A0A078BTK9_CAEEL Loading...

TSC22 domain family protein 1

AlphaFold DB , UniProt , Accession A0A078BTK9, Species CAEEL (Caenorhabditis elegans), Gene n/a, Length 98 aa.

						>A0A078BTK9_CAEEL|A0A078BTK9
MVAEANQSRRTKRAPLVRAKTVVAASPPAHNVLNIDNKIEQAMDLVKTHLMFAVREEVDGLRGKIFDLENHVRRLEAENSILKRTIPNDTLKQLHLKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.8	Very low	50.7	Low	231 Å²	231	159 Å²	159	100%	1.138	83%	0.826	S	S	*	*				0	85.2	0	-74.3	171.1	65.4	0	0	106.2
2	V	41.3	Very low	51.4	Low	140 Å²	140	163.3 Å²	163.3	85%	0.848	83%	0.834	S	S	*	*				74.1	124.7	77.1	178.9	0	0	0	0	111.4
3	A	45.2	Very low	51.7	Low	75 Å²	75	168.5 Å²	168.5	62%	0.62	84%	0.836	S	S	*	*			trans	73.2	144.2	156	0	0	0	0	0	117.4
4	E	49	Very low	52.3	Low	179 Å²	179	162.9 Å²	162.9	84%	0.836	83%	0.83	S	S	*	*			cis	-169.7	127.9	2.4	-112.1	166.8	145.1	0	0	105
5	A	52	Low	52.6	Low	90 Å²	90	159.9 Å²	159.9	74%	0.744	83%	0.826	S	S	*	*				75.1	107.8	93.1	0	0	0	0	0	115.8
6	N	52.8	Low	53.1	Low	155 Å²	155	160.7 Å²	160.7	83%	0.829	83%	0.831	S	S	*	*				81.3	82.6	123.6	-145.9	10.4	0	0	0	118.6	S8	N6-S8 PolarHBondContact O-N 3.18Å
7	Q	55.1	Low	53.4	Low	197 Å²	197	158.8 Å²	158.8	92%	0.921	83%	0.828	S	S	*	*			trans	-75	91.3	162.5	-88.1	165.1	-8.8	0	0	111.6	R9	Q7-R9 PolarHBondContact O-N 3.34Å
8	S	52.9	Low	53.9	Low	97 Å²	97	163 Å²	163	68%	0.678	83%	0.831	S	S	*	*			trans	0.2	97.6	150.2	-158.2	0	0	0	0	117.9	N6 R10	N6-S8 PolarHBondContact O-N 3.18Å; S8-R10 PolarHBondContact O-N 3.28Å; S8-R10 VanDerWaalsContact O-N 3.14Å
9	R	56.4	Low	54.2	Low	238 Å²	238	159 Å²	159	90%	0.898	83%	0.825	S	S	*	*			trans	-71.2	95.2	156.6	-77.8	-177.5	174.7	-166.5	-1.1	109.1	Q7 T11	Q7-R9 PolarHBondContact O-N 3.34Å; R9-T11 PolarHBondContact O-N 3.41Å
10	R	55.7	Low	54.5	Low	234 Å²	234	160.9 Å²	160.9	88%	0.883	83%	0.827	S	S	*	*			trans	-72.4	87.2	169.8	-91.6	174.3	129.8	178.2	-1.7	110.5	S8 K12	S8-R10 PolarHBondContact O-N 3.28Å; S8-R10 VanDerWaalsContact O-N 3.14Å; R10-K12 PolarHBondContact O-N 3.49Å
11	T	54.7	Low	54.6	Low	113 Å²	113	159.2 Å²	159.2	69%	0.693	82%	0.824	S	S	*	*			trans	-76.6	114.7	160.4	54.7	0	0	0	0	108.6	R9 R13	R9-T11 PolarHBondContact O-N 3.41Å; T11-R13 PolarHBondContact O-N 3.25Å
12	K	58.5	Low	55.4	Low	211 Å²	211	154.3 Å²	154.3	92%	0.917	81%	0.807	S	S	*	*			trans	-69.2	92.1	171.3	-68.1	-174.9	-179.8	-176.6	0	109.1	R10	R10-K12 PolarHBondContact O-N 3.49Å
13	R	56.1	Low	56.3	Low	230 Å²	230	153.9 Å²	153.9	87%	0.868	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-90.4	116.5	165.2	-81	-178.5	129	-168.7	-2.8	108.5	T11	T11-R13 PolarHBondContact O-N 3.25Å
14	A	60	Low	57	Low	91 Å²	91	154.5 Å²	154.5	75%	0.752	81%	0.809	S	S	*	*	P	Polyproline II helix	trans	-63.2	148.6	170.6	0	0	0	0	0	110.4
15	P	57.4	Low	57.6	Low	118 Å²	118	150.5 Å²	150.5	77%	0.766	81%	0.806	S	S	*	*	P	Polyproline II helix	trans	-72.1	133.5	177.4	29.6	-31.4	0	0	0	110	V17	P15-V17 PolarHBondContact O-N 3.49Å; P15-V17 VanDerWaalsContact O-N 3.08Å
16	L	59.4	Low	58.1	Low	172 Å²	172	151.2 Å²	151.2	90%	0.901	81%	0.806	S	S	*	*			trans	-65.7	104	171.4	-179.7	65.6	0	0	0	108.3	R18	L16-R18 PolarHBondContact O-N 3.26Å; L16-R18 VanDerWaalsContact O-N 3.11Å
17	V	58.6	Low	58.4	Low	128 Å²	128	149.3 Å²	149.3	78%	0.776	80%	0.802	S	S	*	*			trans	-60	114.7	171.6	-177	0	0	0	0	107.2	P15 A19	P15-V17 PolarHBondContact O-N 3.49Å; P15-V17 VanDerWaalsContact O-N 3.08Å; V17-A19 PolarHBondContact O-N 3.04Å
18	R	62.6	Low	58.6	Low	235 Å²	235	144 Å²	144	89%	0.887	79%	0.785	S	S	*	*			trans	-59.1	107.4	177.8	-172.5	170.1	179.3	-175.7	-0.8	108	L16 K20	L16-R18 PolarHBondContact O-N 3.26Å; L16-R18 VanDerWaalsContact O-N 3.11Å; R18-K20 PolarHBondContact O-N 3.12Å
19	A	59.7	Low	58.9	Low	87 Å²	87	143 Å²	143	72%	0.719	78%	0.782	S	S	*	*			trans	-55.6	114.2	171.3	0	0	0	0	0	107.7	V17 T21	V17-A19 PolarHBondContact O-N 3.04Å; A19-T21 PolarHBondContact O-N 3.46Å; A19-T21 VanDerWaalsContact O-N 3.09Å
20	K	59.4	Low	58.9	Low	197 Å²	197	138.5 Å²	138.5	86%	0.857	77%	0.771	S	S	*	*			trans	-69.6	104.6	171.7	-149.9	175.9	-172.5	-176.2	0	105.1	R18 V22	R18-K20 PolarHBondContact O-N 3.12Å; K20-V22 PolarHBondContact O-N 3.09Å
21	T	56.6	Low	59.1	Low	125 Å²	125	132.4 Å²	132.4	77%	0.767	76%	0.756	S	S	*	*			trans	-57.5	106.8	171.8	-40.9	0	0	0	0	106.7	A19 V23	A19-T21 PolarHBondContact O-N 3.46Å; A19-T21 VanDerWaalsContact O-N 3.09Å; T21-V23 PolarHBondContact O-N 3.23Å
22	V	60	Low	59.4	Low	129 Å²	129	131.3 Å²	131.3	78%	0.782	75%	0.749	S	S	*	*			trans	-66.7	107.7	169.9	-173.7	0	0	0	0	104.4	K20 A24	K20-V22 PolarHBondContact O-N 3.09Å; V22-A24 PolarHBondContact O-N 3.13Å
23	V	60	Low	59.6	Low	131 Å²	131	126.5 Å²	126.5	79%	0.794	73%	0.733	S	S	*	*			trans	-61.8	105.7	172.2	-174.6	0	0	0	0	105.1	T21 A25	T21-V23 PolarHBondContact O-N 3.23Å; V23-A25 PolarHBondContact O-N 3.43Å
24	A	59.6	Low	60.8	Low	87 Å²	87	119.6 Å²	119.6	72%	0.719	71%	0.713	S	S	*	*			trans	-57.2	114	173	0	0	0	0	0	106.9	V22 S26	V22-A24 PolarHBondContact O-N 3.13Å; A24-S26 PolarHBondContact O-N 3.07Å; A24-S26 VanDerWaalsContact O-N 3.15Å
25	A	61.6	Low	62.3	Low	95 Å²	95	119.8 Å²	119.8	79%	0.785	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-59.6	118.5	168.8	0	0	0	0	0	107.1	V23	V23-A25 PolarHBondContact O-N 3.43Å
26	S	62.6	Low	64	Low	106 Å²	106	118 Å²	118	74%	0.741	68%	0.684	S	S	*	*	P	Polyproline II helix	trans	-51.9	140.2	169.2	-74.8	0	0	0	0	109.3	A24	A24-S26 PolarHBondContact O-N 3.07Å; A24-S26 VanDerWaalsContact O-N 3.15Å
27	P	60.1	Low	65.6	Low	115 Å²	115	113.6 Å²	113.6	75%	0.747	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-57.3	139.8	173.9	-6.9	17.3	0	0	0	108.6	A29	P27-A29 PolarHBondContact O-N 3.05Å
28	P	58	Low	67.3	Low	86 Å²	86	113.3 Å²	113.3	56%	0.558	65%	0.65	S	S	*	*	P	Polyproline II helix	trans	-65	128.5	-176	27.2	-32.9	0	0	0	109.2	H30 N31	P28-H30 HydrophobicContact CB-CB 4.08Å; P28-H30 PolarHBondContact O-N 2.91Å; P28-N31 PolarHBondContact O-N 2.86Å
29	A	59.3	Low	68.9	Low	75 Å²	75	106.2 Å²	106.2	62%	0.62	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55	-3	170.6	0	0	0	0	0	113.9	P27 N31 V32	P27-A29 PolarHBondContact O-N 3.05Å; A29-N31 PolarHBondContact O-N 3.5Å; A29-V32 PolarHBondContact O-N 3.36Å
30	H	57.8	Low	70.6	Confident	144 Å²	144	107.9 Å²	107.9	67%	0.667	62%	0.622	S	S	*	*	H	α-helix	trans	-61.1	-26.9	175.9	-136.5	-19.6	0	0	0	113.8	P28	P28-H30 HydrophobicContact CB-CB 4.08Å; P28-H30 PolarHBondContact O-N 2.91Å
31	N	58.8	Low	72.3	Confident	105 Å²	105	104.7 Å²	104.7	56%	0.561	61%	0.61	S	S	*	*	H	α-helix	trans	-78.2	-32.3	-179.7	-70.3	-15.1	0	0	0	113.2	P28 A29 I35	P28-N31 PolarHBondContact O-N 2.86Å; A29-N31 PolarHBondContact O-N 3.5Å; N31-I35 WeakPolarHBondContact O-CD1 3.32Å; N31-I35 WeakPolarHBondContact O-CG1 3.32Å; N31-I35 PolarHBondContact O-N 2.9Å
32	V	60.4	Low	74.3	Confident	90 Å²	90	101.3 Å²	101.3	55%	0.545	60%	0.595	S	S	.	*	H	α-helix	trans	-74.1	-45.7	-178.4	-177	0	0	0	0	110.4	A29 N34 I35 D36	A29-V32 PolarHBondContact O-N 3.36Å; V32-N34 PolarHBondContact O-N 3.43Å; V32-N34 VanDerWaalsContact O-N 3.15Å; V32-I35 PolarHBondContact O-N 3.48Å; V32-D36 PolarHBondContact O-N 3.25Å
33	L	63.8	Low	76.1	Confident	111 Å²	111	100.9 Å²	100.9	58%	0.581	59%	0.586	S	S	*	*	H	α-helix	trans	-59.8	-27.9	175.7	-63.1	174.9	0	0	0	113.1	N37	L33-N37 PolarHBondContact O-N 2.9Å; L33-N37 PolarHBondContact O-ND2 3.21Å
34	N	81.5	Confident	77.9	Confident	85 Å²	85	98.6 Å²	98.6	46%	0.455	57%	0.569	S	S	.	*	H	α-helix	trans	-80.4	-26.2	177.7	-164.7	24.3	0	0	0	112.7	V32 K38	V32-N34 PolarHBondContact O-N 3.43Å; V32-N34 VanDerWaalsContact O-N 3.15Å; N34-K38 WeakPolarHBondContact O-CD 3.28Å; N34-K38 VanDerWaalsContact O-CG 3.29Å; N34-K38 WeakPolarHBondContact O-CG 3.3Å; N34-K38 PolarHBondContact O-N 3.33Å
35	I	90.5	Very high	79.7	Confident	94 Å²	94	100.4 Å²	100.4	48%	0.482	57%	0.566	S	S	.	*	H	α-helix	trans	-75	-45.4	176.4	-68.7	164.5	0	0	0	109.7	N31 V32 N37 K38 I39	N31-I35 WeakPolarHBondContact O-CD1 3.32Å; N31-I35 WeakPolarHBondContact O-CG1 3.32Å; N31-I35 PolarHBondContact O-N 2.9Å; V32-I35 PolarHBondContact O-N 3.48Å; I35-N37 VanDerWaalsContact C-N 3.3Å; I35-N37 PolarHBondContact O-N 3.04Å; I35-K38 WeakPolarHBondContact O-CB 3.49Å; I35-K38 PolarHBondContact O-N 3.06Å; I35-I39 HydrophobicContact CG2-CD1 3.75Å; I35-I39 HydrophobicContact CG2-CG1 4.28Å; I35-I39 WeakPolarHBondContact O-CG1 3.04Å; I35-I39 PolarHBondContact O-N 3.22Å
36	D	93.6	Very high	81.5	Confident	80 Å²	80	100 Å²	100	43%	0.428	55%	0.554	S	S	.	*	H	α-helix	trans	-58	-44.8	178.2	-62.3	-24.8	0	0	0	110.9	V32 K38 I39 E40	V32-D36 PolarHBondContact O-N 3.25Å; D36-K38 VanDerWaalsContact C-N 3.32Å; D36-K38 PolarHBondContact O-N 2.78Å; D36-I39 WeakPolarHBondContact O-CB 3.13Å; D36-I39 PolarHBondContact O-N 3.12Å; D36-I39 VanDerWaalsContact O-N 3.16Å; D36-E40 WeakPolarHBondContact O-CG 3.35Å; D36-E40 PolarHBondContact O-N 3.44Å
37	N	93.1	Very high	83.2	Confident	81 Å²	81	100.1 Å²	100.1	43%	0.433	54%	0.541	S	S	.	.	H	α-helix	trans	-61.3	-36.7	174.9	-70.1	-14	0	0	0	113.4	L33 I35 Q41	L33-N37 PolarHBondContact O-N 2.9Å; L33-N37 PolarHBondContact O-ND2 3.21Å; I35-N37 VanDerWaalsContact C-N 3.3Å; I35-N37 PolarHBondContact O-N 3.04Å; N37-Q41 WeakPolarHBondContact O-CB 3.45Å; N37-Q41 WeakPolarHBondContact O-CG 3.18Å; N37-Q41 PolarHBondContact O-N 3.19Å; N37-Q41 PolarHBondContact O-NE2 2.97Å
38	K	94.4	Very high	85	Confident	122 Å²	122	97.3 Å²	97.3	53%	0.53	52%	0.522	S	S	.	.	H	α-helix	trans	-72	-35.4	176.6	-77.8	171	175.4	-73.8	0	111.7	N34 I35 D36 A42	N34-K38 WeakPolarHBondContact O-CD 3.28Å; N34-K38 VanDerWaalsContact O-CG 3.29Å; N34-K38 WeakPolarHBondContact O-CG 3.3Å; N34-K38 PolarHBondContact O-N 3.33Å; I35-K38 WeakPolarHBondContact O-CB 3.49Å; I35-K38 PolarHBondContact O-N 3.06Å; D36-K38 VanDerWaalsContact C-N 3.32Å; D36-K38 PolarHBondContact O-N 2.78Å; K38-A42 WeakPolarHBondContact O-CB 3.43Å; K38-A42 PolarHBondContact O-N 3.29Å
39	I	95.5	Very high	86.9	Confident	86 Å²	86	99.6 Å²	99.6	44%	0.441	53%	0.525	S	S	.	.	H	α-helix	trans	-65.7	-47.4	173.8	-68.1	169	0	0	0	109.5	I35 D36 Q41 A42 M43	I35-I39 HydrophobicContact CG2-CD1 3.75Å; I35-I39 HydrophobicContact CG2-CG1 4.28Å; I35-I39 WeakPolarHBondContact O-CG1 3.04Å; I35-I39 PolarHBondContact O-N 3.22Å; D36-I39 WeakPolarHBondContact O-CB 3.13Å; D36-I39 PolarHBondContact O-N 3.12Å; D36-I39 VanDerWaalsContact O-N 3.16Å; I39-Q41 PolarHBondContact O-N 2.8Å; I39-A42 PolarHBondContact O-N 2.83Å; I39-M43 HydrophobicContact CG2-CG 4.35Å; I39-M43 HydrophobicContact CG2-SD 3.95Å; I39-M43 WeakPolarHBondContact O-CB 3.34Å; I39-M43 WeakPolarHBondContact O-CG 3.48Å; I39-M43 PolarHBondContact O-N 3.5Å
40	E	95.9	Very high	88.8	Confident	122 Å²	122	100.9 Å²	100.9	57%	0.57	52%	0.521	S	S	*	.	H	α-helix	trans	-58.6	-45.4	176.4	-74.4	-167.7	154.8	0	0	111.8	D36 A42 M43 D44	D36-E40 WeakPolarHBondContact O-CG 3.35Å; D36-E40 PolarHBondContact O-N 3.44Å; E40-A42 PolarHBondContact O-N 2.93Å; E40-M43 PolarHBondContact O-N 3.06Å; E40-D44 PolarHBondContact O-N 2.88Å
41	Q	96.1	Very high	90.7	Very high	129 Å²	129	99.4 Å²	99.4	60%	0.603	52%	0.515	S	S	*	.	H	α-helix	trans	-59.9	-43.9	175.7	-75.4	168.7	41	0	0	112.7	N37 I39 M43 D44 L45	N37-Q41 WeakPolarHBondContact O-CB 3.45Å; N37-Q41 WeakPolarHBondContact O-CG 3.18Å; N37-Q41 PolarHBondContact O-N 3.19Å; N37-Q41 PolarHBondContact O-NE2 2.97Å; I39-Q41 PolarHBondContact O-N 2.8Å; Q41-M43 VanDerWaalsContact C-N 3.34Å; Q41-D44 PolarHBondContact O-N 3.2Å; Q41-L45 WeakPolarHBondContact O-CB 3.46Å; Q41-L45 PolarHBondContact O-N 3.12Å
42	A	97.5	Very high	92.6	Very high	55 Å²	55	100.4 Å²	100.4	46%	0.455	52%	0.515	S	S	.	.	H	α-helix	trans	-64.6	-40.7	176.9	0	0	0	0	0	111.3	K38 I39 E40 L45 V46	K38-A42 WeakPolarHBondContact O-CB 3.43Å; K38-A42 PolarHBondContact O-N 3.29Å; I39-A42 PolarHBondContact O-N 2.83Å; E40-A42 PolarHBondContact O-N 2.93Å; A42-L45 PolarHBondContact O-N 3.4Å; A42-V46 VanDerWaalsContact O-CG2 3.28Å; A42-V46 WeakPolarHBondContact O-CG2 3.37Å; A42-V46 PolarHBondContact O-N 3.2Å
43	M	97.9	Very high	94.4	Very high	119 Å²	119	97.8 Å²	97.8	59%	0.586	50%	0.503	S	S	*	.	H	α-helix	trans	-65	-43.4	176.6	-75.3	-179.2	64.2	0	0	112.4	I39 E40 Q41 L45 V46 K47	I39-M43 HydrophobicContact CG2-CG 4.35Å; I39-M43 HydrophobicContact CG2-SD 3.95Å; I39-M43 WeakPolarHBondContact O-CB 3.34Å; I39-M43 WeakPolarHBondContact O-CG 3.48Å; I39-M43 PolarHBondContact O-N 3.5Å; E40-M43 PolarHBondContact O-N 3.06Å; Q41-M43 VanDerWaalsContact C-N 3.34Å; M43-L45 VanDerWaalsContact C-N 3.32Å; M43-V46 PolarHBondContact O-N 3.35Å; M43-K47 VanDerWaalsContact O-CB 3.28Å; M43-K47 WeakPolarHBondContact O-CB 3.49Å; M43-K47 PolarHBondContact O-N 3.46Å
44	D	97.8	Very high	96	Very high	83 Å²	83	96.8 Å²	96.8	44%	0.444	50%	0.501	S	S	.	.	H	α-helix	trans	-67.9	-34.3	178	-79.7	-21.4	0	0	0	112.1	E40 Q41 K47 T48	E40-D44 PolarHBondContact O-N 2.88Å; Q41-D44 PolarHBondContact O-N 3.2Å; D44-K47 PolarHBondContact O-N 2.85Å; D44-K47 IonicContact OD1-NZ 2.81Å; D44-K47 PolarHBondContact OD1-NZ 2.91Å; D44-T48 VanDerWaalsContact O-CB 3.31Å; D44-T48 WeakPolarHBondContact O-CB 3.27Å; D44-T48 PolarHBondContact O-N 3.24Å; D44-T48 PolarHBondContact O-OG1 3.45Å
45	L	98	Very high	96.8	Very high	126 Å²	126	100.7 Å²	100.7	66%	0.66	51%	0.509	S	S	*	.	H	α-helix	trans	-63.8	-47.9	171.1	-177	63.6	0	0	0	111.3	Q41 A42 M43 K47 T48 H49	Q41-L45 WeakPolarHBondContact O-CB 3.46Å; Q41-L45 PolarHBondContact O-N 3.12Å; A42-L45 PolarHBondContact O-N 3.4Å; M43-L45 VanDerWaalsContact C-N 3.32Å; L45-K47 VanDerWaalsContact C-N 3.34Å; L45-K47 PolarHBondContact O-N 3.16Å; L45-T48 PolarHBondContact O-N 3.11Å; L45-H49 WeakPolarHBondContact O-CB 3.38Å; L45-H49 PolarHBondContact O-N 3.43Å
46	V	98.3	Very high	97.2	Very high	86 Å²	86	103 Å²	103	52%	0.521	52%	0.518	S	S	.	.	H	α-helix	trans	-60.7	-44.8	176.9	168.6	0	0	0	0	110.8	A42 M43 T48 H49 L50	A42-V46 VanDerWaalsContact O-CG2 3.28Å; A42-V46 WeakPolarHBondContact O-CG2 3.37Å; A42-V46 PolarHBondContact O-N 3.2Å; M43-V46 PolarHBondContact O-N 3.35Å; V46-T48 VanDerWaalsContact C-N 3.33Å; V46-T48 PolarHBondContact O-N 3.45Å; V46-H49 PolarHBondContact O-N 3.45Å; V46-L50 HydrophobicContact CG1-CD1 3.95Å; V46-L50 HydrophobicContact CG1-CG 4.34Å; V46-L50 WeakPolarHBondContact O-CB 3.3Å; V46-L50 WeakPolarHBondContact O-CG 3.49Å; V46-L50 PolarHBondContact O-N 3Å
47	K	98.4	Very high	97.4	Very high	108 Å²	108	105.6 Å²	105.6	47%	0.47	53%	0.528	S	S	.	.	H	α-helix	trans	-58.3	-47.5	177.2	-173.9	-171.2	-65.5	150.4	0	110.7	M43 D44 L45 L50 M51	M43-K47 VanDerWaalsContact O-CB 3.28Å; M43-K47 WeakPolarHBondContact O-CB 3.49Å; M43-K47 PolarHBondContact O-N 3.46Å; D44-K47 PolarHBondContact O-N 2.85Å; D44-K47 IonicContact OD1-NZ 2.81Å; D44-K47 PolarHBondContact OD1-NZ 2.91Å; L45-K47 VanDerWaalsContact C-N 3.34Å; L45-K47 PolarHBondContact O-N 3.16Å; K47-L50 PolarHBondContact O-N 3.06Å; K47-M51 HydrophobicContact CG-CE 4.2Å; K47-M51 WeakPolarHBondContact O-CB 3.3Å; K47-M51 VanDerWaalsContact O-CG 3.28Å; K47-M51 WeakPolarHBondContact O-CG 3.38Å; K47-M51 PolarHBondContact O-N 3.49Å
48	T	98.1	Very high	97.7	Very high	56 Å²	56	104.4 Å²	104.4	34%	0.344	52%	0.523	S	S	.	.	H	α-helix	trans	-61.9	-45.9	177.9	-59.2	0	0	0	0	111.5	D44 L45 V46 L50 M51 F52	D44-T48 VanDerWaalsContact O-CB 3.31Å; D44-T48 WeakPolarHBondContact O-CB 3.27Å; D44-T48 PolarHBondContact O-N 3.24Å; D44-T48 PolarHBondContact O-OG1 3.45Å; L45-T48 PolarHBondContact O-N 3.11Å; V46-T48 VanDerWaalsContact C-N 3.33Å; V46-T48 PolarHBondContact O-N 3.45Å; T48-L50 PolarHBondContact O-N 3.36Å; T48-M51 PolarHBondContact O-N 3.42Å; T48-F52 HydrophobicContact CG2-CD2 3.69Å; T48-F52 HydrophobicContact CG2-CE2 3.36Å; T48-F52 WeakPolarHBondContact O-CD2 3.43Å; T48-F52 PolarHBondContact O-N 2.92Å
49	H	98.3	Very high	97.9	Very high	135 Å²	135	102.2 Å²	102.2	63%	0.625	52%	0.517	S	S	*	.	H	α-helix	trans	-61.7	-44.6	178.1	-169.8	61.8	0	0	0	112.3	L45 V46 F52 A53	L45-H49 WeakPolarHBondContact O-CB 3.38Å; L45-H49 PolarHBondContact O-N 3.43Å; V46-H49 PolarHBondContact O-N 3.45Å; H49-F52 PolarHBondContact O-N 3.46Å; H49-A53 WeakPolarHBondContact O-CB 3.44Å; H49-A53 PolarHBondContact O-N 3.32Å
50	L	98.5	Very high	98	Very high	102 Å²	102	100.3 Å²	100.3	53%	0.534	52%	0.519	S	S	.	.	H	α-helix	trans	-64.3	-41.4	176.4	-72.3	175.9	0	0	0	112.1	V46 K47 T48 F52 A53 V54	V46-L50 HydrophobicContact CG1-CD1 3.95Å; V46-L50 HydrophobicContact CG1-CG 4.34Å; V46-L50 WeakPolarHBondContact O-CB 3.3Å; V46-L50 WeakPolarHBondContact O-CG 3.49Å; V46-L50 PolarHBondContact O-N 3Å; K47-L50 PolarHBondContact O-N 3.06Å; T48-L50 PolarHBondContact O-N 3.36Å; L50-F52 VanDerWaalsContact C-N 3.31Å; L50-F52 PolarHBondContact O-N 2.75Å; L50-A53 PolarHBondContact O-N 3.41Å; L50-V54 VanDerWaalsContact O-CB 3.27Å; L50-V54 WeakPolarHBondContact O-CB 3.39Å; L50-V54 WeakPolarHBondContact O-CG2 3.27Å; L50-V54 PolarHBondContact O-N 2.9Å
51	M	97.8	Very high	98.2	Very high	113 Å²	113	99.6 Å²	99.6	56%	0.557	52%	0.519	S	S	*	.	H	α-helix	trans	-59.7	-43.4	176.2	-75.8	-172.2	-60.7	0	0	111.6	K47 T48 R55	K47-M51 HydrophobicContact CG-CE 4.2Å; K47-M51 WeakPolarHBondContact O-CB 3.3Å; K47-M51 VanDerWaalsContact O-CG 3.28Å; K47-M51 WeakPolarHBondContact O-CG 3.38Å; K47-M51 PolarHBondContact O-N 3.49Å; T48-M51 PolarHBondContact O-N 3.42Å; M51-R55 VanDerWaalsContact O-CB 3.24Å; M51-R55 WeakPolarHBondContact O-CB 3.37Å; M51-R55 PolarHBondContact O-N 2.97Å; M51-R55 VanDerWaalsContact O-N 3.09Å
52	F	98.4	Very high	98.3	Very high	125 Å²	125	101 Å²	101	55%	0.548	52%	0.519	S	S	.	.	H	α-helix	trans	-66.7	-51.6	176.4	-76	-61.8	0	0	0	111.9	T48 H49 L50 V54 R55 E56	T48-F52 HydrophobicContact CG2-CD2 3.69Å; T48-F52 HydrophobicContact CG2-CE2 3.36Å; T48-F52 WeakPolarHBondContact O-CD2 3.43Å; T48-F52 PolarHBondContact O-N 2.92Å; H49-F52 PolarHBondContact O-N 3.46Å; L50-F52 VanDerWaalsContact C-N 3.31Å; L50-F52 PolarHBondContact O-N 2.75Å; F52-V54 PolarHBondContact O-N 3.22Å; F52-R55 WeakPolarHBondContact O-CB 3.44Å; F52-R55 PolarHBondContact O-N 3.23Å; F52-R55 VanDerWaalsContact O-N 3.11Å; F52-E56 WeakPolarHBondContact O-CG 3.27Å; F52-E56 PolarHBondContact O-N 3.42Å
53	A	98.4	Very high	98.3	Very high	36 Å²	36	99.9 Å²	99.9	30%	0.298	51%	0.513	S	S	.	.	H	α-helix	trans	-58.2	-46.6	-178.9	0	0	0	0	0	111.8	H49 L50 R55 E56 E57	H49-A53 WeakPolarHBondContact O-CB 3.44Å; H49-A53 PolarHBondContact O-N 3.32Å; L50-A53 PolarHBondContact O-N 3.41Å; A53-R55 VanDerWaalsContact C-N 3.33Å; A53-R55 PolarHBondContact O-N 2.99Å; A53-E56 PolarHBondContact O-N 3.49Å; A53-E57 WeakPolarHBondContact O-CB 3.48Å; A53-E57 VanDerWaalsContact O-CG 3.31Å; A53-E57 WeakPolarHBondContact O-CG 3.17Å; A53-E57 PolarHBondContact O-N 2.9Å
54	V	98.5	Very high	98.4	Very high	89 Å²	89	100.1 Å²	100.1	54%	0.539	51%	0.51	S	S	.	.	H	α-helix	trans	-63.2	-40.9	177.7	172	0	0	0	0	111.1	L50 F52 V58	L50-V54 VanDerWaalsContact O-CB 3.27Å; L50-V54 WeakPolarHBondContact O-CB 3.39Å; L50-V54 WeakPolarHBondContact O-CG2 3.27Å; L50-V54 PolarHBondContact O-N 2.9Å; F52-V54 PolarHBondContact O-N 3.22Å; V54-V58 HydrophobicContact CG1-CG2 4.37Å; V54-V58 WeakPolarHBondContact O-CB 3.43Å; V54-V58 VanDerWaalsContact O-CG2 3.23Å; V54-V58 WeakPolarHBondContact O-CG2 3.39Å; V54-V58 PolarHBondContact O-N 3.31Å
55	R	98.3	Very high	98.4	Very high	167 Å²	167	100.6 Å²	100.6	63%	0.63	51%	0.512	S	S	*	.	H	α-helix	trans	-63.3	-47	177.6	-178.9	176.6	-179.7	171.7	1.1	111.6	M51 F52 A53 V58 D59	M51-R55 VanDerWaalsContact O-CB 3.24Å; M51-R55 WeakPolarHBondContact O-CB 3.37Å; M51-R55 PolarHBondContact O-N 2.97Å; M51-R55 VanDerWaalsContact O-N 3.09Å; F52-R55 WeakPolarHBondContact O-CB 3.44Å; F52-R55 PolarHBondContact O-N 3.23Å; F52-R55 VanDerWaalsContact O-N 3.11Å; A53-R55 VanDerWaalsContact C-N 3.33Å; A53-R55 PolarHBondContact O-N 2.99Å; R55-V58 PolarHBondContact O-N 2.98Å; R55-D59 IonicContact NE-OD2 3.8Å; R55-D59 WeakPolarHBondContact O-CB 3.5Å; R55-D59 PolarHBondContact O-N 3.43Å
56	E	98.5	Very high	98.4	Very high	144 Å²	144	100.5 Å²	100.5	67%	0.673	51%	0.506	S	S	*	.	H	α-helix	trans	-61.3	-44.4	178.4	-72.8	-173.4	123.2	0	0	111.7	F52 A53 V58 D59 G60	F52-E56 WeakPolarHBondContact O-CG 3.27Å; F52-E56 PolarHBondContact O-N 3.42Å; A53-E56 PolarHBondContact O-N 3.49Å; E56-V58 PolarHBondContact O-N 3.12Å; E56-D59 PolarHBondContact O-N 2.97Å; E56-G60 PolarHBondContact O-N 3.36Å
57	E	98.5	Very high	98.4	Very high	134 Å²	134	101.1 Å²	101.1	63%	0.626	51%	0.507	S	S	*	.	H	α-helix	trans	-61.5	-43.6	176	-72.5	-64	155.6	0	0	111.8	A53 G60 L61	A53-E57 WeakPolarHBondContact O-CB 3.48Å; A53-E57 VanDerWaalsContact O-CG 3.31Å; A53-E57 WeakPolarHBondContact O-CG 3.17Å; A53-E57 PolarHBondContact O-N 2.9Å; E57-G60 PolarHBondContact O-N 3.5Å; E57-L61 WeakPolarHBondContact O-CB 3.49Å; E57-L61 VanDerWaalsContact O-CG 3.27Å; E57-L61 WeakPolarHBondContact O-CG 3Å; E57-L61 PolarHBondContact O-N 3.5Å
58	V	98.6	Very high	98.5	Very high	56 Å²	56	100 Å²	100	34%	0.339	51%	0.506	S	S	.	.	H	α-helix	trans	-64.5	-44.9	177.7	168.1	0	0	0	0	111.5	V54 R55 E56 G60 L61 R62	V54-V58 HydrophobicContact CG1-CG2 4.37Å; V54-V58 WeakPolarHBondContact O-CB 3.43Å; V54-V58 VanDerWaalsContact O-CG2 3.23Å; V54-V58 WeakPolarHBondContact O-CG2 3.39Å; V54-V58 PolarHBondContact O-N 3.31Å; R55-V58 PolarHBondContact O-N 2.98Å; E56-V58 PolarHBondContact O-N 3.12Å; V58-G60 VanDerWaalsContact C-N 3.33Å; V58-L61 PolarHBondContact O-N 3.09Å; V58-R62 WeakPolarHBondContact O-CB 3.34Å; V58-R62 VanDerWaalsContact O-CG 3.28Å; V58-R62 WeakPolarHBondContact O-CG 3.45Å; V58-R62 PolarHBondContact O-N 3.11Å
59	D	98.6	Very high	98.5	Very high	75 Å²	75	102.2 Å²	102.2	40%	0.401	51%	0.512	S	S	.	.	H	α-helix	trans	-67.2	-37.2	179.5	-71.7	-20.1	0	0	0	110.9	R55 E56 R62 G63	R55-D59 IonicContact NE-OD2 3.8Å; R55-D59 WeakPolarHBondContact O-CB 3.5Å; R55-D59 PolarHBondContact O-N 3.43Å; E56-D59 PolarHBondContact O-N 2.97Å; D59-R62 PolarHBondContact O-N 3.37Å; D59-R62 IonicContact OD1-NH1 3.37Å; D59-R62 PolarHBondContact OD1-NH1 3.36Å; D59-G63 PolarHBondContact O-N 3.37Å
60	G	98.6	Very high	98.5	Very high	47 Å²	47	97.5 Å²	97.5	49%	0.485	49%	0.491	S	S	.	.	H	α-helix	trans	-62.2	-46.8	172.3	0	0	0	0	0	113	E56 E57 V58 R62 G63 K64	E56-G60 PolarHBondContact O-N 3.36Å; E57-G60 PolarHBondContact O-N 3.5Å; V58-G60 VanDerWaalsContact C-N 3.33Å; G60-R62 PolarHBondContact O-N 2.96Å; G60-G63 PolarHBondContact O-N 2.94Å; G60-K64 PolarHBondContact O-N 3.4Å
61	L	98.8	Very high	98.5	Very high	107 Å²	107	96.6 Å²	96.6	56%	0.56	48%	0.484	S	S	*	.	H	α-helix	trans	-62.8	-41.8	176.1	-72.7	173.2	0	0	0	112	E57 V58 G63 K64 I65	E57-L61 WeakPolarHBondContact O-CB 3.49Å; E57-L61 VanDerWaalsContact O-CG 3.27Å; E57-L61 WeakPolarHBondContact O-CG 3Å; E57-L61 PolarHBondContact O-N 3.5Å; V58-L61 PolarHBondContact O-N 3.09Å; L61-G63 PolarHBondContact O-N 3.44Å; L61-K64 PolarHBondContact O-N 3.43Å; L61-I65 VanDerWaalsContact O-CG1 3.3Å; L61-I65 WeakPolarHBondContact O-CG1 3.47Å; L61-I65 PolarHBondContact O-N 2.88Å
62	R	98.6	Very high	98.5	Very high	158 Å²	158	94.6 Å²	94.6	60%	0.596	48%	0.478	S	S	*	.	H	α-helix	trans	-60.3	-44.1	175.2	-76.9	171.2	172.4	165.4	-3	112.1	V58 D59 G60 K64 I65 F66	V58-R62 WeakPolarHBondContact O-CB 3.34Å; V58-R62 VanDerWaalsContact O-CG 3.28Å; V58-R62 WeakPolarHBondContact O-CG 3.45Å; V58-R62 PolarHBondContact O-N 3.11Å; D59-R62 PolarHBondContact O-N 3.37Å; D59-R62 IonicContact OD1-NH1 3.37Å; D59-R62 PolarHBondContact OD1-NH1 3.36Å; G60-R62 PolarHBondContact O-N 2.96Å; R62-K64 VanDerWaalsContact C-N 3.34Å; R62-K64 PolarHBondContact O-N 2.89Å; R62-I65 PolarHBondContact O-N 3.31Å; R62-F66 WeakPolarHBondContact O-CB 3.18Å; R62-F66 PolarHBondContact O-N 3.5Å
63	G	98.7	Very high	98.5	Very high	32 Å²	32	95.2 Å²	95.2	33%	0.33	48%	0.477	S	S	.	.	H	α-helix	trans	-59.4	-45.5	174	0	0	0	0	0	111.7	D59 G60 L61 I65 F66 D67	D59-G63 PolarHBondContact O-N 3.37Å; G60-G63 PolarHBondContact O-N 2.94Å; L61-G63 PolarHBondContact O-N 3.44Å; G63-I65 PolarHBondContact O-N 2.84Å; G63-F66 WeakPolarHBondContact O-CB 3.23Å; G63-F66 PolarHBondContact O-N 3.47Å; G63-D67 PolarHBondContact O-N 3.37Å
64	K	98.5	Very high	98.5	Very high	123 Å²	123	99.9 Å²	99.9	54%	0.535	49%	0.487	S	S	.	.	H	α-helix	trans	-62.3	-41.6	178.3	-173.6	58.4	175.5	-178.5	0	112.8	G60 L61 R62 D67 L68	G60-K64 PolarHBondContact O-N 3.4Å; L61-K64 PolarHBondContact O-N 3.43Å; R62-K64 VanDerWaalsContact C-N 3.34Å; R62-K64 PolarHBondContact O-N 2.89Å; K64-D67 PolarHBondContact O-N 3.47Å; K64-L68 HydrophobicContact CD-CD1 4.37Å; K64-L68 HydrophobicContact CD-CG 4.41Å; K64-L68 HydrophobicContact CG-CD1 4.09Å; K64-L68 WeakPolarHBondContact O-CB 3.28Å; K64-L68 VanDerWaalsContact O-CG 3.27Å; K64-L68 WeakPolarHBondContact O-CG 3.37Å; K64-L68 PolarHBondContact O-N 2.92Å
65	I	98.6	Very high	98.4	Very high	93 Å²	93	99.3 Å²	99.3	48%	0.477	48%	0.48	S	S	.	.	H	α-helix	trans	-60.5	-49.8	175.3	-70.2	164.9	0	0	0	109.8	L61 R62 G63 D67 L68 E69	L61-I65 VanDerWaalsContact O-CG1 3.3Å; L61-I65 WeakPolarHBondContact O-CG1 3.47Å; L61-I65 PolarHBondContact O-N 2.88Å; R62-I65 PolarHBondContact O-N 3.31Å; G63-I65 PolarHBondContact O-N 2.84Å; I65-D67 VanDerWaalsContact C-N 3.34Å; I65-D67 PolarHBondContact O-N 2.88Å; I65-L68 PolarHBondContact O-N 2.99Å; I65-E69 HydrophobicContact CG2-CG 4.24Å; I65-E69 WeakPolarHBondContact O-CG 3.31Å; I65-E69 PolarHBondContact O-N 2.81Å
66	F	98.5	Very high	98.3	Very high	125 Å²	125	97.4 Å²	97.4	55%	0.548	48%	0.479	S	S	.	.	H	α-helix	trans	-57.3	-44.8	179.8	179.2	-102.2	0	0	0	112.6	R62 G63 E69 N70	R62-F66 WeakPolarHBondContact O-CB 3.18Å; R62-F66 PolarHBondContact O-N 3.5Å; G63-F66 WeakPolarHBondContact O-CB 3.23Å; G63-F66 PolarHBondContact O-N 3.47Å; F66-E69 PolarHBondContact O-N 3.29Å; F66-N70 VanDerWaalsContact CD1-ND2 3.34Å; F66-N70 WeakPolarHBondContact CD1-ND2 3.38Å; F66-N70 WeakPolarHBondContact CE1-ND2 3.42Å; F66-N70 WeakPolarHBondContact CZ-ND2 3.33Å; F66-N70 WeakPolarHBondContact O-CB 3.42Å; F66-N70 VanDerWaalsContact O-CG 3.24Å; F66-N70 PolarHBondContact O-N 3.44Å; F66-N70 PolarHBondContact O-ND2 2.88Å; F66-N70 VanDerWaalsContact O-ND2 3.12Å
67	D	98.5	Very high	98.2	Very high	98 Å²	98	93.2 Å²	93.2	52%	0.524	47%	0.468	S	S	.	.	H	α-helix	trans	-64.9	-41.7	178.3	-72.5	-20.9	0	0	0	112.5	G63 K64 I65 N70 H71	G63-D67 PolarHBondContact O-N 3.37Å; K64-D67 PolarHBondContact O-N 3.47Å; I65-D67 VanDerWaalsContact C-N 3.34Å; I65-D67 PolarHBondContact O-N 2.88Å; D67-N70 PolarHBondContact O-N 3.42Å; D67-H71 WeakPolarHBondContact O-CB 3.27Å; D67-H71 PolarHBondContact O-N 3.31Å
68	L	98.7	Very high	98	Very high	86 Å²	86	91.8 Å²	91.8	45%	0.45	46%	0.462	S	S	.	.	H	α-helix	trans	-65.4	-44.5	177.2	-74.2	171.8	0	0	0	111.4	K64 I65 N70 H71 V72	K64-L68 HydrophobicContact CD-CD1 4.37Å; K64-L68 HydrophobicContact CD-CG 4.41Å; K64-L68 HydrophobicContact CG-CD1 4.09Å; K64-L68 WeakPolarHBondContact O-CB 3.28Å; K64-L68 VanDerWaalsContact O-CG 3.27Å; K64-L68 WeakPolarHBondContact O-CG 3.37Å; K64-L68 PolarHBondContact O-N 2.92Å; I65-L68 PolarHBondContact O-N 2.99Å; L68-N70 VanDerWaalsContact C-N 3.33Å; L68-N70 PolarHBondContact O-N 3.43Å; L68-H71 WeakPolarHBondContact O-CB 3.46Å; L68-H71 PolarHBondContact O-N 3.31Å; L68-H71 VanDerWaalsContact O-N 3.16Å; L68-V72 WeakPolarHBondContact O-CG2 3.28Å; L68-V72 PolarHBondContact O-N 2.92Å
69	E	98.4	Very high	97.7	Very high	102 Å²	102	92.9 Å²	92.9	48%	0.477	47%	0.466	S	S	.	.	H	α-helix	trans	-60.2	-43.5	175.8	-73.8	-179.9	165.6	0	0	111.7	I65 F66 H71 V72 R73	I65-E69 HydrophobicContact CG2-CG 4.24Å; I65-E69 WeakPolarHBondContact O-CG 3.31Å; I65-E69 PolarHBondContact O-N 2.81Å; F66-E69 PolarHBondContact O-N 3.29Å; E69-H71 VanDerWaalsContact C-N 3.31Å; E69-H71 PolarHBondContact O-N 3.28Å; E69-V72 PolarHBondContact O-N 3.48Å; E69-R73 WeakPolarHBondContact O-CB 3.48Å; E69-R73 PolarHBondContact O-N 2.88Å
70	N	98.3	Very high	97.4	Very high	36 Å²	36	91.7 Å²	91.7	19%	0.193	46%	0.463	C	S	.	.	H	α-helix	trans	-64.2	-38.2	175.5	-72.5	-32.1	0	0	0	111.9	F66 D67 L68 R73 R74	F66-N70 VanDerWaalsContact CD1-ND2 3.34Å; F66-N70 WeakPolarHBondContact CD1-ND2 3.38Å; F66-N70 WeakPolarHBondContact CE1-ND2 3.42Å; F66-N70 WeakPolarHBondContact CZ-ND2 3.33Å; F66-N70 WeakPolarHBondContact O-CB 3.42Å; F66-N70 VanDerWaalsContact O-CG 3.24Å; F66-N70 PolarHBondContact O-N 3.44Å; F66-N70 PolarHBondContact O-ND2 2.88Å; F66-N70 VanDerWaalsContact O-ND2 3.12Å; D67-N70 PolarHBondContact O-N 3.42Å; L68-N70 VanDerWaalsContact C-N 3.33Å; L68-N70 PolarHBondContact O-N 3.43Å; N70-R73 PolarHBondContact OD1-NH1 2.81Å; N70-R74 WeakPolarHBondContact O-CG 3.48Å; N70-R74 PolarHBondContact O-N 3.17Å; N70-R74 VanDerWaalsContact O-N 3.11Å; N70-R74 PolarHBondContact O-NH1 2.95Å
71	H	98.4	Very high	97	Very high	83 Å²	83	94.6 Å²	94.6	38%	0.384	47%	0.467	S	S	.	.	H	α-helix	trans	-65.8	-47.2	176.5	-174.9	45.4	0	0	0	111.9	D67 L68 E69 R73 R74 L75	D67-H71 WeakPolarHBondContact O-CB 3.27Å; D67-H71 PolarHBondContact O-N 3.31Å; L68-H71 WeakPolarHBondContact O-CB 3.46Å; L68-H71 PolarHBondContact O-N 3.31Å; L68-H71 VanDerWaalsContact O-N 3.16Å; E69-H71 VanDerWaalsContact C-N 3.31Å; E69-H71 PolarHBondContact O-N 3.28Å; H71-R73 VanDerWaalsContact C-N 3.34Å; H71-R73 PolarHBondContact O-N 3.04Å; H71-R74 PolarHBondContact ND1-NH2 3.03Å; H71-R74 PolarHBondContact O-N 3.36Å; H71-L75 WeakPolarHBondContact NE2-CD1 3.28Å; H71-L75 WeakPolarHBondContact O-CG 3.45Å; H71-L75 PolarHBondContact O-N 2.87Å
72	V	98.3	Very high	96.5	Very high	71 Å²	71	94.2 Å²	94.2	43%	0.43	47%	0.465	S	S	.	.	H	α-helix	trans	-57.2	-48.3	175.1	169.6	0	0	0	0	110.3	L68 E69 R74 L75 E76	L68-V72 WeakPolarHBondContact O-CG2 3.28Å; L68-V72 PolarHBondContact O-N 2.92Å; E69-V72 PolarHBondContact O-N 3.48Å; V72-R74 VanDerWaalsContact C-N 3.3Å; V72-R74 PolarHBondContact O-N 2.89Å; V72-L75 PolarHBondContact O-N 2.85Å; V72-L75 VanDerWaalsContact O-N 3.12Å; V72-E76 HydrophobicContact CG1-CG 4.12Å; V72-E76 WeakPolarHBondContact O-CB 3.28Å; V72-E76 WeakPolarHBondContact O-CG 3.45Å; V72-E76 PolarHBondContact O-N 3.33Å
73	R	98.1	Very high	96	Very high	137 Å²	137	91.8 Å²	91.8	52%	0.517	46%	0.458	S	S	.	.	H	α-helix	trans	-59.3	-39.5	179.6	-165	-175.8	-57.5	113.8	5.6	112.8	E69 N70 H71 A77	E69-R73 WeakPolarHBondContact O-CB 3.48Å; E69-R73 PolarHBondContact O-N 2.88Å; N70-R73 PolarHBondContact OD1-NH1 2.81Å; H71-R73 VanDerWaalsContact C-N 3.34Å; H71-R73 PolarHBondContact O-N 3.04Å; R73-A77 PolarHBondContact O-N 2.85Å; R73-A77 VanDerWaalsContact O-N 3.12Å
74	R	98	Very high	95.3	Very high	134 Å²	134	100.3 Å²	100.3	51%	0.506	48%	0.48	S	S	.	.	H	α-helix	trans	-64.4	-48.7	174.2	-72.7	-167.6	-51.1	-85.4	5.1	111.3	N70 H71 V72 E76 A77 E78	N70-R74 WeakPolarHBondContact O-CG 3.48Å; N70-R74 PolarHBondContact O-N 3.17Å; N70-R74 VanDerWaalsContact O-N 3.11Å; N70-R74 PolarHBondContact O-NH1 2.95Å; H71-R74 PolarHBondContact ND1-NH2 3.03Å; H71-R74 PolarHBondContact O-N 3.36Å; V72-R74 VanDerWaalsContact C-N 3.3Å; V72-R74 PolarHBondContact O-N 2.89Å; R74-E76 VanDerWaalsContact C-N 3.31Å; R74-E76 PolarHBondContact O-N 3.21Å; R74-A77 WeakPolarHBondContact O-CB 3.24Å; R74-A77 PolarHBondContact O-N 3.43Å; R74-E78 WeakPolarHBondContact O-CG 3.49Å; R74-E78 PolarHBondContact O-N 3.34Å
75	L	97.5	Very high	94.7	Very high	78 Å²	78	99.5 Å²	99.5	41%	0.408	49%	0.486	S	S	.	.	H	α-helix	trans	-61.7	-38.8	178.8	-71.5	177.1	0	0	0	112.1	H71 V72 E78 N79	H71-L75 WeakPolarHBondContact NE2-CD1 3.28Å; H71-L75 WeakPolarHBondContact O-CG 3.45Å; H71-L75 PolarHBondContact O-N 2.87Å; V72-L75 PolarHBondContact O-N 2.85Å; V72-L75 VanDerWaalsContact O-N 3.12Å; L75-E78 PolarHBondContact O-N 3.16Å; L75-N79 WeakPolarHBondContact O-CB 3.5Å; L75-N79 PolarHBondContact O-N 2.82Å
76	E	96.4	Very high	94.1	Very high	127 Å²	127	97.4 Å²	97.4	59%	0.593	48%	0.475	S	S	*	.	H	α-helix	trans	-63.6	-41.6	175.4	-74.5	177.4	160.3	0	0	111.9	V72 R74 S80	V72-E76 HydrophobicContact CG1-CG 4.12Å; V72-E76 WeakPolarHBondContact O-CB 3.28Å; V72-E76 WeakPolarHBondContact O-CG 3.45Å; V72-E76 PolarHBondContact O-N 3.33Å; R74-E76 VanDerWaalsContact C-N 3.31Å; R74-E76 PolarHBondContact O-N 3.21Å; E76-S80 VanDerWaalsContact O-CB 3.27Å; E76-S80 WeakPolarHBondContact O-CB 3.48Å; E76-S80 PolarHBondContact O-N 3.01Å
77	A	95.6	Very high	93.3	Very high	55 Å²	55	95.7 Å²	95.7	46%	0.455	48%	0.477	S	S	.	.	H	α-helix	trans	-64.2	-47.6	175.2	0	0	0	0	0	111.6	R73 R74 N79 S80 I81	R73-A77 PolarHBondContact O-N 2.85Å; R73-A77 VanDerWaalsContact O-N 3.12Å; R74-A77 WeakPolarHBondContact O-CB 3.24Å; R74-A77 PolarHBondContact O-N 3.43Å; A77-N79 PolarHBondContact O-N 3.47Å; A77-S80 PolarHBondContact O-N 3.42Å; A77-I81 WeakPolarHBondContact O-CG1 3.37Å; A77-I81 PolarHBondContact O-N 2.99Å
78	E	95	Very high	92.3	Very high	105 Å²	105	96.8 Å²	96.8	49%	0.491	48%	0.482	S	S	.	.	H	α-helix	trans	-59.5	-47	176.1	-72.3	173	-158.2	0	0	111.4	R74 L75 S80 I81 L82	R74-E78 WeakPolarHBondContact O-CG 3.49Å; R74-E78 PolarHBondContact O-N 3.34Å; L75-E78 PolarHBondContact O-N 3.16Å; E78-S80 VanDerWaalsContact C-N 3.34Å; E78-S80 PolarHBondContact O-N 2.77Å; E78-I81 PolarHBondContact O-N 3.25Å; E78-L82 VanDerWaalsContact O-CG 3.3Å; E78-L82 WeakPolarHBondContact O-CG 3.11Å; E78-L82 PolarHBondContact O-N 3.38Å
79	N	92.6	Very high	91.3	Very high	79 Å²	79	98 Å²	98	42%	0.422	49%	0.49	S	S	.	.	H	α-helix	trans	-64.3	-39.1	179.8	-163.9	-34.1	0	0	0	111.5	L75 A77 I81 L82 K83	L75-N79 WeakPolarHBondContact O-CB 3.5Å; L75-N79 PolarHBondContact O-N 2.82Å; A77-N79 PolarHBondContact O-N 3.47Å; N79-I81 PolarHBondContact O-N 3.19Å; N79-L82 PolarHBondContact O-N 3.41Å; N79-K83 WeakPolarHBondContact O-CB 3.5Å; N79-K83 VanDerWaalsContact O-CG 3.32Å; N79-K83 WeakPolarHBondContact O-CG 3.31Å; N79-K83 PolarHBondContact O-N 3.33Å; N79-K83 WeakPolarHBondContact OD1-CD 3.5Å; N79-K83 WeakPolarHBondContact OD1-CE 3.34Å
80	S	90.8	Very high	90.4	Very high	50 Å²	50	96.4 Å²	96.4	35%	0.35	49%	0.487	S	S	.	.	H	α-helix	trans	-60.6	-43.2	173.9	-173	0	0	0	0	112.2	E76 A77 E78 R84	E76-S80 VanDerWaalsContact O-CB 3.27Å; E76-S80 WeakPolarHBondContact O-CB 3.48Å; E76-S80 PolarHBondContact O-N 3.01Å; A77-S80 PolarHBondContact O-N 3.42Å; E78-S80 VanDerWaalsContact C-N 3.34Å; E78-S80 PolarHBondContact O-N 2.77Å; S80-R84 VanDerWaalsContact O-CG 3.28Å; S80-R84 WeakPolarHBondContact O-CG 3.44Å; S80-R84 PolarHBondContact O-N 3.03Å
81	I	91.2	Very high	89.4	Confident	108 Å²	108	96.3 Å²	96.3	55%	0.554	49%	0.486	S	S	*	.	H	α-helix	trans	-65.7	-45.8	176.5	-67.1	165.8	0	0	0	110.9	A77 E78 N79 K83 R84 T85	A77-I81 WeakPolarHBondContact O-CG1 3.37Å; A77-I81 PolarHBondContact O-N 2.99Å; E78-I81 PolarHBondContact O-N 3.25Å; N79-I81 PolarHBondContact O-N 3.19Å; I81-K83 PolarHBondContact O-N 3.01Å; I81-R84 PolarHBondContact O-N 3.33Å; I81-T85 WeakPolarHBondContact O-CB 3.48Å; I81-T85 PolarHBondContact O-N 3.19Å; I81-T85 PolarHBondContact O-OG1 2.81Å
82	L	88.9	Confident	88.4	Confident	99 Å²	99	98.4 Å²	98.4	52%	0.518	49%	0.494	S	S	.	.	H	α-helix	trans	-60.7	-47.3	178.8	-71.6	171.1	0	0	0	111.1	E78 N79 R84 T85 I86	E78-L82 VanDerWaalsContact O-CG 3.3Å; E78-L82 WeakPolarHBondContact O-CG 3.11Å; E78-L82 PolarHBondContact O-N 3.38Å; N79-L82 PolarHBondContact O-N 3.41Å; L82-R84 PolarHBondContact O-N 3.15Å; L82-T85 PolarHBondContact O-N 3.44Å; L82-I86 HydrophobicContact CB-CD1 4.15Å; L82-I86 WeakPolarHBondContact O-CB 3.39Å; L82-I86 WeakPolarHBondContact O-CD1 3.46Å; L82-I86 WeakPolarHBondContact O-CG1 3.21Å; L82-I86 PolarHBondContact O-N 3.36Å
83	K	86.4	Confident	87.4	Confident	107 Å²	107	101.2 Å²	101.2	47%	0.465	50%	0.502	S	S	.	.	H	α-helix	trans	-59.1	-32.5	177.3	-78.4	174.6	172.2	171	0	113.5	N79 I81 L91	N79-K83 WeakPolarHBondContact O-CB 3.5Å; N79-K83 VanDerWaalsContact O-CG 3.32Å; N79-K83 WeakPolarHBondContact O-CG 3.31Å; N79-K83 PolarHBondContact O-N 3.33Å; N79-K83 WeakPolarHBondContact OD1-CD 3.5Å; N79-K83 WeakPolarHBondContact OD1-CE 3.34Å; I81-K83 PolarHBondContact O-N 3.01Å; K83-L91 HydrophobicContact CG-CD1 4.22Å
84	R	85.5	Confident	86.3	Confident	210 Å²	210	98.7 Å²	98.7	79%	0.792	50%	0.499	S	S	*	.	H	α-helix	trans	-77.4	-30	176.1	-69.4	171.6	-172.7	-159.2	-0.1	112.9	S80 I81 L82	S80-R84 VanDerWaalsContact O-CG 3.28Å; S80-R84 WeakPolarHBondContact O-CG 3.44Å; S80-R84 PolarHBondContact O-N 3.03Å; I81-R84 PolarHBondContact O-N 3.33Å; L82-R84 PolarHBondContact O-N 3.15Å
85	T	85.6	Confident	85	Confident	106 Å²	106	98 Å²	98	65%	0.65	50%	0.501	S	S	*	.	H	α-helix	trans	-90	-26.7	-174.1	-50.3	0	0	0	0	112.5	I81 L82	I81-T85 WeakPolarHBondContact O-CB 3.48Å; I81-T85 PolarHBondContact O-N 3.19Å; I81-T85 PolarHBondContact O-OG1 2.81Å; L82-T85 PolarHBondContact O-N 3.44Å
86	I	85.5	Confident	83.8	Confident	50 Å²	50	101.3 Å²	101.3	26%	0.256	52%	0.519	S	S	.	.	S	Bend	trans	-79.5	133	-177	-67.3	165.6	0	0	0	110.7	L82 T90 L91	L82-I86 HydrophobicContact CB-CD1 4.15Å; L82-I86 WeakPolarHBondContact O-CB 3.39Å; L82-I86 WeakPolarHBondContact O-CD1 3.46Å; L82-I86 WeakPolarHBondContact O-CG1 3.21Å; L82-I86 PolarHBondContact O-N 3.36Å; I86-T90 HydrophobicContact CG2-CG2 3.91Å; I86-L91 HydrophobicContact CG2-CB 4.31Å
87	P	81.1	Confident	82.3	Confident	88 Å²	88	103.8 Å²	103.8	57%	0.571	53%	0.527	S	S	*	.			trans	-56.5	141.7	173.1	-25.1	33.9	0	0	0	112.8	D89 T90 L91	P87-D89 PolarHBondContact O-N 3.35Å; P87-D89 VanDerWaalsContact O-N 3.09Å; P87-T90 PolarHBondContact O-N 3Å; P87-L91 PolarHBondContact O-N 3.09Å; P87-L91 VanDerWaalsContact O-N 3.07Å
88	N	78.1	Confident	80.2	Confident	121 Å²	121	111.2 Å²	111.2	65%	0.647	56%	0.558	S	S	*	*	H	α-helix	trans	-53.8	-35	-175.2	-76.1	-64.9	0	0	0	114.1	L91 K92	N88-L91 PolarHBondContact O-N 3.27Å; N88-K92 VanDerWaalsContact O-CG 3.3Å; N88-K92 WeakPolarHBondContact O-CG 3.49Å; N88-K92 PolarHBondContact O-N 2.93Å
89	D	78.4	Confident	79.5	Confident	113 Å²	113	111.6 Å²	111.6	60%	0.604	56%	0.562	S	S	*	*	H	α-helix	trans	-70.9	-38.2	-179.3	-65.2	-26.8	0	0	0	112.2	P87 K92 Q93	P87-D89 PolarHBondContact O-N 3.35Å; P87-D89 VanDerWaalsContact O-N 3.09Å; D89-K92 IonicContact OD1-NZ 3.8Å; D89-Q93 WeakPolarHBondContact O-CG 3.29Å; D89-Q93 PolarHBondContact O-N 2.97Å
90	T	78.9	Confident	78.8	Confident	68 Å²	68	113.3 Å²	113.3	42%	0.417	57%	0.569	S	S	.	*	H	α-helix	trans	-68	-39.3	173.3	-50.2	0	0	0	0	111.2	I86 P87 K92 Q93 L94	I86-T90 HydrophobicContact CG2-CG2 3.91Å; P87-T90 PolarHBondContact O-N 3Å; T90-K92 PolarHBondContact O-N 3.04Å; T90-Q93 PolarHBondContact O-N 3.04Å; T90-L94 PolarHBondContact O-N 3.14Å; T90-L94 VanDerWaalsContact O-N 3.13Å
91	L	77.4	Confident	78.2	Confident	33 Å²	33	116.8 Å²	116.8	17%	0.173	58%	0.581	C	S	.	*	H	α-helix	trans	-63.5	-41.3	177.6	-172.7	66.4	0	0	0	111.9	K83 I86 P87 N88 Q93 L94 H95	K83-L91 HydrophobicContact CG-CD1 4.22Å; I86-L91 HydrophobicContact CG2-CB 4.31Å; P87-L91 PolarHBondContact O-N 3.09Å; P87-L91 VanDerWaalsContact O-N 3.07Å; N88-L91 PolarHBondContact O-N 3.27Å; L91-Q93 VanDerWaalsContact C-N 3.33Å; L91-Q93 PolarHBondContact O-N 2.98Å; L91-L94 PolarHBondContact O-N 2.92Å; L91-H95 PolarHBondContact O-N 3.05Å; L91-H95 VanDerWaalsContact O-N 3.12Å
92	K	77.1	Confident	77.4	Confident	128 Å²	128	117.3 Å²	117.3	56%	0.557	58%	0.583	S	S	*	*	H	α-helix	trans	-61	-40	174.4	-73.3	169.6	-173.2	169	0	112.3	N88 D89 T90 L94 H95 L96	N88-K92 VanDerWaalsContact O-CG 3.3Å; N88-K92 WeakPolarHBondContact O-CG 3.49Å; N88-K92 PolarHBondContact O-N 2.93Å; D89-K92 IonicContact OD1-NZ 3.8Å; T90-K92 PolarHBondContact O-N 3.04Å; K92-L94 VanDerWaalsContact C-N 3.33Å; K92-L94 PolarHBondContact O-N 3.15Å; K92-H95 PolarHBondContact O-N 3.49Å; K92-L96 PolarHBondContact O-N 3.11Å
93	Q	76.6	Confident	76.7	Confident	129 Å²	129	118.4 Å²	118.4	60%	0.603	59%	0.587	S	S	*	*	H	α-helix	trans	-66.3	-33.5	176.6	-71.5	-177.9	0.9	0	0	112.9	D89 T90 L91	D89-Q93 WeakPolarHBondContact O-CG 3.29Å; D89-Q93 PolarHBondContact O-N 2.97Å; T90-Q93 PolarHBondContact O-N 3.04Å; L91-Q93 VanDerWaalsContact C-N 3.33Å; L91-Q93 PolarHBondContact O-N 2.98Å
94	L	74.9	Confident	76	Confident	84 Å²	84	119.2 Å²	119.2	44%	0.44	60%	0.595	S	S	.	*	H	α-helix	trans	-69.5	-40.9	175.4	-70.8	172.4	0	0	0	112.1	T90 L91 K92 L96 K97	T90-L94 PolarHBondContact O-N 3.14Å; T90-L94 VanDerWaalsContact O-N 3.13Å; L91-L94 PolarHBondContact O-N 2.92Å; K92-L94 VanDerWaalsContact C-N 3.33Å; K92-L94 PolarHBondContact O-N 3.15Å; L94-L96 PolarHBondContact O-N 3.02Å; L94-K97 PolarHBondContact O-N 3.08Å
95	H	71.8	Confident	75.3	Confident	119 Å²	119	112.7 Å²	112.7	55%	0.551	58%	0.581	S	S	*	*	H	α-helix	trans	-65.4	-21.4	176.7	-73.5	175.3	0	0	0	114.2	L91 K92	L91-H95 PolarHBondContact O-N 3.05Å; L91-H95 VanDerWaalsContact O-N 3.12Å; K92-H95 PolarHBondContact O-N 3.49Å
96	L	72.4	Confident	74.5	Confident	149 Å²	149	113.2 Å²	113.2	78%	0.78	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.9	-9.7	176.9	-76	161.8	0	0	0	113.5	K92 L94	K92-L96 PolarHBondContact O-N 3.11Å; L94-L96 PolarHBondContact O-N 3.02Å
97	K	63.6	Low	73.6	Confident	179 Å²	179	118.5 Å²	118.5	78%	0.778	60%	0.602	S	S	*	*			trans	-106.8	-7.8	-175.1	-75.9	-175	177	-179.2	0	114.6	L94	L94-K97 PolarHBondContact O-N 3.08Å
98	L	53.2	Low	73	Confident	211 Å²	211	121.3 Å²	121.3	100%	1.105	61%	0.605	S	S	*	*			trans	-103.5	0	174.7	-90.1	145.7	0	0	0	109.4

Retrieved 98 of 98 residues in 24.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).