A0A087WNL9_MOUSE Loading...

Ribosomal biogenesis factor

AlphaFold DB , UniProt , Accession A0A087WNL9, Species MOUSE (Mus musculus, Mouse), Gene Rbis, Length 58 aa.

						>A0A087WNL9_MOUSE|A0A087WNL9|Rbis
MAKNKLKGQKSRNVFHIASHKTFKAKNKAKPVTTNLKKKHHENEPANVDEATRLMAQL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.5	Very low	66.2	Low	248 Å²	248	166.2 Å²	166.2	100%	1.222	87%	0.865	S	S	*	*				0	115.7	0	-72.7	-174.5	-81.2	0	0	109.1
2	A	62.4	Low	67	Low	93 Å²	93	165.8 Å²	165.8	77%	0.769	84%	0.844	S	S	*	*			trans	-95.1	119.8	-178.2	0	0	0	0	0	110.3	N4	A2-N4 PolarHBondContact O-N 2.88Å; A2-N4 PolarHBondContact O-OD1 3.39Å
3	K	70.1	Confident	68.2	Low	209 Å²	209	159.5 Å²	159.5	91%	0.909	81%	0.813	S	S	*	*			trans	-85.5	100.1	173.5	-90.6	178.6	174	175.3	0	109.4	K5	K3-K5 PolarHBondContact O-N 3.04Å
4	N	68.7	Low	68.7	Low	144 Å²	144	155.9 Å²	155.9	77%	0.77	80%	0.802	S	S	*	*			trans	-81.2	106.9	168.4	12.6	27	0	0	0	108.9	A2 L6	A2-N4 PolarHBondContact O-N 2.88Å; A2-N4 PolarHBondContact O-OD1 3.39Å; N4-L6 PolarHBondContact O-N 2.94Å
5	K	65.4	Low	69.2	Low	198 Å²	198	156.6 Å²	156.6	86%	0.861	80%	0.798	S	S	*	*			trans	-67.8	102.1	170.5	-64.2	-169.7	-177.4	-176.4	0	108	K3 K7	K3-K5 PolarHBondContact O-N 3.04Å; K5-K7 PolarHBondContact O-N 3.21Å
6	L	67.7	Low	69.5	Low	167 Å²	167	153.8 Å²	153.8	87%	0.874	78%	0.78	S	S	*	*			trans	-57.4	104.7	165.8	-65.4	170.7	0	0	0	106.5	N4 G8	N4-L6 PolarHBondContact O-N 2.94Å; L6-G8 PolarHBondContact O-N 2.85Å
7	K	66.8	Low	69.9	Low	204 Å²	204	149.9 Å²	149.9	89%	0.887	76%	0.761	S	S	*	*			trans	-54.9	112.3	175.5	-77.2	-178.1	176.3	178.3	0	106.5	K5 Q9	K5-K7 PolarHBondContact O-N 3.21Å; K7-Q9 PolarHBondContact O-N 2.74Å
8	G	69.4	Low	70	Confident	66 Å²	66	145.2 Å²	145.2	68%	0.68	75%	0.749	S	S	*	*			trans	-50.3	130.3	-174.1	0	0	0	0	0	110.6	L6 K10	L6-G8 PolarHBondContact O-N 2.85Å; G8-K10 PolarHBondContact O-N 2.83Å
9	Q	70.8	Confident	70.1	Confident	193 Å²	193	141.9 Å²	141.9	90%	0.902	74%	0.739	S	S	*	*			trans	-55.4	108	172.7	179.8	177.7	-46.2	0	0	107.6	K7 S11	K7-Q9 PolarHBondContact O-N 2.74Å; Q9-S11 PolarHBondContact O-N 2.8Å
10	K	72.3	Confident	69.9	Low	187 Å²	187	141.4 Å²	141.4	81%	0.813	73%	0.733	S	S	*	*			trans	-55.3	128.1	176.9	-68.5	-177	178.1	-178.2	0	107.8	G8 R12	G8-K10 PolarHBondContact O-N 2.83Å; K10-R12 PolarHBondContact O-N 3.03Å
11	S	72.8	Confident	69.8	Low	119 Å²	119	143 Å²	143	83%	0.832	73%	0.734	S	S	*	*			trans	-57.8	115.8	173.2	47.3	0	0	0	0	108.1	Q9 N13	Q9-S11 PolarHBondContact O-N 2.8Å; S11-N13 PolarHBondContact O-N 3.42Å
12	R	76.3	Confident	70.9	Confident	162 Å²	162	136.2 Å²	136.2	61%	0.611	71%	0.707	S	S	*	*			trans	-73.1	120.9	173	-72.6	176.2	64	116	3	106.5	K10 V14 I17 H20	K10-R12 PolarHBondContact O-N 3.03Å; R12-V14 PolarHBondContact O-N 2.78Å; R12-I17 HydrophobicContact CB-CD1 3.93Å; R12-I17 HydrophobicContact CB-CG1 3.98Å; R12-I17 WeakPolarHBondContact O-CD1 3.26Å; R12-H20 PolarHBondContact NH2-CD2 3.42Å
13	N	82.2	Confident	71	Confident	83 Å²	83	140.9 Å²	140.9	44%	0.444	71%	0.71	S	S	.	*			trans	-59.8	133.9	179.3	175.9	-42.6	0	0	0	110	S11 F15 H16 I17	S11-N13 PolarHBondContact O-N 3.42Å; N13-F15 PolarHBondContact O-N 3.05Å; N13-F15 VanDerWaalsContact O-N 3.16Å; N13-F15 VanDerWaalsContact OD1-CB 3.31Å; N13-F15 WeakPolarHBondContact OD1-CB 3.35Å; N13-F15 WeakPolarHBondContact OD1-CD2 3.38Å; N13-F15 PolarHBondContact OD1-N 3.46Å; N13-H16 WeakPolarHBondContact O-CA 3.48Å; N13-H16 WeakPolarHBondContact O-CB 3.35Å; N13-H16 PolarHBondContact O-N 3.43Å; N13-I17 PolarHBondContact O-N 3.22Å; N13-I17 VanDerWaalsContact O-N 3.14Å
14	V	75.9	Confident	70.8	Confident	109 Å²	109	138.2 Å²	138.2	66%	0.661	70%	0.698	S	S	*	*	H	α-helix	trans	-54.2	-34.5	-176.8	180	0	0	0	0	112.4	R12 H16 I17 A18	R12-V14 PolarHBondContact O-N 2.78Å; V14-H16 VanDerWaalsContact C-N 3.32Å; V14-H16 PolarHBondContact O-N 3.41Å; V14-I17 PolarHBondContact O-N 3.05Å; V14-I17 VanDerWaalsContact O-N 3.15Å; V14-A18 WeakPolarHBondContact O-CB 3.26Å; V14-A18 PolarHBondContact O-N 3.24Å
15	F	75.3	Confident	70.8	Confident	167 Å²	167	135.1 Å²	135.1	73%	0.732	69%	0.693	S	S	*	*	H	α-helix	trans	-61.2	-39.6	175.1	-68.7	-73.1	0	0	0	112.3	N13 S19	N13-F15 PolarHBondContact O-N 3.05Å; N13-F15 VanDerWaalsContact O-N 3.16Å; N13-F15 VanDerWaalsContact OD1-CB 3.31Å; N13-F15 WeakPolarHBondContact OD1-CB 3.35Å; N13-F15 WeakPolarHBondContact OD1-CD2 3.38Å; N13-F15 PolarHBondContact OD1-N 3.46Å; F15-S19 VanDerWaalsContact O-CB 3.26Å; F15-S19 WeakPolarHBondContact O-CB 3.41Å; F15-S19 PolarHBondContact O-N 3.12Å; F15-S19 PolarHBondContact O-OG 3.35Å; F15-S19 VanDerWaalsContact O-OG 3.12Å
16	H	74.9	Confident	70.9	Confident	112 Å²	112	134.1 Å²	134.1	52%	0.519	69%	0.689	S	S	.	*	H	α-helix	trans	-71.1	-36.5	175	-65.7	80.8	0	0	0	111.2	N13 V14 S19 H20	N13-H16 WeakPolarHBondContact O-CA 3.48Å; N13-H16 WeakPolarHBondContact O-CB 3.35Å; N13-H16 PolarHBondContact O-N 3.43Å; V14-H16 VanDerWaalsContact C-N 3.32Å; V14-H16 PolarHBondContact O-N 3.41Å; H16-S19 WeakPolarHBondContact CA-OG 3.49Å; H16-S19 PolarHBondContact O-OG 2.94Å; H16-S19 VanDerWaalsContact O-OG 3.13Å; H16-H20 PolarHBondContact O-CD2 3Å; H16-H20 PolarHBondContact O-N 3.43Å
17	I	76.2	Confident	70.9	Confident	88 Å²	88	131.8 Å²	131.8	45%	0.451	68%	0.677	S	S	.	*	H	α-helix	trans	-66.8	-42.8	177.5	-61.4	172.6	0	0	0	111	R12 N13 V14	R12-I17 HydrophobicContact CB-CD1 3.93Å; R12-I17 HydrophobicContact CB-CG1 3.98Å; R12-I17 WeakPolarHBondContact O-CD1 3.26Å; N13-I17 PolarHBondContact O-N 3.22Å; N13-I17 VanDerWaalsContact O-N 3.14Å; V14-I17 PolarHBondContact O-N 3.05Å; V14-I17 VanDerWaalsContact O-N 3.15Å
18	A	71.3	Confident	71.2	Confident	65 Å²	65	131.5 Å²	131.5	54%	0.537	68%	0.676	S	S	.	*	H	α-helix	trans	-70.9	-36	179	0	0	0	0	0	112.3	V14 K21	V14-A18 WeakPolarHBondContact O-CB 3.26Å; V14-A18 PolarHBondContact O-N 3.24Å; A18-K21 PolarHBondContact O-N 2.82Å
19	S	71.4	Confident	71.6	Confident	82 Å²	82	131.4 Å²	131.4	57%	0.573	67%	0.669	S	S	*	*	H	α-helix	trans	-73.9	-25	-179.8	69.7	0	0	0	0	113.8	F15 H16 K21	F15-S19 VanDerWaalsContact O-CB 3.26Å; F15-S19 WeakPolarHBondContact O-CB 3.41Å; F15-S19 PolarHBondContact O-N 3.12Å; F15-S19 PolarHBondContact O-OG 3.35Å; F15-S19 VanDerWaalsContact O-OG 3.12Å; H16-S19 WeakPolarHBondContact CA-OG 3.49Å; H16-S19 PolarHBondContact O-OG 2.94Å; H16-S19 VanDerWaalsContact O-OG 3.13Å; S19-K21 PolarHBondContact O-N 3.13Å
20	H	67.1	Low	71.8	Confident	132 Å²	132	131.3 Å²	131.3	61%	0.611	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.4	-11.5	175.6	-83.3	-64.6	0	0	0	114	R12 H16 T22	R12-H20 PolarHBondContact NH2-CD2 3.42Å; H16-H20 PolarHBondContact O-CD2 3Å; H16-H20 PolarHBondContact O-N 3.43Å; H20-T22 PolarHBondContact O-N 2.91Å
21	K	68	Low	71.7	Confident	176 Å²	176	127.7 Å²	127.7	77%	0.765	66%	0.66	S	S	*	*	S	Bend	trans	-74.6	97.2	166.4	-72.2	-167.9	179.8	-172.3	0	107.5	A18 S19 F23	A18-K21 PolarHBondContact O-N 2.82Å; S19-K21 PolarHBondContact O-N 3.13Å; K21-F23 PolarHBondContact O-N 3.15Å
22	T	64	Low	71.9	Confident	104 Å²	104	128 Å²	128	64%	0.638	66%	0.657	S	S	*	*			trans	-42.7	101.5	168	20.2	0	0	0	0	109.7	H20 K24	H20-T22 PolarHBondContact O-N 2.91Å; T22-K24 PolarHBondContact O-N 3.14Å
23	F	64.1	Low	71.9	Confident	192 Å²	192	125.7 Å²	125.7	84%	0.842	66%	0.661	S	S	*	*			trans	-69.4	86.4	162.1	-169.3	-98.9	0	0	0	104.9	K21 A25	K21-F23 PolarHBondContact O-N 3.15Å; F23-A25 HydrophobicContact CD1-CB 4.33Å; F23-A25 HydrophobicContact CE1-CB 4.42Å; F23-A25 PolarHBondContact O-N 3.04Å
24	K	66.1	Low	71.7	Confident	152 Å²	152	126.5 Å²	126.5	66%	0.661	67%	0.669	S	S	*	*			trans	-64.4	92.5	170.1	-65.2	-67.2	-175.8	177.9	0	104.8	T22 K26	T22-K24 PolarHBondContact O-N 3.14Å; K24-K26 PolarHBondContact O-N 2.92Å
25	A	69.1	Low	71.6	Confident	79 Å²	79	129 Å²	129	65%	0.653	68%	0.679	S	S	*	*			trans	-61.3	90.2	165.9	0	0	0	0	0	105.9	F23 N27	F23-A25 HydrophobicContact CD1-CB 4.33Å; F23-A25 HydrophobicContact CE1-CB 4.42Å; F23-A25 PolarHBondContact O-N 3.04Å; A25-N27 PolarHBondContact O-N 3.23Å
26	K	66.9	Low	71.6	Confident	178 Å²	178	127.6 Å²	127.6	77%	0.774	68%	0.679	S	S	*	*			trans	-73.5	69.4	173.3	-77.8	-179.2	176.8	175.7	0	107.2	K24 K28	K24-K26 PolarHBondContact O-N 2.92Å; K26-K28 VanDerWaalsContact C-N 3.34Å; K26-K28 PolarHBondContact O-N 3.3Å
27	N	68.5	Low	71.4	Confident	117 Å²	117	131.9 Å²	131.9	63%	0.626	70%	0.695	S	S	*	*			trans	-82.7	92.8	160.1	-159.4	-34.6	0	0	0	107.2	A25 A29	A25-N27 PolarHBondContact O-N 3.23Å; N27-A29 PolarHBondContact O-N 2.94Å; N27-A29 WeakPolarHBondContact OD1-CA 3.36Å; N27-A29 WeakPolarHBondContact OD1-CB 3.31Å; N27-A29 PolarHBondContact OD1-N 2.83Å; N27-A29 PolarHBondContact OD1-O 3.41Å
28	K	72.1	Confident	71.2	Confident	199 Å²	199	136.6 Å²	136.6	87%	0.865	71%	0.713	S	S	*	*			trans	-72.7	-5.5	173.5	-70.4	-173.1	175.2	-175.6	0	112.3	K26	K26-K28 VanDerWaalsContact C-N 3.34Å; K26-K28 PolarHBondContact O-N 3.3Å
29	A	79.4	Confident	71.2	Confident	64 Å²	64	142.2 Å²	142.2	53%	0.529	73%	0.725	S	S	.	*	S	Bend	trans	-103.3	148	-179	0	0	0	0	0	110.1	N27	N27-A29 PolarHBondContact O-N 2.94Å; N27-A29 WeakPolarHBondContact OD1-CA 3.36Å; N27-A29 WeakPolarHBondContact OD1-CB 3.31Å; N27-A29 PolarHBondContact OD1-N 2.83Å; N27-A29 PolarHBondContact OD1-O 3.41Å
30	K	73.4	Confident	71	Confident	191 Å²	191	146.3 Å²	146.3	83%	0.83	74%	0.735	S	S	*	*	P	Polyproline II helix	trans	-61.2	137.5	165.3	-65	176.9	-179.9	178.3	0	107.5	V32	K30-V32 PolarHBondContact O-N 2.9Å
31	P	70.9	Confident	71	Confident	110 Å²	110	147.8 Å²	147.8	71%	0.714	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-58.1	117.8	174.6	24.4	-32.1	0	0	0	108.3	T33	P31-T33 PolarHBondContact O-N 2.86Å
32	V	77.8	Confident	70.8	Confident	125 Å²	125	147.9 Å²	147.9	76%	0.758	75%	0.745	S	S	*	*			trans	-78.1	105.2	171.4	179.9	0	0	0	0	106.1	K30 T34	K30-V32 PolarHBondContact O-N 2.9Å; V32-T34 HydrophobicContact CG1-CG2 4.16Å; V32-T34 PolarHBondContact O-N 3.16Å
33	T	76.1	Confident	71	Confident	115 Å²	115	150 Å²	150	71%	0.706	75%	0.752	S	S	*	*			trans	-73.2	94.5	171.4	55	0	0	0	0	107.8	P31 N35	P31-T33 PolarHBondContact O-N 2.86Å; T33-N35 PolarHBondContact O-N 3.44Å
34	T	76.8	Confident	71.3	Confident	100 Å²	100	149 Å²	149	61%	0.613	75%	0.75	S	S	*	*			trans	-75.5	118.3	167.1	45.6	0	0	0	0	107.9	V32 L36	V32-T34 HydrophobicContact CG1-CG2 4.16Å; V32-T34 PolarHBondContact O-N 3.16Å; T34-L36 PolarHBondContact O-N 3.34Å; T34-L36 VanDerWaalsContact OG1-CD1 3.26Å; T34-L36 WeakPolarHBondContact OG1-CD1 3.21Å
35	N	75.1	Confident	71.4	Confident	161 Å²	161	147.4 Å²	147.4	86%	0.861	76%	0.756	S	S	*	*			trans	-69.5	80.4	170.6	-70.5	-62.4	0	0	0	108.4	T33 K37	T33-N35 PolarHBondContact O-N 3.44Å; N35-K37 PolarHBondContact O-N 3.05Å
36	L	73.5	Confident	71.4	Confident	138 Å²	138	147.7 Å²	147.7	72%	0.723	76%	0.758	S	S	*	*			trans	-66.4	108	169.8	-91.2	87.4	0	0	0	107.7	T34 K38	T34-L36 PolarHBondContact O-N 3.34Å; T34-L36 VanDerWaalsContact OG1-CD1 3.26Å; T34-L36 WeakPolarHBondContact OG1-CD1 3.21Å; L36-K38 PolarHBondContact O-N 2.93Å
37	K	72.4	Confident	72.2	Confident	201 Å²	201	143.3 Å²	143.3	87%	0.874	74%	0.743	S	S	*	*			trans	-58.5	104.1	161.3	-107.1	172.5	174.2	176.1	0	106.5	N35 K39	N35-K37 PolarHBondContact O-N 3.05Å; K37-K39 VanDerWaalsContact C-N 3.33Å; K37-K39 PolarHBondContact O-N 2.91Å
38	K	70.8	Confident	72.8	Confident	187 Å²	187	142.5 Å²	142.5	81%	0.813	74%	0.742	S	S	*	*			trans	-62.3	100.7	169.4	-62.8	-178.8	-175.9	177.2	0	105.8	L36 H40	L36-K38 PolarHBondContact O-N 2.93Å; K38-H40 PolarHBondContact O-N 3.03Å
39	K	70.9	Confident	73.4	Confident	183 Å²	183	139.1 Å²	139.1	80%	0.796	73%	0.733	S	S	*	*			trans	-63.9	109.5	165	-67.3	-150.8	177.9	-172.9	0	105	K37 H41	K37-K39 VanDerWaalsContact C-N 3.33Å; K37-K39 PolarHBondContact O-N 2.91Å; K39-H41 VanDerWaalsContact C-N 3.29Å; K39-H41 PolarHBondContact O-N 2.96Å
40	H	68.9	Low	73.7	Confident	169 Å²	169	141.6 Å²	141.6	78%	0.782	73%	0.734	S	S	*	*			trans	-59.8	104.4	161.9	-89.1	-98.8	0	0	0	104.8	K38 E42	K38-H40 PolarHBondContact O-N 3.03Å; H40-E42 PolarHBondContact O-N 3.01Å
41	H	66.4	Low	74.3	Confident	162 Å²	162	135.1 Å²	135.1	75%	0.75	72%	0.716	S	S	*	*			trans	-67	99.6	159.1	-78.9	112.2	0	0	0	104	K39 N43	K39-H41 VanDerWaalsContact C-N 3.29Å; K39-H41 PolarHBondContact O-N 2.96Å; H41-N43 PolarHBondContact O-N 2.83Å
42	E	64.2	Low	75.2	Confident	179 Å²	179	133.9 Å²	133.9	84%	0.836	71%	0.706	S	S	*	*			trans	-59.8	92.8	162.5	-68.2	173.4	-173.6	0	0	104.9	H40 E44	H40-E42 PolarHBondContact O-N 3.01Å; E42-E44 PolarHBondContact O-N 2.93Å
43	N	66.6	Low	76	Confident	147 Å²	147	136.7 Å²	136.7	79%	0.786	70%	0.703	S	S	*	*			trans	-66.4	94.7	163.1	-77.7	-27.9	0	0	0	103.9	H41	H41-N43 PolarHBondContact O-N 2.83Å
44	E	70.5	Confident	76.7	Confident	171 Å²	171	136.1 Å²	136.1	80%	0.799	70%	0.695	S	S	*	*			trans	-49.9	130.3	159.6	-80.6	-135.2	129.9	0	0	106.8	E42 A46	E42-E44 PolarHBondContact O-N 2.93Å; E44-A46 VanDerWaalsContact C-N 3.31Å; E44-A46 PolarHBondContact O-N 3Å
45	P	68.4	Low	77.2	Confident	120 Å²	120	138 Å²	138	78%	0.779	70%	0.699	S	S	*	*			trans	-61	102.7	176	25	-31	0	0	0	106.8	N47	P45-N47 PolarHBondContact O-N 2.77Å
46	A	70.2	Confident	77.8	Confident	84 Å²	84	134.2 Å²	134.2	69%	0.694	69%	0.69	S	S	*	*			trans	-53.3	117.2	170.4	0	0	0	0	0	105.9	E44 V48	E44-A46 VanDerWaalsContact C-N 3.31Å; E44-A46 PolarHBondContact O-N 3Å; A46-V48 WeakPolarHBondContact O-CG2 3.39Å; A46-V48 PolarHBondContact O-N 2.9Å
47	N	82.9	Confident	78.6	Confident	86 Å²	86	134.8 Å²	134.8	46%	0.46	69%	0.689	S	S	.	*			trans	-68.3	106.3	-175.3	106	67.1	0	0	0	107.2	P45 D49 E50	P45-N47 PolarHBondContact O-N 2.77Å; N47-D49 PolarHBondContact O-N 2.7Å; N47-E50 VanDerWaalsContact CG-CB 3.49Å; N47-E50 VanDerWaalsContact ND2-CB 3.31Å; N47-E50 WeakPolarHBondContact ND2-CB 3.31Å; N47-E50 PolarHBondContact ND2-OE2 3.43Å; N47-E50 WeakPolarHBondContact OD1-CA 3.31Å; N47-E50 WeakPolarHBondContact OD1-CB 3.33Å; N47-E50 PolarHBondContact OD1-N 2.93Å
48	V	82.5	Confident	78.8	Confident	100 Å²	100	134.7 Å²	134.7	61%	0.606	70%	0.697	S	S	*	*	H	α-helix	trans	-70.3	-27.4	-173.3	179.7	0	0	0	0	110.3	A46 T52	A46-V48 WeakPolarHBondContact O-CG2 3.39Å; A46-V48 PolarHBondContact O-N 2.9Å; V48-T52 WeakPolarHBondContact O-CB 2.94Å; V48-T52 PolarHBondContact O-N 2.76Å; V48-T52 PolarHBondContact O-OG1 2.9Å
49	D	83.9	Confident	79.3	Confident	129 Å²	129	132.1 Å²	132.1	69%	0.69	69%	0.691	S	S	*	*	H	α-helix	trans	-69	-43.3	-176	-71.8	-6	0	0	0	112.5	N47 T52 R53	N47-D49 PolarHBondContact O-N 2.7Å; D49-T52 PolarHBondContact O-N 3.37Å; D49-R53 VanDerWaalsContact O-CG 3.31Å; D49-R53 WeakPolarHBondContact O-CG 3.42Å; D49-R53 PolarHBondContact O-N 2.69Å
50	E	85.7	Confident	79.7	Confident	116 Å²	116	129.4 Å²	129.4	54%	0.542	69%	0.686	S	S	.	*	H	α-helix	trans	-69.5	-41.8	177.1	-170.9	173.2	-160	0	0	111.2	N47 T52 R53 L54	N47-E50 VanDerWaalsContact CG-CB 3.49Å; N47-E50 VanDerWaalsContact ND2-CB 3.31Å; N47-E50 WeakPolarHBondContact ND2-CB 3.31Å; N47-E50 PolarHBondContact ND2-OE2 3.43Å; N47-E50 WeakPolarHBondContact OD1-CA 3.31Å; N47-E50 WeakPolarHBondContact OD1-CB 3.33Å; N47-E50 PolarHBondContact OD1-N 2.93Å; E50-T52 VanDerWaalsContact C-N 3.26Å; E50-T52 PolarHBondContact O-N 2.95Å; E50-R53 PolarHBondContact O-N 3.17Å; E50-L54 WeakPolarHBondContact O-CG 3.47Å; E50-L54 PolarHBondContact O-N 3.36Å
51	A	86.6	Confident	80.3	Confident	55 Å²	55	127.2 Å²	127.2	46%	0.455	68%	0.68	S	S	.	*	H	α-helix	trans	-58.3	-41.9	173.7	0	0	0	0	0	111.2	L54 M55	A51-L54 PolarHBondContact O-N 3.37Å; A51-M55 VanDerWaalsContact O-CG 3.3Å; A51-M55 WeakPolarHBondContact O-CG 3.41Å; A51-M55 PolarHBondContact O-N 3.45Å; A51-M55 VanDerWaalsContact O-N 3.08Å
52	T	90.1	Very high	81.1	Confident	83 Å²	83	125.1 Å²	125.1	51%	0.509	68%	0.676	S	S	.	*	H	α-helix	trans	-66.8	-40.8	176.5	-56.2	0	0	0	0	111.8	V48 D49 E50 L54 M55 A56	V48-T52 WeakPolarHBondContact O-CB 2.94Å; V48-T52 PolarHBondContact O-N 2.76Å; V48-T52 PolarHBondContact O-OG1 2.9Å; D49-T52 PolarHBondContact O-N 3.37Å; E50-T52 VanDerWaalsContact C-N 3.26Å; E50-T52 PolarHBondContact O-N 2.95Å; T52-L54 VanDerWaalsContact C-N 3.33Å; T52-L54 PolarHBondContact O-N 3.08Å; T52-M55 PolarHBondContact O-N 3.42Å; T52-A56 PolarHBondContact O-N 3.07Å; T52-A56 VanDerWaalsContact O-N 3.07Å
53	R	92.9	Very high	82.2	Confident	185 Å²	185	121.8 Å²	121.8	70%	0.698	67%	0.666	S	S	*	*	H	α-helix	trans	-64.3	-34.8	176.1	-74.7	177.3	83.4	-171.1	5.9	113.1	D49 E50 Q57	D49-R53 VanDerWaalsContact O-CG 3.31Å; D49-R53 WeakPolarHBondContact O-CG 3.42Å; D49-R53 PolarHBondContact O-N 2.69Å; E50-R53 PolarHBondContact O-N 3.17Å; R53-Q57 WeakPolarHBondContact O-CG 3.3Å; R53-Q57 PolarHBondContact O-NE2 3.12Å
54	L	91.2	Very high	83.2	Confident	102 Å²	102	120.1 Å²	120.1	53%	0.534	66%	0.658	S	S	.	*	H	α-helix	trans	-72.4	-40.8	176.2	-70.3	173.9	0	0	0	111.6	E50 A51 T52 A56 Q57	E50-L54 WeakPolarHBondContact O-CG 3.47Å; E50-L54 PolarHBondContact O-N 3.36Å; A51-L54 PolarHBondContact O-N 3.37Å; T52-L54 VanDerWaalsContact C-N 3.33Å; T52-L54 PolarHBondContact O-N 3.08Å; L54-A56 VanDerWaalsContact C-N 3.26Å; L54-A56 PolarHBondContact O-N 2.92Å; L54-Q57 PolarHBondContact O-N 3.46Å; L54-Q57 VanDerWaalsContact O-N 3.12Å
55	M	87.8	Confident	84.1	Confident	139 Å²	139	116.4 Å²	116.4	69%	0.685	65%	0.648	S	S	*	*	H	α-helix	trans	-63.3	-32.8	175.8	-70.9	-69.1	-118.2	0	0	112.6	A51 T52 Q57 L58	A51-M55 VanDerWaalsContact O-CG 3.3Å; A51-M55 WeakPolarHBondContact O-CG 3.41Å; A51-M55 PolarHBondContact O-N 3.45Å; A51-M55 VanDerWaalsContact O-N 3.08Å; T52-M55 PolarHBondContact O-N 3.42Å; M55-Q57 PolarHBondContact O-N 3.35Å; M55-L58 PolarHBondContact O-N 3.37Å; M55-L58 HydrophobicContact SD-CD1 4.12Å
56	A	87.6	Confident	85.3	Confident	83 Å²	83	116.2 Å²	116.2	69%	0.686	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73	-10.5	176.7	0	0	0	0	0	114.2	T52 L54	T52-A56 PolarHBondContact O-N 3.07Å; T52-A56 VanDerWaalsContact O-N 3.07Å; L54-A56 VanDerWaalsContact C-N 3.26Å; L54-A56 PolarHBondContact O-N 2.92Å
57	Q	89.1	Confident	86.6	Confident	149 Å²	149	118.8 Å²	118.8	70%	0.696	63%	0.634	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.7	-4.9	177.9	-72.6	169.5	63.8	0	0	113.5	R53 L54 M55	R53-Q57 WeakPolarHBondContact O-CG 3.3Å; R53-Q57 PolarHBondContact O-NE2 3.12Å; L54-Q57 PolarHBondContact O-N 3.46Å; L54-Q57 VanDerWaalsContact O-N 3.12Å; M55-Q57 PolarHBondContact O-N 3.35Å
58	L	78.6	Confident	86.9	Confident	199 Å²	199	121.8 Å²	121.8	100%	1.042	65%	0.649	S	S	*	*			trans	-86.1	0	174.6	-66.7	173.3	0	0	0	111.1	M55	M55-L58 PolarHBondContact O-N 3.37Å; M55-L58 HydrophobicContact SD-CD1 4.12Å

Retrieved 58 of 58 residues in 16.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).