A0A087WNN9_MOUSE Loading...

ABPBG1

AlphaFold DB , UniProt , Accession A0A087WNN9, Species MOUSE (Mus musculus, Mouse), Gene Scgb2b1, Length 109 aa.

						>A0A087WNN9_MOUSE|A0A087WNN9|Scgb2b1
MKGTVLLALLVSRELGFLTKETCLPFLSVYLGVVSGYRFWLRKELATFHPTVEEKKKAFEKIQDCYEEAGLKTKTQDMKFMAAILFSPECKSYYTKEVLINILDKFSKK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.9	Very low	52.7	Low	208 Å²	208	81.3 Å²	81.3	100%	1.025	43%	0.433	S	S	*	.				0	120.7	0	-66.6	163.9	88.4	0	0	107.1	T4	M1-T4 PolarHBondContact O-OG1 2.8Å
2	K	38.8	Very low	52.9	Low	200 Å²	200	76.7 Å²	76.7	87%	0.87	41%	0.412	S	S	*	.			trans	-102.9	126.5	-178	-71.8	175.5	176.6	176.2	0	107.4
3	G	50.1	Low	52.5	Low	28 Å²	28	87.6 Å²	87.6	29%	0.289	44%	0.444	S	S	.	.	S	Bend	trans	109.8	22.6	-178	0	0	0	0	0	115.8	E54	G3-E54 WeakPolarHBondContact CA-OE2 2.9Å
4	T	59.4	Low	51.9	Low	45 Å²	45	93.7 Å²	93.7	28%	0.276	47%	0.47	S	S	.	.			trans	-93.8	2	-169.5	-9.5	0	0	0	0	113.9	M1 A8	M1-T4 PolarHBondContact O-OG1 2.8Å; T4-A8 WeakPolarHBondContact O-CB 3.47Å; T4-A8 PolarHBondContact O-N 3.31Å
5	V	56.6	Low	51.5	Low	1 Å²	1	94.8 Å²	94.8	1%	0.006	48%	0.477	C	S	.	.	H	α-helix	trans	-76.1	-53	-171.8	-170.4	0	0	0	0	111	L7 A8 L9 L45 F48 P50 E54 F59	V5-L7 PolarHBondContact O-N 3.2Å; V5-A8 PolarHBondContact O-N 3.06Å; V5-L9 WeakPolarHBondContact O-CG 3.19Å; V5-L9 PolarHBondContact O-N 3.4Å; V5-L45 HydrophobicContact CG1-CD2 4Å; V5-F48 HydrophobicContact CB-CB 4.15Å; V5-F48 HydrophobicContact CG1-CB 4.07Å; V5-F48 HydrophobicContact CG1-CD2 4.35Å; V5-F48 HydrophobicContact CG1-CG 4.25Å; V5-F48 HydrophobicContact CG2-CB 3.41Å; V5-F48 VanDerWaalsContact CG2-CB 3.41Å; V5-F48 HydrophobicContact CG2-CG 4.43Å; V5-P50 HydrophobicContact CG2-CB 3.59Å; V5-P50 HydrophobicContact CG2-CG 4.41Å; V5-E54 PolarHBondContact N-OE1 3.16Å; V5-F59 HydrophobicContact CB-CE2 4.47Å; V5-F59 HydrophobicContact CG1-CE2 3.87Å; V5-F59 HydrophobicContact CG1-CZ 3.99Å
6	L	58.8	Low	51.4	Low	83 Å²	83	92.2 Å²	92.2	44%	0.435	48%	0.482	S	S	.	.	H	α-helix	trans	-65.2	-37.8	178.1	-142.4	108.5	0	0	0	110.2	L9 L10 E54	L6-L9 PolarHBondContact O-N 3.16Å; L6-L10 HydrophobicContact CD2-CD1 3.79Å; L6-L10 HydrophobicContact CG-CD1 4.47Å; L6-L10 VanDerWaalsContact O-CB 3.31Å; L6-L10 WeakPolarHBondContact O-CB 3.42Å; L6-L10 VanDerWaalsContact O-CG 3.27Å; L6-L10 WeakPolarHBondContact O-CG 3.34Å; L6-L10 PolarHBondContact O-N 3.04Å; L6-E54 PolarHBondContact N-OE1 3.48Å
7	L	53.4	Low	50.8	Low	101 Å²	101	97.6 Å²	97.6	53%	0.529	50%	0.501	S	S	.	.	H	α-helix	trans	-66.3	-43.5	176.7	-159.9	73	0	0	0	111.5	V5 L9 L10 V11	V5-L7 PolarHBondContact O-N 3.2Å; L7-L9 VanDerWaalsContact C-N 3.33Å; L7-L9 PolarHBondContact O-N 2.87Å; L7-L10 PolarHBondContact O-N 3Å; L7-V11 HydrophobicContact CD1-CG2 4.25Å; L7-V11 HydrophobicContact CG-CG2 3.88Å; L7-V11 WeakPolarHBondContact O-CA 3.45Å; L7-V11 WeakPolarHBondContact O-CB 3.41Å; L7-V11 WeakPolarHBondContact O-CG2 3.32Å; L7-V11 PolarHBondContact O-N 3.06Å
8	A	57.3	Low	50.6	Low	34 Å²	34	96.2 Å²	96.2	28%	0.281	49%	0.494	S	S	.	.	H	α-helix	trans	-64.8	-37	176.1	0	0	0	0	0	112.3	T4 V5 S12	T4-A8 WeakPolarHBondContact O-CB 3.47Å; T4-A8 PolarHBondContact O-N 3.31Å; V5-A8 PolarHBondContact O-N 3.06Å; A8-S12 WeakPolarHBondContact O-CB 3.1Å; A8-S12 PolarHBondContact O-N 3.14Å; A8-S12 PolarHBondContact O-OG 3.03Å
9	L	58.7	Low	50.6	Low	46 Å²	46	94.1 Å²	94.1	24%	0.241	49%	0.486	C	S	.	.	H	α-helix	trans	-67.5	-41.4	173.7	-70	178.1	0	0	0	112.4	V5 L6 L7 F26 F59	V5-L9 WeakPolarHBondContact O-CG 3.19Å; V5-L9 PolarHBondContact O-N 3.4Å; L6-L9 PolarHBondContact O-N 3.16Å; L7-L9 VanDerWaalsContact C-N 3.33Å; L7-L9 PolarHBondContact O-N 2.87Å; L9-F26 HydrophobicContact CD2-CB 4.09Å; L9-F26 HydrophobicContact CD2-CD2 3.9Å; L9-F59 HydrophobicContact CD1-CE1 4.34Å; L9-F59 HydrophobicContact CD1-CZ 3.9Å
10	L	54.1	Low	50.7	Low	96 Å²	96	95.4 Å²	95.4	50%	0.503	49%	0.488	S	S	.	.	H	α-helix	trans	-73.8	-43.1	178.1	-75.3	169.3	0	0	0	112.8	L6 L7 S12 R13 E14	L6-L10 HydrophobicContact CD2-CD1 3.79Å; L6-L10 HydrophobicContact CG-CD1 4.47Å; L6-L10 VanDerWaalsContact O-CB 3.31Å; L6-L10 WeakPolarHBondContact O-CB 3.42Å; L6-L10 VanDerWaalsContact O-CG 3.27Å; L6-L10 WeakPolarHBondContact O-CG 3.34Å; L6-L10 PolarHBondContact O-N 3.04Å; L7-L10 PolarHBondContact O-N 3Å; L10-S12 PolarHBondContact O-N 3.18Å; L10-R13 WeakPolarHBondContact O-CB 3.45Å; L10-R13 PolarHBondContact O-N 3.24Å; L10-E14 PolarHBondContact O-N 3.29Å
11	V	52.7	Low	50.8	Low	52 Å²	52	97.9 Å²	97.9	32%	0.315	50%	0.498	S	S	.	.	H	α-helix	trans	-64.8	-29	179.3	171.6	0	0	0	0	111.3	L7 R13 E14 L15	L7-V11 HydrophobicContact CD1-CG2 4.25Å; L7-V11 HydrophobicContact CG-CG2 3.88Å; L7-V11 WeakPolarHBondContact O-CA 3.45Å; L7-V11 WeakPolarHBondContact O-CB 3.41Å; L7-V11 WeakPolarHBondContact O-CG2 3.32Å; L7-V11 PolarHBondContact O-N 3.06Å; V11-R13 PolarHBondContact O-N 3.27Å; V11-E14 PolarHBondContact O-N 3.03Å; V11-L15 HydrophobicContact CG1-CB 4.41Å; V11-L15 HydrophobicContact CG1-CD1 3.43Å; V11-L15 VanDerWaalsContact CG1-CD1 3.43Å; V11-L15 HydrophobicContact CG1-CG 4.02Å; V11-L15 PolarHBondContact O-N 3.41Å
12	S	54.9	Low	51.8	Low	26 Å²	26	89.6 Å²	89.6	18%	0.182	46%	0.459	C	S	.	.	H	α-helix	trans	-59.9	-28.8	171	-64.1	0	0	0	0	113.1	A8 L10 T22	A8-S12 WeakPolarHBondContact O-CB 3.1Å; A8-S12 PolarHBondContact O-N 3.14Å; A8-S12 PolarHBondContact O-OG 3.03Å; L10-S12 PolarHBondContact O-N 3.18Å; S12-T22 WeakPolarHBondContact CB-OG1 3.28Å; S12-T22 VanDerWaalsContact OG-CB 3.23Å; S12-T22 WeakPolarHBondContact OG-CB 3.34Å; S12-T22 WeakPolarHBondContact OG-CG2 3.42Å; S12-T22 PolarHBondContact OG-OG1 3.21Å
13	R	48.5	Very low	53.4	Low	219 Å²	219	80.8 Å²	80.8	83%	0.826	42%	0.422	S	S	*	.	H	α-helix	trans	-85.2	-38.4	179.4	-173.1	-179	173.3	-163.5	-2.5	112.7	L10 V11	L10-R13 WeakPolarHBondContact O-CB 3.45Å; L10-R13 PolarHBondContact O-N 3.24Å; V11-R13 PolarHBondContact O-N 3.27Å
14	E	43.8	Very low	54.6	Low	173 Å²	173	81.4 Å²	81.4	81%	0.808	42%	0.418	S	S	*	.	H	α-helix	trans	-85.4	-32.4	-175.9	-74.3	-168.9	167.2	0	0	114.3	L10 V11	L10-E14 PolarHBondContact O-N 3.29Å; V11-E14 PolarHBondContact O-N 3.03Å
15	L	45.1	Very low	55.6	Low	110 Å²	110	81.1 Å²	81.1	58%	0.576	42%	0.418	S	S	*	.	S	Bend	trans	-92.7	-12.1	-176.7	-70.9	179.4	0	0	0	113.9	V11 F17	V11-L15 HydrophobicContact CG1-CB 4.41Å; V11-L15 HydrophobicContact CG1-CD1 3.43Å; V11-L15 VanDerWaalsContact CG1-CD1 3.43Å; V11-L15 HydrophobicContact CG1-CG 4.02Å; V11-L15 PolarHBondContact O-N 3.41Å; L15-F17 HydrophobicContact CB-CD2 4.43Å; L15-F17 WeakPolarHBondContact O-CD2 3Å; L15-F17 PolarHBondContact O-N 3.16Å
16	G	49.9	Very low	56.8	Low	53 Å²	53	85 Å²	85	55%	0.546	43%	0.434	S	S	.	.			trans	60.2	-0	178.2	0	0	0	0	0	116
17	F	42.1	Very low	58	Low	184 Å²	184	81 Å²	81	81%	0.807	41%	0.414	S	S	*	.	S	Bend	trans	-92.8	-4.7	-166.1	-89.9	-71.1	0	0	0	115.3	L15	L15-F17 HydrophobicContact CB-CD2 4.43Å; L15-F17 WeakPolarHBondContact O-CD2 3Å; L15-F17 PolarHBondContact O-N 3.16Å
18	L	45.9	Very low	59.5	Low	73 Å²	73	76.4 Å²	76.4	38%	0.382	39%	0.39	S	S	.	.			trans	-134.7	25.2	-170.5	-86.2	157.4	0	0	0	114.4	K20 E21 T22	L18-K20 PolarHBondContact O-N 3.43Å; L18-E21 HydrophobicContact CD2-CB 3.75Å; L18-E21 HydrophobicContact CD2-CG 4.2Å; L18-E21 WeakPolarHBondContact CD2-OE2 3.05Å; L18-E21 PolarHBondContact O-N 3.26Å; L18-E21 VanDerWaalsContact O-N 3.16Å; L18-T22 HydrophobicContact CB-CG2 3.88Å; L18-T22 PolarHBondContact O-N 3.32Å; L18-T22 PolarHBondContact O-OG1 2.63Å
19	T	52.2	Low	61	Low	55 Å²	55	75 Å²	75	34%	0.337	38%	0.378	S	S	.	.	H	α-helix	trans	-56.9	-26.1	-176.8	50.3	0	0	0	0	114.6	C23	T19-C23 VanDerWaalsContact O-CB 3.23Å; T19-C23 WeakPolarHBondContact O-CB 3.23Å
20	K	51.1	Low	62.4	Low	121 Å²	121	73.7 Å²	73.7	53%	0.526	37%	0.37	S	S	.	.	H	α-helix	trans	-81.3	-42.6	176.2	-59.8	-173.7	-167.2	-179.7	0	113.5	L18 T95 V98	L18-K20 PolarHBondContact O-N 3.43Å; K20-T95 HydrophobicContact CD-CG2 4.09Å; K20-T95 VanDerWaalsContact CE-CG2 3.45Å; K20-V98 HydrophobicContact CB-CG2 4.2Å; K20-V98 HydrophobicContact CG-CG2 4.24Å
21	E	54	Low	64.2	Low	148 Å²	148	69.9 Å²	69.9	69%	0.692	35%	0.35	S	S	*	.	H	α-helix	trans	-86.3	-27.2	-172.1	-67.5	-174.5	172.8	0	0	112.8	L18 P25	L18-E21 HydrophobicContact CD2-CB 3.75Å; L18-E21 HydrophobicContact CD2-CG 4.2Å; L18-E21 WeakPolarHBondContact CD2-OE2 3.05Å; L18-E21 PolarHBondContact O-N 3.26Å; L18-E21 VanDerWaalsContact O-N 3.16Å; E21-P25 WeakPolarHBondContact O-CD 3.25Å; E21-P25 WeakPolarHBondContact O-CG 3.19Å
22	T	60.7	Low	66	Low	34 Å²	34	67.4 Å²	67.4	21%	0.209	34%	0.335	C	S	.	.	H	α-helix	trans	-100.4	-12.4	-176.2	60.7	0	0	0	0	114.6	S12 L18 P25 F26	S12-T22 WeakPolarHBondContact CB-OG1 3.28Å; S12-T22 VanDerWaalsContact OG-CB 3.23Å; S12-T22 WeakPolarHBondContact OG-CB 3.34Å; S12-T22 WeakPolarHBondContact OG-CG2 3.42Å; S12-T22 PolarHBondContact OG-OG1 3.21Å; L18-T22 HydrophobicContact CB-CG2 3.88Å; L18-T22 PolarHBondContact O-N 3.32Å; L18-T22 PolarHBondContact O-OG1 2.63Å; T22-P25 WeakPolarHBondContact O-CD 3.49Å; T22-F26 VanDerWaalsContact O-CB 3.28Å; T22-F26 WeakPolarHBondContact O-CB 3.23Å; T22-F26 PolarHBondContact O-N 3.39Å
23	C	71.3	Confident	67.8	Low	14 Å²	14	66.6 Å²	66.6	10%	0.095	33%	0.329	C	S	.	.	H	α-helix	trans	-63.7	-49.4	174.8	-177.7	0	0	0	0	112.2	T19 F26 L27	T19-C23 VanDerWaalsContact O-CB 3.23Å; T19-C23 WeakPolarHBondContact O-CB 3.23Å; C23-F26 PolarHBondContact O-N 2.92Å; C23-L27 VanDerWaalsContact O-CG 3.3Å; C23-L27 WeakPolarHBondContact O-CG 3.32Å; C23-L27 PolarHBondContact O-N 3.02Å
24	L	76.1	Confident	70	Confident	41 Å²	41	56.1 Å²	56.1	22%	0.215	29%	0.289	C	S	.	.	H	α-helix	trans	-67.2	-40.6	-178.1	-59.7	174.9	0	0	0	113.4	L27 S28 N101 I102	L24-L27 PolarHBondContact O-N 3.04Å; L24-S28 WeakPolarHBondContact O-CB 3.03Å; L24-S28 PolarHBondContact O-N 2.9Å; L24-S28 PolarHBondContact O-OG 3.44Å; L24-N101 HydrophobicContact CD1-CB 3.91Å; L24-N101 HydrophobicContact CD2-CB 3.66Å; L24-N101 HydrophobicContact CG-CB 4.44Å; L24-I102 HydrophobicContact CD2-CG1 4.2Å
25	P	79.8	Confident	72.2	Confident	40 Å²	40	50 Å²	50	26%	0.26	27%	0.265	S	S	.	.	H	α-helix	trans	-66.7	-38.8	172.9	-21.7	33.8	0	0	0	113.1	E21 T22 L27 S28 V29 F48	E21-P25 WeakPolarHBondContact O-CD 3.25Å; E21-P25 WeakPolarHBondContact O-CG 3.19Å; T22-P25 WeakPolarHBondContact O-CD 3.49Å; P25-L27 PolarHBondContact O-N 2.74Å; P25-S28 PolarHBondContact O-N 3.37Å; P25-V29 WeakPolarHBondContact O-CG2 3.08Å; P25-V29 PolarHBondContact O-N 3.24Å; P25-F48 HydrophobicContact CB-CE1 4.12Å; P25-F48 HydrophobicContact CB-CE2 4.38Å; P25-F48 HydrophobicContact CB-CZ 3.42Å; P25-F48 VanDerWaalsContact CB-CZ 3.42Å
26	F	81.8	Confident	74.4	Confident	81 Å²	81	45.6 Å²	45.6	36%	0.355	25%	0.247	S	C	.	.	H	α-helix	trans	-57.3	-49.8	172.1	168.2	-98.6	0	0	0	111.3	L9 T22 C23 S28 V29 Y30 M81	L9-F26 HydrophobicContact CD2-CB 4.09Å; L9-F26 HydrophobicContact CD2-CD2 3.9Å; T22-F26 VanDerWaalsContact O-CB 3.28Å; T22-F26 WeakPolarHBondContact O-CB 3.23Å; T22-F26 PolarHBondContact O-N 3.39Å; C23-F26 PolarHBondContact O-N 2.92Å; F26-S28 VanDerWaalsContact C-N 3.29Å; F26-S28 PolarHBondContact O-N 3.44Å; F26-V29 PolarHBondContact O-N 3.19Å; F26-Y30 WeakPolarHBondContact O-CB 3.47Å; F26-Y30 PolarHBondContact O-N 3.32Å; F26-M81 HydrophobicContact CE1-CE 4.35Å; F26-M81 HydrophobicContact CE1-SD 4.26Å; F26-M81 HydrophobicContact CZ-CE 4.22Å
27	L	83.8	Confident	76.4	Confident	0 Å²	0	49.4 Å²	49.4	0%	0	25%	0.246	C	C	.	.	H	α-helix	trans	-62.4	-37.3	179.4	-69	175	0	0	0	112.3	C23 L24 P25 Y30 L31 L85 I102 F106	C23-L27 VanDerWaalsContact O-CG 3.3Å; C23-L27 WeakPolarHBondContact O-CG 3.32Å; C23-L27 PolarHBondContact O-N 3.02Å; L24-L27 PolarHBondContact O-N 3.04Å; P25-L27 PolarHBondContact O-N 2.74Å; L27-Y30 PolarHBondContact O-N 2.98Å; L27-L31 WeakPolarHBondContact O-CB 3.4Å; L27-L31 VanDerWaalsContact O-CG 3.24Å; L27-L31 WeakPolarHBondContact O-CG 3.36Å; L27-L31 PolarHBondContact O-N 3.3Å; L27-L85 HydrophobicContact CD1-CD1 4.3Å; L27-L85 HydrophobicContact CD2-CD1 3.45Å; L27-L85 VanDerWaalsContact CD2-CD1 3.45Å; L27-L85 HydrophobicContact CD2-CD2 4.17Å; L27-L85 HydrophobicContact CD2-CG 4.41Å; L27-I102 HydrophobicContact CD1-CB 4.27Å; L27-I102 HydrophobicContact CD1-CD1 4.38Å; L27-I102 HydrophobicContact CD1-CG1 3.67Å; L27-I102 HydrophobicContact CD1-CG2 3.99Å; L27-F106 HydrophobicContact CD2-CE2 4.28Å
28	S	84.9	Confident	78.8	Confident	5 Å²	5	43.7 Å²	43.7	4%	0.035	22%	0.218	C	C	.	.	H	α-helix	trans	-68	-41.2	178.6	-55.2	0	0	0	0	111.6	L24 P25 F26 G32 E44 K105	L24-S28 WeakPolarHBondContact O-CB 3.03Å; L24-S28 PolarHBondContact O-N 2.9Å; L24-S28 PolarHBondContact O-OG 3.44Å; P25-S28 PolarHBondContact O-N 3.37Å; F26-S28 VanDerWaalsContact C-N 3.29Å; F26-S28 PolarHBondContact O-N 3.44Å; S28-G32 PolarHBondContact O-N 2.97Å; S28-E44 VanDerWaalsContact CB-OE2 3.24Å; S28-E44 WeakPolarHBondContact CB-OE2 3.34Å; S28-K105 WeakPolarHBondContact OG-CE 2.95Å; S28-K105 PolarHBondContact OG-NZ 2.71Å
29	V	88.6	Confident	81	Confident	4 Å²	4	46.3 Å²	46.3	2%	0.024	23%	0.227	C	C	.	.	H	α-helix	trans	-65.7	-44.3	173.2	174.4	0	0	0	0	111.1	P25 F26 G32 V33 L41 E44 L45 F48 F59	P25-V29 WeakPolarHBondContact O-CG2 3.08Å; P25-V29 PolarHBondContact O-N 3.24Å; F26-V29 PolarHBondContact O-N 3.19Å; V29-G32 CarbonylContact O-C 3.6Å; V29-G32 WeakPolarHBondContact O-CA 3.31Å; V29-G32 PolarHBondContact O-N 2.61Å; V29-V33 WeakPolarHBondContact O-CG2 3.36Å; V29-V33 PolarHBondContact O-N 3.26Å; V29-L41 HydrophobicContact CG1-CD1 4.29Å; V29-E44 HydrophobicContact CG2-CB 4.05Å; V29-L45 HydrophobicContact CG1-CD2 3.98Å; V29-L45 HydrophobicContact CG2-CD2 4.24Å; V29-F48 HydrophobicContact CG2-CE2 3.87Å; V29-F59 HydrophobicContact CG1-CD1 3.9Å; V29-F59 HydrophobicContact CG1-CE1 3.61Å; V29-F59 HydrophobicContact CG1-CZ 4.39Å
30	Y	90	Very high	82.8	Confident	19 Å²	19	47.7 Å²	47.7	8%	0.075	23%	0.226	C	C	.	.	H	α-helix	trans	-57.1	-50.6	176	167.1	-101.2	0	0	0	111.7	F26 L27 G32 V33 V34 D77 M78 M81	F26-Y30 WeakPolarHBondContact O-CB 3.47Å; F26-Y30 PolarHBondContact O-N 3.32Å; L27-Y30 PolarHBondContact O-N 2.98Å; Y30-G32 VanDerWaalsContact C-N 3.29Å; Y30-G32 PolarHBondContact O-N 3.2Å; Y30-V33 WeakPolarHBondContact O-CB 3.42Å; Y30-V33 PolarHBondContact O-N 2.99Å; Y30-V33 VanDerWaalsContact O-N 3.1Å; Y30-V34 HydrophobicContact CD2-CG2 4.02Å; Y30-V34 HydrophobicContact CE1-CG2 4.22Å; Y30-V34 HydrophobicContact CE2-CG2 3.5Å; Y30-V34 VanDerWaalsContact CE2-CG2 3.5Å; Y30-V34 WeakPolarHBondContact O-CG2 3.43Å; Y30-V34 PolarHBondContact O-N 3.47Å; Y30-D77 WeakPolarHBondContact CE2-OD2 3.15Å; Y30-D77 PolarHBondContact OH-O 2.85Å; Y30-D77 PolarHBondContact OH-OD2 3.23Å; Y30-M78 WeakPolarHBondContact OH-CA 3.42Å; Y30-M78 PolarHBondContact OH-N 3.24Å; Y30-M81 HydrophobicContact CD1-CG 4.2Å; Y30-M81 HydrophobicContact CD2-CE 3.93Å; Y30-M81 HydrophobicContact CE1-CB 3.97Å; Y30-M81 HydrophobicContact CE1-CG 3.72Å; Y30-M81 HydrophobicContact CE2-CE 3.71Å; Y30-M81 HydrophobicContact CE2-CG 4.48Å; Y30-M81 HydrophobicContact CG-CE 4.42Å
31	L	90.4	Very high	84.7	Confident	15 Å²	15	42 Å²	42	8%	0.079	20%	0.201	C	C	.	.	H	α-helix	trans	-61.6	-39.4	176.1	-71	173.3	0	0	0	111.4	L27 V33 V34 S35 W40 K105	L27-L31 WeakPolarHBondContact O-CB 3.4Å; L27-L31 VanDerWaalsContact O-CG 3.24Å; L27-L31 WeakPolarHBondContact O-CG 3.36Å; L27-L31 PolarHBondContact O-N 3.3Å; L31-V33 VanDerWaalsContact C-N 3.34Å; L31-V33 PolarHBondContact O-N 2.81Å; L31-V34 PolarHBondContact O-N 3.45Å; L31-S35 WeakPolarHBondContact O-CB 3.39Å; L31-S35 PolarHBondContact O-N 3.34Å; L31-S35 PolarHBondContact O-OG 3.29Å; L31-W40 HydrophobicContact CB-CH2 4.11Å; L31-W40 HydrophobicContact CB-CZ2 4.34Å; L31-K105 HydrophobicContact CD1-CB 4.11Å
32	G	91.7	Very high	86.5	Confident	0 Å²	0	39.7 Å²	39.7	0%	0	19%	0.186	C	C	.	.	H	α-helix	trans	-55.2	-48.2	171.2	0	0	0	0	0	112	S28 V29 Y30 S35 Q63	S28-G32 PolarHBondContact O-N 2.97Å; V29-G32 CarbonylContact O-C 3.6Å; V29-G32 WeakPolarHBondContact O-CA 3.31Å; V29-G32 PolarHBondContact O-N 2.61Å; Y30-G32 VanDerWaalsContact C-N 3.29Å; Y30-G32 PolarHBondContact O-N 3.2Å; G32-S35 PolarHBondContact O-OG 3.14Å; G32-Q63 PolarHBondContact O-NE2 2.72Å
33	V	93	Very high	87.8	Confident	9 Å²	9	44.5 Å²	44.5	6%	0.055	20%	0.204	C	C	.	.	H	α-helix	trans	-61	-55.8	177.4	169.4	0	0	0	0	111.1	V29 Y30 L31 S35 G36 L41 F59 I62 Q63 Y66	V29-V33 WeakPolarHBondContact O-CG2 3.36Å; V29-V33 PolarHBondContact O-N 3.26Å; Y30-V33 WeakPolarHBondContact O-CB 3.42Å; Y30-V33 PolarHBondContact O-N 2.99Å; Y30-V33 VanDerWaalsContact O-N 3.1Å; L31-V33 VanDerWaalsContact C-N 3.34Å; L31-V33 PolarHBondContact O-N 2.81Å; V33-S35 VanDerWaalsContact C-N 3.27Å; V33-S35 PolarHBondContact O-N 2.99Å; V33-G36 PolarHBondContact O-N 2.98Å; V33-L41 HydrophobicContact CG2-CD1 3.66Å; V33-L41 HydrophobicContact CG2-CD2 4.29Å; V33-F59 HydrophobicContact CG2-CD1 4.15Å; V33-I62 HydrophobicContact CG1-CB 4.25Å; V33-I62 HydrophobicContact CG1-CG2 3.56Å; V33-Q63 HydrophobicContact CG1-CB 4.4Å; V33-Q63 WeakPolarHBondContact O-CG 3.24Å; V33-Y66 HydrophobicContact CG1-CD2 3.63Å; V33-Y66 HydrophobicContact CG1-CE2 3.72Å
34	V	93.6	Very high	88.6	Confident	0 Å²	0	45.6 Å²	45.6	0%	0	21%	0.208	C	C	.	.	H	α-helix	trans	-67.7	-28.4	-174.5	-175.2	0	0	0	0	112.1	Y30 L31 G36 Y66 K74 M78	Y30-V34 HydrophobicContact CD2-CG2 4.02Å; Y30-V34 HydrophobicContact CE1-CG2 4.22Å; Y30-V34 HydrophobicContact CE2-CG2 3.5Å; Y30-V34 VanDerWaalsContact CE2-CG2 3.5Å; Y30-V34 WeakPolarHBondContact O-CG2 3.43Å; Y30-V34 PolarHBondContact O-N 3.47Å; L31-V34 PolarHBondContact O-N 3.45Å; V34-G36 PolarHBondContact O-N 3.41Å; V34-Y66 HydrophobicContact CG1-CD1 4.2Å; V34-Y66 HydrophobicContact CG1-CE1 4.32Å; V34-Y66 HydrophobicContact CG2-CD1 4.31Å; V34-Y66 HydrophobicContact CG2-CE1 3.92Å; V34-Y66 HydrophobicContact CG2-CE2 4.19Å; V34-K74 HydrophobicContact CG1-CB 3.71Å; V34-K74 HydrophobicContact CG1-CG 3.95Å; V34-K74 WeakPolarHBondContact O-CD 3.12Å; V34-M78 HydrophobicContact CB-CE 4.07Å; V34-M78 HydrophobicContact CG1-CE 3.5Å; V34-M78 VanDerWaalsContact CG1-CE 3.5Å; V34-M78 HydrophobicContact CG1-CG 4.1Å
35	S	90.6	Very high	89.1	Confident	43 Å²	43	43.6 Å²	43.6	30%	0.301	20%	0.198	S	C	.	.	H	α-helix	trans	-64.7	-24.6	179.9	71.8	0	0	0	0	114.3	L31 G32 V33 Y37	L31-S35 WeakPolarHBondContact O-CB 3.39Å; L31-S35 PolarHBondContact O-N 3.34Å; L31-S35 PolarHBondContact O-OG 3.29Å; G32-S35 PolarHBondContact O-OG 3.14Å; V33-S35 VanDerWaalsContact C-N 3.27Å; V33-S35 PolarHBondContact O-N 2.99Å; S35-Y37 PolarHBondContact O-N 3.19Å; S35-Y37 PolarHBondContact OG-N 3.06Å
36	G	90.3	Very high	89.4	Confident	18 Å²	18	44.5 Å²	44.5	19%	0.186	21%	0.208	C	C	.	.			trans	79.1	-12.6	-168.8	0	0	0	0	0	116.3	V33 V34 R38 E67	V33-G36 PolarHBondContact O-N 2.98Å; V34-G36 PolarHBondContact O-N 3.41Å; G36-R38 PolarHBondContact O-N 3.47Å; G36-E67 WeakPolarHBondContact CA-OE1 3.36Å
37	Y	92.4	Very high	89.3	Confident	134 Å²	134	45.5 Å²	45.5	53%	0.525	22%	0.221	S	C	.	.			trans	-81.8	95.6	-170.4	-173.9	-141	0	0	0	110.8	S35 F39 W40 L41	S35-Y37 PolarHBondContact O-N 3.19Å; S35-Y37 PolarHBondContact OG-N 3.06Å; Y37-F39 VanDerWaalsContact C-N 3.28Å; Y37-F39 HydrophobicContact CD2-CB 4.43Å; Y37-F39 HydrophobicContact CE1-CB 4.1Å; Y37-F39 AromaticContact CE1-CD1 3.93Å; Y37-F39 HydrophobicContact CE1-CD1 3.93Å; Y37-F39 HydrophobicContact CE2-CB 3.81Å; Y37-F39 AromaticContact CZ-CD1 3.86Å; Y37-F39 PolarHBondContact O-N 3.03Å; Y37-F39 WeakPolarHBondContact OH-CD1 3.47Å; Y37-W40 HydrophobicContact CD1-CB 3.26Å; Y37-W40 HydrophobicContact CD1-CE3 4.49Å; Y37-W40 HydrophobicContact CD1-CG 4.33Å; Y37-W40 HydrophobicContact CE1-CB 3.85Å; Y37-W40 HydrophobicContact CG-CB 4.05Å; Y37-W40 PolarHBondContact O-N 3.49Å; Y37-L41 PolarHBondContact O-N 2.96Å
38	R	92.4	Very high	89.1	Confident	63 Å²	63	47.7 Å²	47.7	24%	0.238	23%	0.231	C	C	.	.	H	α-helix	trans	-48.1	-45.2	-178.8	-84.4	-76.8	-168.9	-117.9	9.2	113.9	G36 R42 E60 Q63 D64	G36-R38 PolarHBondContact O-N 3.47Å; R38-R42 WeakPolarHBondContact O-CB 3.48Å; R38-R42 WeakPolarHBondContact O-CG 3.5Å; R38-R42 PolarHBondContact O-N 3.35Å; R38-E60 VanDerWaalsContact CZ-O 3.29Å; R38-E60 IonicContact NE-OE2 2.7Å; R38-E60 VanDerWaalsContact NH1-C 3.25Å; R38-E60 PolarHBondContact NH1-O 3.46Å; R38-E60 PolarHBondContact NH2-O 3.18Å; R38-Q63 VanDerWaalsContact CD-OE1 3.25Å; R38-D64 IonicContact CZ-OD1 3.99Å; R38-D64 IonicContact CZ-OD2 2.69Å; R38-D64 IonicContact NH1-OD1 3.98Å; R38-D64 IonicContact NH2-OD1 3.79Å; R38-D64 PolarHBondContact NH2-OD1 3.33Å; R38-D64 IonicContact NH2-OD2 3.39Å; R38-D64 PolarHBondContact NH2-OD2 3.42Å
39	F	91.9	Very high	88.9	Confident	129 Å²	129	54.2 Å²	54.2	57%	0.566	26%	0.26	S	S	*	.	H	α-helix	trans	-63.5	-43.5	-178.7	175.6	-97.5	0	0	0	111.4	Y37 R42 K43	Y37-F39 VanDerWaalsContact C-N 3.28Å; Y37-F39 HydrophobicContact CD2-CB 4.43Å; Y37-F39 HydrophobicContact CE1-CB 4.1Å; Y37-F39 AromaticContact CE1-CD1 3.93Å; Y37-F39 HydrophobicContact CE1-CD1 3.93Å; Y37-F39 HydrophobicContact CE2-CB 3.81Å; Y37-F39 AromaticContact CZ-CD1 3.86Å; Y37-F39 PolarHBondContact O-N 3.03Å; Y37-F39 WeakPolarHBondContact OH-CD1 3.47Å; F39-R42 PolarHBondContact O-N 3.5Å; F39-K43 WeakPolarHBondContact O-CB 3.39Å; F39-K43 PolarHBondContact O-N 2.78Å
40	W	90.4	Very high	88.5	Confident	84 Å²	84	55.5 Å²	55.5	32%	0.318	27%	0.269	S	S	.	.	H	α-helix	trans	-66	-47.8	178.1	-178.2	18.4	0	0	0	112	L31 Y37 R42 K43 E44	L31-W40 HydrophobicContact CB-CH2 4.11Å; L31-W40 HydrophobicContact CB-CZ2 4.34Å; Y37-W40 HydrophobicContact CD1-CB 3.26Å; Y37-W40 HydrophobicContact CD1-CE3 4.49Å; Y37-W40 HydrophobicContact CD1-CG 4.33Å; Y37-W40 HydrophobicContact CE1-CB 3.85Å; Y37-W40 HydrophobicContact CG-CB 4.05Å; Y37-W40 PolarHBondContact O-N 3.49Å; W40-R42 VanDerWaalsContact C-N 3.26Å; W40-R42 PolarHBondContact O-N 3Å; W40-K43 WeakPolarHBondContact O-CB 3.48Å; W40-K43 PolarHBondContact O-N 2.92Å; W40-E44 PolarHBondContact NE1-OE1 3.26Å; W40-E44 WeakPolarHBondContact O-CG 3.44Å; W40-E44 PolarHBondContact O-N 3.43Å
41	L	91.2	Very high	88.3	Confident	0 Å²	0	56.4 Å²	56.4	0%	0	28%	0.277	C	S	.	.	H	α-helix	trans	-53.8	-45.1	174.9	176.1	59.4	0	0	0	111.7	V29 V33 Y37 K43 E44 L45 F59 Q63	V29-L41 HydrophobicContact CG1-CD1 4.29Å; V33-L41 HydrophobicContact CG2-CD1 3.66Å; V33-L41 HydrophobicContact CG2-CD2 4.29Å; Y37-L41 PolarHBondContact O-N 2.96Å; L41-K43 VanDerWaalsContact C-N 3.33Å; L41-K43 PolarHBondContact O-N 3.3Å; L41-E44 PolarHBondContact O-N 3.44Å; L41-L45 HydrophobicContact CD1-CD1 3.82Å; L41-L45 HydrophobicContact CD1-CG 4.07Å; L41-L45 HydrophobicContact CG-CD1 3.88Å; L41-L45 WeakPolarHBondContact O-CB 3.45Å; L41-L45 VanDerWaalsContact O-CG 3.23Å; L41-L45 WeakPolarHBondContact O-CG 3.46Å; L41-L45 PolarHBondContact O-N 3.01Å; L41-F59 HydrophobicContact CD1-CB 4.4Å; L41-F59 HydrophobicContact CD2-CB 4.24Å; L41-Q63 HydrophobicContact CD2-CB 3.92Å; L41-Q63 HydrophobicContact CD2-CG 4.4Å
42	R	90.6	Very high	88.1	Confident	100 Å²	100	60 Å²	60	38%	0.377	30%	0.299	S	S	.	.	H	α-helix	trans	-63.8	-38	178.1	-71.7	175.5	171.6	177.9	6.4	112.9	R38 F39 W40 A46 K55 E60	R38-R42 WeakPolarHBondContact O-CB 3.48Å; R38-R42 WeakPolarHBondContact O-CG 3.5Å; R38-R42 PolarHBondContact O-N 3.35Å; F39-R42 PolarHBondContact O-N 3.5Å; W40-R42 VanDerWaalsContact C-N 3.26Å; W40-R42 PolarHBondContact O-N 3Å; R42-A46 WeakPolarHBondContact O-CB 3.3Å; R42-A46 PolarHBondContact O-N 3.16Å; R42-K55 HydrophobicContact CG-CD 4.3Å; R42-E60 IonicContact CZ-OE1 3.78Å; R42-E60 IonicContact NE-OE1 2.89Å; R42-E60 PolarHBondContact NE-OE1 3.28Å; R42-E60 IonicContact NH2-OE1 3.22Å; R42-E60 PolarHBondContact NH2-OE1 2.86Å; R42-E60 IonicContact NH2-OE2 3.21Å; R42-E60 PolarHBondContact NH2-OE2 3.42Å
43	K	89.9	Confident	87.8	Confident	136 Å²	136	65 Å²	65	59%	0.591	32%	0.322	S	S	*	.	H	α-helix	trans	-65.4	-47.5	177.9	-176.5	-175.9	175.8	-175.2	0	110.9	F39 W40 L41 L45 A46	F39-K43 WeakPolarHBondContact O-CB 3.39Å; F39-K43 PolarHBondContact O-N 2.78Å; W40-K43 WeakPolarHBondContact O-CB 3.48Å; W40-K43 PolarHBondContact O-N 2.92Å; L41-K43 VanDerWaalsContact C-N 3.33Å; L41-K43 PolarHBondContact O-N 3.3Å; K43-L45 PolarHBondContact O-N 3.33Å; K43-A46 WeakPolarHBondContact O-CB 3.39Å; K43-A46 PolarHBondContact O-N 2.94Å
44	E	86.5	Confident	87.3	Confident	36 Å²	36	65.7 Å²	65.7	17%	0.168	33%	0.325	C	S	.	.	H	α-helix	trans	-63	-43.7	178.5	-62.9	-59.2	154.8	0	0	111.2	S28 V29 W40 L41 A46 T47 F48	S28-E44 VanDerWaalsContact CB-OE2 3.24Å; S28-E44 WeakPolarHBondContact CB-OE2 3.34Å; V29-E44 HydrophobicContact CG2-CB 4.05Å; W40-E44 PolarHBondContact NE1-OE1 3.26Å; W40-E44 WeakPolarHBondContact O-CG 3.44Å; W40-E44 PolarHBondContact O-N 3.43Å; L41-E44 PolarHBondContact O-N 3.44Å; E44-A46 VanDerWaalsContact C-N 3.31Å; E44-A46 PolarHBondContact O-N 3.11Å; E44-T47 PolarHBondContact O-OG1 3.12Å; E44-F48 WeakPolarHBondContact O-CD2 3.27Å
45	L	86.4	Confident	86.9	Confident	0 Å²	0	68.5 Å²	68.5	0%	0	34%	0.337	C	S	.	.	H	α-helix	trans	-64.7	-32.6	177.9	-70.9	171.9	0	0	0	112.9	V5 V29 L41 K43 T47 F48 P50 F59	V5-L45 HydrophobicContact CG1-CD2 4Å; V29-L45 HydrophobicContact CG1-CD2 3.98Å; V29-L45 HydrophobicContact CG2-CD2 4.24Å; L41-L45 HydrophobicContact CD1-CD1 3.82Å; L41-L45 HydrophobicContact CD1-CG 4.07Å; L41-L45 HydrophobicContact CG-CD1 3.88Å; L41-L45 WeakPolarHBondContact O-CB 3.45Å; L41-L45 VanDerWaalsContact O-CG 3.23Å; L41-L45 WeakPolarHBondContact O-CG 3.46Å; L41-L45 PolarHBondContact O-N 3.01Å; K43-L45 PolarHBondContact O-N 3.33Å; L45-T47 PolarHBondContact O-N 3.28Å; L45-T47 VanDerWaalsContact O-N 3.12Å; L45-F48 PolarHBondContact O-N 3.04Å; L45-P50 HydrophobicContact CB-CG 4.17Å; L45-P50 WeakPolarHBondContact O-CD 3.31Å; L45-F59 HydrophobicContact CD1-CB 3.69Å; L45-F59 HydrophobicContact CD1-CD2 3.97Å; L45-F59 HydrophobicContact CD1-CG 3.85Å; L45-F59 HydrophobicContact CD2-CD1 4.14Å; L45-F59 HydrophobicContact CD2-CD2 3.63Å; L45-F59 HydrophobicContact CD2-CE1 4.19Å; L45-F59 HydrophobicContact CD2-CE2 3.7Å; L45-F59 HydrophobicContact CD2-CG 3.87Å; L45-F59 HydrophobicContact CD2-CZ 3.99Å; L45-F59 HydrophobicContact CG-CD2 4.48Å; L45-F59 HydrophobicContact CG-CG 4.48Å
46	A	86.4	Confident	86.7	Confident	58 Å²	58	72 Å²	72	48%	0.479	35%	0.347	S	S	.	.	H	α-helix	trans	-56.9	-31.9	-176.7	0	0	0	0	0	113.2	R42 K43 E44 F48 H49	R42-A46 WeakPolarHBondContact O-CB 3.3Å; R42-A46 PolarHBondContact O-N 3.16Å; K43-A46 WeakPolarHBondContact O-CB 3.39Å; K43-A46 PolarHBondContact O-N 2.94Å; E44-A46 VanDerWaalsContact C-N 3.31Å; E44-A46 PolarHBondContact O-N 3.11Å; A46-F48 PolarHBondContact O-N 3.16Å; A46-F48 VanDerWaalsContact O-N 3.11Å; A46-H49 PolarHBondContact O-N 3.49Å; A46-H49 VanDerWaalsContact O-N 3.16Å
47	T	80.4	Confident	86.4	Confident	102 Å²	102	77.9 Å²	77.9	63%	0.626	37%	0.367	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.5	-23.8	176.9	-41.6	0	0	0	0	113.1	E44 L45	E44-T47 PolarHBondContact O-OG1 3.12Å; L45-T47 PolarHBondContact O-N 3.28Å; L45-T47 VanDerWaalsContact O-N 3.12Å
48	F	79.3	Confident	86.2	Confident	46 Å²	46	73 Å²	73	20%	0.202	36%	0.355	C	S	.	.	T	Hydrogen-bonded Turn	trans	-105.8	6	-175.7	-53.9	-85.2	0	0	0	113.9	V5 P25 V29 E44 L45 A46	V5-F48 HydrophobicContact CB-CB 4.15Å; V5-F48 HydrophobicContact CG1-CB 4.07Å; V5-F48 HydrophobicContact CG1-CD2 4.35Å; V5-F48 HydrophobicContact CG1-CG 4.25Å; V5-F48 HydrophobicContact CG2-CB 3.41Å; V5-F48 VanDerWaalsContact CG2-CB 3.41Å; V5-F48 HydrophobicContact CG2-CG 4.43Å; P25-F48 HydrophobicContact CB-CE1 4.12Å; P25-F48 HydrophobicContact CB-CE2 4.38Å; P25-F48 HydrophobicContact CB-CZ 3.42Å; P25-F48 VanDerWaalsContact CB-CZ 3.42Å; V29-F48 HydrophobicContact CG2-CE2 3.87Å; E44-F48 WeakPolarHBondContact O-CD2 3.27Å; L45-F48 PolarHBondContact O-N 3.04Å; A46-F48 PolarHBondContact O-N 3.16Å; A46-F48 VanDerWaalsContact O-N 3.11Å
49	H	80.8	Confident	86.2	Confident	142 Å²	142	70.8 Å²	70.8	66%	0.657	35%	0.347	S	S	*	.			trans	49.3	54.7	-178.2	-54.2	-73.5	0	0	0	113.9	A46	A46-H49 PolarHBondContact O-N 3.49Å; A46-H49 VanDerWaalsContact O-N 3.16Å
50	P	80.2	Confident	86.2	Confident	31 Å²	31	65.3 Å²	65.3	20%	0.201	32%	0.323	C	S	.	.			trans	-62.4	150.6	-179.6	27.3	-37.5	0	0	0	111.7	V5 L45 E54	V5-P50 HydrophobicContact CG2-CB 3.59Å; V5-P50 HydrophobicContact CG2-CG 4.41Å; L45-P50 HydrophobicContact CB-CG 4.17Å; L45-P50 WeakPolarHBondContact O-CD 3.31Å; P50-E54 HydrophobicContact CB-CB 4.25Å
51	T	85.8	Confident	86.4	Confident	39 Å²	39	67.3 Å²	67.3	24%	0.239	33%	0.334	C	S	.	.			trans	-64.4	159.4	161.6	59.9	0	0	0	0	110.7	E53 E54 K55	T51-E53 PolarHBondContact O-N 2.94Å; T51-E54 PolarHBondContact N-OE2 3.11Å; T51-E54 PolarHBondContact O-N 3.22Å; T51-E54 WeakPolarHBondContact OG1-CB 3.47Å; T51-E54 WeakPolarHBondContact OG1-CG 3.27Å; T51-E54 PolarHBondContact OG1-N 3.02Å; T51-E54 VanDerWaalsContact OG1-N 3.12Å; T51-E54 PolarHBondContact OG1-OE2 2.73Å; T51-K55 PolarHBondContact O-N 3.39Å; T51-K55 VanDerWaalsContact O-N 3.16Å
52	V	86.9	Confident	86.5	Confident	89 Å²	89	71.2 Å²	71.2	54%	0.539	35%	0.354	S	S	.	.	H	α-helix	trans	-61.3	-36.2	176.7	177.3	0	0	0	0	110.1	K56	V52-K56 HydrophobicContact CG1-CD 3.98Å; V52-K56 HydrophobicContact CG1-CG 4.36Å; V52-K56 WeakPolarHBondContact O-CB 3.1Å; V52-K56 PolarHBondContact O-N 2.86Å
53	E	85.8	Confident	86.8	Confident	106 Å²	106	66.5 Å²	66.5	50%	0.495	34%	0.336	S	S	.	.	H	α-helix	trans	-65.8	-50	178	-73.1	64.6	-150.8	0	0	111.8	T51 K55 K56 K57 A58	T51-E53 PolarHBondContact O-N 2.94Å; E53-K55 VanDerWaalsContact C-N 3.29Å; E53-K55 PolarHBondContact O-N 2.98Å; E53-K56 PolarHBondContact O-N 2.81Å; E53-K57 HydrophobicContact CG-CD 4.38Å; E53-K57 WeakPolarHBondContact O-CA 3.42Å; E53-K57 VanDerWaalsContact O-CB 3.29Å; E53-K57 WeakPolarHBondContact O-CB 3.47Å; E53-K57 PolarHBondContact O-N 3.01Å; E53-A58 PolarHBondContact O-N 3.37Å
54	E	82.3	Confident	87	Confident	24 Å²	24	63 Å²	63	11%	0.112	32%	0.324	C	S	.	.	I	π-helix	trans	-57.5	-45	176.6	-77.1	166.9	124.2	0	0	111.1	G3 V5 L6 P50 T51 A58 F59	G3-E54 WeakPolarHBondContact CA-OE2 2.9Å; V5-E54 PolarHBondContact N-OE1 3.16Å; L6-E54 PolarHBondContact N-OE1 3.48Å; P50-E54 HydrophobicContact CB-CB 4.25Å; T51-E54 PolarHBondContact N-OE2 3.11Å; T51-E54 PolarHBondContact O-N 3.22Å; T51-E54 WeakPolarHBondContact OG1-CB 3.47Å; T51-E54 WeakPolarHBondContact OG1-CG 3.27Å; T51-E54 PolarHBondContact OG1-N 3.02Å; T51-E54 VanDerWaalsContact OG1-N 3.12Å; T51-E54 PolarHBondContact OG1-OE2 2.73Å; E54-A58 WeakPolarHBondContact O-CB 3.45Å; E54-A58 PolarHBondContact O-N 3.34Å; E54-F59 WeakPolarHBondContact O-CD2 3.4Å; E54-F59 PolarHBondContact O-N 3.21Å; E54-F59 VanDerWaalsContact O-N 3.08Å
55	K	85.1	Confident	87.4	Confident	58 Å²	58	65 Å²	65	25%	0.252	34%	0.341	S	S	.	.	I	π-helix	trans	-63.5	-58.4	178.3	172.9	170.3	155.5	164.7	0	111.5	R42 T51 E53 E60	R42-K55 HydrophobicContact CG-CD 4.3Å; T51-K55 PolarHBondContact O-N 3.39Å; T51-K55 VanDerWaalsContact O-N 3.16Å; E53-K55 VanDerWaalsContact C-N 3.29Å; E53-K55 PolarHBondContact O-N 2.98Å; K55-E60 WeakPolarHBondContact CE-OE1 3.24Å; K55-E60 HydrophobicContact CG-CG 4.49Å; K55-E60 WeakPolarHBondContact O-CB 3.01Å; K55-E60 WeakPolarHBondContact O-CG 3.4Å; K55-E60 PolarHBondContact O-N 2.81Å
56	K	85.1	Confident	87.8	Confident	118 Å²	118	67.1 Å²	67.1	51%	0.513	35%	0.349	S	S	.	.	I	π-helix	trans	-81.4	-39.5	-169.4	-69.2	-170.1	175	-175.8	0	114.1	V52 E53	V52-K56 HydrophobicContact CG1-CD 3.98Å; V52-K56 HydrophobicContact CG1-CG 4.36Å; V52-K56 WeakPolarHBondContact O-CB 3.1Å; V52-K56 PolarHBondContact O-N 2.86Å; E53-K56 PolarHBondContact O-N 2.81Å
57	K	85.4	Confident	88.2	Confident	140 Å²	140	68.4 Å²	68.4	61%	0.609	35%	0.346	S	S	*	.	I	π-helix	trans	-94.6	-20.6	-172.2	-63.1	-177.3	178	173.1	0	113.2	E53 K61	E53-K57 HydrophobicContact CG-CD 4.38Å; E53-K57 WeakPolarHBondContact O-CA 3.42Å; E53-K57 VanDerWaalsContact O-CB 3.29Å; E53-K57 WeakPolarHBondContact O-CB 3.47Å; E53-K57 PolarHBondContact O-N 3.01Å; K57-K61 WeakPolarHBondContact O-CD 3.49Å
58	A	88.1	Confident	88.9	Confident	33 Å²	33	71.3 Å²	71.3	27%	0.273	35%	0.352	S	S	.	.	I	π-helix	trans	-106.6	-78	176.2	0	0	0	0	0	111.4	E53 E54 E60 K61 I62	E53-A58 PolarHBondContact O-N 3.37Å; E54-A58 WeakPolarHBondContact O-CB 3.45Å; E54-A58 PolarHBondContact O-N 3.34Å; A58-E60 VanDerWaalsContact C-N 3.35Å; A58-E60 PolarHBondContact O-N 2.84Å; A58-K61 PolarHBondContact O-N 3.48Å; A58-K61 VanDerWaalsContact O-N 3.15Å; A58-I62 WeakPolarHBondContact O-CG1 3.26Å; A58-I62 PolarHBondContact O-N 3.12Å
59	F	91.2	Very high	89.6	Confident	16 Å²	16	71.4 Å²	71.4	7%	0.07	36%	0.361	C	S	.	.	I	π-helix	trans	-62.4	-41.4	-171.3	-73.3	-76.6	0	0	0	113.1	V5 L9 V29 V33 L41 L45 E54 K61 I62 Q63	V5-F59 HydrophobicContact CB-CE2 4.47Å; V5-F59 HydrophobicContact CG1-CE2 3.87Å; V5-F59 HydrophobicContact CG1-CZ 3.99Å; L9-F59 HydrophobicContact CD1-CE1 4.34Å; L9-F59 HydrophobicContact CD1-CZ 3.9Å; V29-F59 HydrophobicContact CG1-CD1 3.9Å; V29-F59 HydrophobicContact CG1-CE1 3.61Å; V29-F59 HydrophobicContact CG1-CZ 4.39Å; V33-F59 HydrophobicContact CG2-CD1 4.15Å; L41-F59 HydrophobicContact CD1-CB 4.4Å; L41-F59 HydrophobicContact CD2-CB 4.24Å; L45-F59 HydrophobicContact CD1-CB 3.69Å; L45-F59 HydrophobicContact CD1-CD2 3.97Å; L45-F59 HydrophobicContact CD1-CG 3.85Å; L45-F59 HydrophobicContact CD2-CD1 4.14Å; L45-F59 HydrophobicContact CD2-CD2 3.63Å; L45-F59 HydrophobicContact CD2-CE1 4.19Å; L45-F59 HydrophobicContact CD2-CE2 3.7Å; L45-F59 HydrophobicContact CD2-CG 3.87Å; L45-F59 HydrophobicContact CD2-CZ 3.99Å; L45-F59 HydrophobicContact CG-CD2 4.48Å; L45-F59 HydrophobicContact CG-CG 4.48Å; E54-F59 WeakPolarHBondContact O-CD2 3.4Å; E54-F59 PolarHBondContact O-N 3.21Å; E54-F59 VanDerWaalsContact O-N 3.08Å; F59-K61 VanDerWaalsContact C-N 3.33Å; F59-K61 PolarHBondContact O-N 3.43Å; F59-I62 PolarHBondContact O-N 3.37Å; F59-Q63 PolarHBondContact O-N 2.93Å
60	E	93.3	Very high	90.2	Very high	13 Å²	13	65.9 Å²	65.9	6%	0.061	34%	0.342	C	S	.	.	H	α-helix	trans	-65.4	-37.7	179.3	-81.5	-175.7	-166.4	0	0	111.9	R38 R42 K55 A58 Q63 D64	R38-E60 VanDerWaalsContact CZ-O 3.29Å; R38-E60 IonicContact NE-OE2 2.7Å; R38-E60 VanDerWaalsContact NH1-C 3.25Å; R38-E60 PolarHBondContact NH1-O 3.46Å; R38-E60 PolarHBondContact NH2-O 3.18Å; R42-E60 IonicContact CZ-OE1 3.78Å; R42-E60 IonicContact NE-OE1 2.89Å; R42-E60 PolarHBondContact NE-OE1 3.28Å; R42-E60 IonicContact NH2-OE1 3.22Å; R42-E60 PolarHBondContact NH2-OE1 2.86Å; R42-E60 IonicContact NH2-OE2 3.21Å; R42-E60 PolarHBondContact NH2-OE2 3.42Å; K55-E60 WeakPolarHBondContact CE-OE1 3.24Å; K55-E60 HydrophobicContact CG-CG 4.49Å; K55-E60 WeakPolarHBondContact O-CB 3.01Å; K55-E60 WeakPolarHBondContact O-CG 3.4Å; K55-E60 PolarHBondContact O-N 2.81Å; A58-E60 VanDerWaalsContact C-N 3.35Å; A58-E60 PolarHBondContact O-N 2.84Å; E60-Q63 PolarHBondContact O-N 3.45Å; E60-D64 VanDerWaalsContact O-CG 3.24Å; E60-D64 PolarHBondContact O-N 2.84Å; E60-D64 VanDerWaalsContact O-OD2 3.09Å
61	K	94.3	Very high	90.7	Very high	127 Å²	127	70.9 Å²	70.9	55%	0.552	37%	0.367	S	S	*	.	H	α-helix	trans	-68.3	-39.1	175.1	-74.2	-160.7	176.8	-171.6	0	113.3	K57 A58 F59 Q63 D64 C65	K57-K61 WeakPolarHBondContact O-CD 3.49Å; A58-K61 PolarHBondContact O-N 3.48Å; A58-K61 VanDerWaalsContact O-N 3.15Å; F59-K61 VanDerWaalsContact C-N 3.33Å; F59-K61 PolarHBondContact O-N 3.43Å; K61-Q63 VanDerWaalsContact C-N 3.28Å; K61-Q63 PolarHBondContact O-N 3.43Å; K61-D64 WeakPolarHBondContact O-CB 3.2Å; K61-D64 PolarHBondContact O-N 3.14Å; K61-D64 VanDerWaalsContact O-N 3.14Å; K61-C65 PolarHBondContact O-N 3.29Å; K61-C65 PolarHBondContact O-SG 2.93Å; K61-C65 VanDerWaalsContact O-SG 3.39Å
62	I	93.6	Very high	91	Very high	82 Å²	82	76.3 Å²	76.3	42%	0.421	39%	0.387	S	S	.	.	H	α-helix	trans	-61.9	-42.3	176.4	-62.4	165.6	0	0	0	109.6	V33 A58 F59 D64 C65 Y66	V33-I62 HydrophobicContact CG1-CB 4.25Å; V33-I62 HydrophobicContact CG1-CG2 3.56Å; A58-I62 WeakPolarHBondContact O-CG1 3.26Å; A58-I62 PolarHBondContact O-N 3.12Å; F59-I62 PolarHBondContact O-N 3.37Å; I62-D64 VanDerWaalsContact C-N 3.32Å; I62-D64 PolarHBondContact O-N 2.93Å; I62-C65 WeakPolarHBondContact O-CB 3.35Å; I62-C65 PolarHBondContact O-N 2.86Å; I62-Y66 HydrophobicContact CG2-CD2 4.14Å; I62-Y66 HydrophobicContact CG2-CE2 3.93Å; I62-Y66 WeakPolarHBondContact O-CD2 3.21Å; I62-Y66 PolarHBondContact O-N 3.43Å; I62-Y66 VanDerWaalsContact O-N 3.17Å
63	Q	95.2	Very high	91.2	Very high	1 Å²	1	74.9 Å²	74.9	1%	0.005	38%	0.378	C	S	.	.	H	α-helix	trans	-61.5	-39	174.5	174.5	172.8	75	0	0	112	G32 V33 R38 L41 F59 E60 K61 C65 Y66 E67	G32-Q63 PolarHBondContact O-NE2 2.72Å; V33-Q63 HydrophobicContact CG1-CB 4.4Å; V33-Q63 WeakPolarHBondContact O-CG 3.24Å; R38-Q63 VanDerWaalsContact CD-OE1 3.25Å; L41-Q63 HydrophobicContact CD2-CB 3.92Å; L41-Q63 HydrophobicContact CD2-CG 4.4Å; F59-Q63 PolarHBondContact O-N 2.93Å; E60-Q63 PolarHBondContact O-N 3.45Å; K61-Q63 VanDerWaalsContact C-N 3.28Å; K61-Q63 PolarHBondContact O-N 3.43Å; Q63-C65 VanDerWaalsContact C-N 3.32Å; Q63-C65 PolarHBondContact O-N 3.18Å; Q63-Y66 PolarHBondContact O-N 2.97Å; Q63-E67 PolarHBondContact O-N 2.93Å
64	D	95.6	Very high	91.6	Very high	63 Å²	63	71 Å²	71	34%	0.337	36%	0.36	S	S	.	.	H	α-helix	trans	-61.6	-40.8	174.6	-61.9	-34	0	0	0	111.3	R38 E60 K61 I62 Y66 E67 E68	R38-D64 IonicContact CZ-OD1 3.99Å; R38-D64 IonicContact CZ-OD2 2.69Å; R38-D64 IonicContact NH1-OD1 3.98Å; R38-D64 IonicContact NH2-OD1 3.79Å; R38-D64 PolarHBondContact NH2-OD1 3.33Å; R38-D64 IonicContact NH2-OD2 3.39Å; R38-D64 PolarHBondContact NH2-OD2 3.42Å; E60-D64 VanDerWaalsContact O-CG 3.24Å; E60-D64 PolarHBondContact O-N 2.84Å; E60-D64 VanDerWaalsContact O-OD2 3.09Å; K61-D64 WeakPolarHBondContact O-CB 3.2Å; K61-D64 PolarHBondContact O-N 3.14Å; K61-D64 VanDerWaalsContact O-N 3.14Å; I62-D64 VanDerWaalsContact C-N 3.32Å; I62-D64 PolarHBondContact O-N 2.93Å; D64-Y66 VanDerWaalsContact C-N 3.3Å; D64-Y66 PolarHBondContact O-N 3.44Å; D64-E67 WeakPolarHBondContact O-CB 3.36Å; D64-E67 PolarHBondContact O-N 3.03Å; D64-E67 VanDerWaalsContact O-N 3.11Å; D64-E68 WeakPolarHBondContact O-CG 3.37Å; D64-E68 PolarHBondContact O-N 3.16Å
65	C	95.2	Very high	92	Very high	77 Å²	77	72.6 Å²	72.6	52%	0.52	37%	0.371	S	S	.	.	H	α-helix	trans	-60.4	-37.9	175	-64.1	0	0	0	0	112.8	K61 I62 Q63 A69	K61-C65 PolarHBondContact O-N 3.29Å; K61-C65 PolarHBondContact O-SG 2.93Å; K61-C65 VanDerWaalsContact O-SG 3.39Å; I62-C65 WeakPolarHBondContact O-CB 3.35Å; I62-C65 PolarHBondContact O-N 2.86Å; Q63-C65 VanDerWaalsContact C-N 3.32Å; Q63-C65 PolarHBondContact O-N 3.18Å; C65-A69 VanDerWaalsContact O-CB 3.24Å; C65-A69 WeakPolarHBondContact O-CB 3.49Å; C65-A69 PolarHBondContact O-N 2.92Å
66	Y	94.7	Very high	92.4	Very high	44 Å²	44	75.1 Å²	75.1	17%	0.173	38%	0.384	C	S	.	.	H	α-helix	trans	-68.8	-37.4	174.3	-82.7	-79.6	0	0	0	112.1	V33 V34 I62 Q63 D64 G70 K74 D77	V33-Y66 HydrophobicContact CG1-CD2 3.63Å; V33-Y66 HydrophobicContact CG1-CE2 3.72Å; V34-Y66 HydrophobicContact CG1-CD1 4.2Å; V34-Y66 HydrophobicContact CG1-CE1 4.32Å; V34-Y66 HydrophobicContact CG2-CD1 4.31Å; V34-Y66 HydrophobicContact CG2-CE1 3.92Å; V34-Y66 HydrophobicContact CG2-CE2 4.19Å; I62-Y66 HydrophobicContact CG2-CD2 4.14Å; I62-Y66 HydrophobicContact CG2-CE2 3.93Å; I62-Y66 WeakPolarHBondContact O-CD2 3.21Å; I62-Y66 PolarHBondContact O-N 3.43Å; I62-Y66 VanDerWaalsContact O-N 3.17Å; Q63-Y66 PolarHBondContact O-N 2.97Å; D64-Y66 VanDerWaalsContact C-N 3.3Å; D64-Y66 PolarHBondContact O-N 3.44Å; Y66-G70 PolarHBondContact O-N 3.03Å; Y66-K74 VanDerWaalsContact C-CE 3.46Å; Y66-K74 HydrophobicContact CD1-CG 3.97Å; Y66-K74 WeakPolarHBondContact O-CE 3.48Å; Y66-D77 HydrophobicContact CE1-CB 3.93Å; Y66-D77 PolarHBondContact OH-OD1 3.25Å; Y66-D77 PolarHBondContact OH-OD2 3.02Å
67	E	94.6	Very high	92.8	Very high	86 Å²	86	71.5 Å²	71.5	40%	0.402	37%	0.371	S	S	.	.	H	α-helix	trans	-61.4	-48.9	173.3	-75.1	-47	126.2	0	0	112	G36 Q63 D64 A69 G70 K74	G36-E67 WeakPolarHBondContact CA-OE1 3.36Å; Q63-E67 PolarHBondContact O-N 2.93Å; D64-E67 WeakPolarHBondContact O-CB 3.36Å; D64-E67 PolarHBondContact O-N 3.03Å; D64-E67 VanDerWaalsContact O-N 3.11Å; E67-A69 VanDerWaalsContact C-N 3.33Å; E67-A69 PolarHBondContact O-N 2.86Å; E67-G70 PolarHBondContact O-N 3.39Å; E67-K74 WeakPolarHBondContact OE1-CE 3.47Å; E67-K74 IonicContact OE1-NZ 2.55Å; E67-K74 PolarHBondContact OE1-NZ 3.33Å; E67-K74 IonicContact OE2-NZ 2.95Å; E67-K74 PolarHBondContact OE2-NZ 2.89Å
68	E	95.6	Very high	93.1	Very high	163 Å²	163	68 Å²	68	76%	0.762	36%	0.357	S	S	*	.	H	α-helix	trans	-62.1	-39.2	178.7	-70.4	173.1	-175.2	0	0	112.2	D64 G70	D64-E68 WeakPolarHBondContact O-CG 3.37Å; D64-E68 PolarHBondContact O-N 3.16Å; E68-G70 VanDerWaalsContact C-N 3.28Å; E68-G70 PolarHBondContact O-N 3.36Å
69	A	93.6	Very high	93.2	Very high	48 Å²	48	73.4 Å²	73.4	40%	0.397	37%	0.374	S	S	.	.	H	α-helix	trans	-74.7	-15.3	-179.9	0	0	0	0	0	114.1	C65 E67 T73	C65-A69 VanDerWaalsContact O-CB 3.24Å; C65-A69 WeakPolarHBondContact O-CB 3.49Å; C65-A69 PolarHBondContact O-N 2.92Å; E67-A69 VanDerWaalsContact C-N 3.33Å; E67-A69 PolarHBondContact O-N 2.86Å; A69-T73 HydrophobicContact CB-CG2 3.82Å; A69-T73 PolarHBondContact O-OG1 2.93Å
70	G	92.9	Very high	93.3	Very high	25 Å²	25	79 Å²	79	26%	0.258	40%	0.399	S	S	.	.	H	α-helix	trans	76.1	178.1	172.7	0	0	0	0	0	116.4	Y66 E67 E68 K72 T73 K74	Y66-G70 PolarHBondContact O-N 3.03Å; E67-G70 PolarHBondContact O-N 3.39Å; E68-G70 VanDerWaalsContact C-N 3.28Å; E68-G70 PolarHBondContact O-N 3.36Å; G70-K72 VanDerWaalsContact C-N 3.35Å; G70-K72 PolarHBondContact O-N 3.08Å; G70-T73 PolarHBondContact O-N 3.39Å; G70-K74 PolarHBondContact O-N 3.46Å
71	L	91.6	Very high	93.1	Very high	136 Å²	136	79.9 Å²	79.9	71%	0.712	40%	0.403	S	S	*	.	H	α-helix	trans	-62.2	-35.5	-167.8	-176.1	62.7	0	0	0	114.2	K74 T75	L71-K74 PolarHBondContact O-N 3.1Å; L71-T75 WeakPolarHBondContact O-CB 3.45Å; L71-T75 PolarHBondContact O-N 3.45Å; L71-T75 PolarHBondContact O-OG1 3.4Å
72	K	91.6	Very high	92.8	Very high	154 Å²	154	74.9 Å²	74.9	67%	0.67	39%	0.386	S	S	*	.	H	α-helix	trans	-61.1	-47.4	179.8	-176	-179.7	177.6	-176.6	0	110.7	G70 T75 Q76	G70-K72 VanDerWaalsContact C-N 3.35Å; G70-K72 PolarHBondContact O-N 3.08Å; K72-T75 PolarHBondContact O-N 2.76Å; K72-Q76 WeakPolarHBondContact O-CG 3.38Å; K72-Q76 PolarHBondContact O-N 3.19Å
73	T	91.4	Very high	92.6	Very high	58 Å²	58	74 Å²	74	36%	0.356	39%	0.391	S	S	.	.	H	α-helix	trans	-63.6	-48.3	179.6	-51.9	0	0	0	0	110.8	A69 G70 T75 Q76 D77	A69-T73 HydrophobicContact CB-CG2 3.82Å; A69-T73 PolarHBondContact O-OG1 2.93Å; G70-T73 PolarHBondContact O-N 3.39Å; T73-T75 VanDerWaalsContact C-N 3.3Å; T73-T75 PolarHBondContact O-N 2.78Å; T73-Q76 PolarHBondContact O-N 2.87Å; T73-D77 WeakPolarHBondContact O-CB 3.23Å; T73-D77 PolarHBondContact O-N 3.28Å
74	K	92.8	Very high	92.2	Very high	24 Å²	24	77.3 Å²	77.3	10%	0.104	41%	0.408	C	S	.	.	H	α-helix	trans	-54	-46.5	175.2	-66	175	-172.5	-178.3	0	112.1	V34 Y66 E67 G70 L71 D77 M78	V34-K74 HydrophobicContact CG1-CB 3.71Å; V34-K74 HydrophobicContact CG1-CG 3.95Å; V34-K74 WeakPolarHBondContact O-CD 3.12Å; Y66-K74 VanDerWaalsContact C-CE 3.46Å; Y66-K74 HydrophobicContact CD1-CG 3.97Å; Y66-K74 WeakPolarHBondContact O-CE 3.48Å; E67-K74 WeakPolarHBondContact OE1-CE 3.47Å; E67-K74 IonicContact OE1-NZ 2.55Å; E67-K74 PolarHBondContact OE1-NZ 3.33Å; E67-K74 IonicContact OE2-NZ 2.95Å; E67-K74 PolarHBondContact OE2-NZ 2.89Å; G70-K74 PolarHBondContact O-N 3.46Å; L71-K74 PolarHBondContact O-N 3.1Å; K74-D77 PolarHBondContact O-N 2.87Å; K74-M78 WeakPolarHBondContact O-CG 3.35Å; K74-M78 PolarHBondContact O-N 2.78Å
75	T	91.1	Very high	91.6	Very high	58 Å²	58	74.7 Å²	74.7	36%	0.356	39%	0.394	S	S	.	.	H	α-helix	trans	-67	-40	-179	-54.3	0	0	0	0	112	L71 K72 T73 K79	L71-T75 WeakPolarHBondContact O-CB 3.45Å; L71-T75 PolarHBondContact O-N 3.45Å; L71-T75 PolarHBondContact O-OG1 3.4Å; K72-T75 PolarHBondContact O-N 2.76Å; T73-T75 VanDerWaalsContact C-N 3.3Å; T73-T75 PolarHBondContact O-N 2.78Å; T75-K79 WeakPolarHBondContact O-CG 3.46Å; T75-K79 PolarHBondContact O-N 3.48Å; T75-K79 VanDerWaalsContact O-N 3.11Å
76	Q	94.1	Very high	91.1	Very high	112 Å²	112	73.6 Å²	73.6	52%	0.523	38%	0.38	S	S	.	.	H	α-helix	trans	-66.1	-42.7	176.7	-75.6	178.5	-38.4	0	0	111.5	K72 T73 K79 F80	K72-Q76 WeakPolarHBondContact O-CG 3.38Å; K72-Q76 PolarHBondContact O-N 3.19Å; T73-Q76 PolarHBondContact O-N 2.87Å; Q76-K79 WeakPolarHBondContact O-CB 3.41Å; Q76-K79 PolarHBondContact O-N 3.15Å; Q76-F80 PolarHBondContact O-N 2.61Å
77	D	93.3	Very high	90.8	Very high	42 Å²	42	72.7 Å²	72.7	23%	0.225	38%	0.381	C	S	.	.	H	α-helix	trans	-63.1	-43.6	177.4	-169.1	78	0	0	0	111.7	Y30 Y66 T73 K74 K79 F80 M81	Y30-D77 WeakPolarHBondContact CE2-OD2 3.15Å; Y30-D77 PolarHBondContact OH-O 2.85Å; Y30-D77 PolarHBondContact OH-OD2 3.23Å; Y66-D77 HydrophobicContact CE1-CB 3.93Å; Y66-D77 PolarHBondContact OH-OD1 3.25Å; Y66-D77 PolarHBondContact OH-OD2 3.02Å; T73-D77 WeakPolarHBondContact O-CB 3.23Å; T73-D77 PolarHBondContact O-N 3.28Å; K74-D77 PolarHBondContact O-N 2.87Å; D77-K79 VanDerWaalsContact C-N 3.31Å; D77-K79 PolarHBondContact O-N 3.01Å; D77-F80 WeakPolarHBondContact O-CB 3.18Å; D77-F80 PolarHBondContact O-N 3.3Å; D77-F80 VanDerWaalsContact O-N 3.14Å; D77-M81 WeakPolarHBondContact O-CB 3.36Å; D77-M81 PolarHBondContact O-N 3.37Å
78	M	90.8	Very high	90.3	Very high	66 Å²	66	73.5 Å²	73.5	33%	0.325	39%	0.393	S	S	.	.	H	α-helix	trans	-59.3	-40.6	173.3	-73.7	-175.1	-174.4	0	0	112.6	Y30 V34 K74 A82	Y30-M78 WeakPolarHBondContact OH-CA 3.42Å; Y30-M78 PolarHBondContact OH-N 3.24Å; V34-M78 HydrophobicContact CB-CE 4.07Å; V34-M78 HydrophobicContact CG1-CE 3.5Å; V34-M78 VanDerWaalsContact CG1-CE 3.5Å; V34-M78 HydrophobicContact CG1-CG 4.1Å; K74-M78 WeakPolarHBondContact O-CG 3.35Å; K74-M78 PolarHBondContact O-N 2.78Å; M78-A82 WeakPolarHBondContact O-CB 3.44Å; M78-A82 PolarHBondContact O-N 3.21Å
79	K	91.2	Very high	89.7	Confident	146 Å²	146	71.5 Å²	71.5	64%	0.635	38%	0.384	S	S	*	.	H	α-helix	trans	-64.4	-41.7	175.6	-74.9	176.5	-179.7	-176.7	0	111.6	T75 Q76 D77 A82 A83	T75-K79 WeakPolarHBondContact O-CG 3.46Å; T75-K79 PolarHBondContact O-N 3.48Å; T75-K79 VanDerWaalsContact O-N 3.11Å; Q76-K79 WeakPolarHBondContact O-CB 3.41Å; Q76-K79 PolarHBondContact O-N 3.15Å; D77-K79 VanDerWaalsContact C-N 3.31Å; D77-K79 PolarHBondContact O-N 3.01Å; K79-A82 PolarHBondContact O-N 2.97Å; K79-A83 WeakPolarHBondContact O-CB 3.39Å; K79-A83 PolarHBondContact O-N 3.3Å
80	F	92.1	Very high	89.1	Confident	134 Å²	134	70.7 Å²	70.7	59%	0.588	38%	0.375	S	S	*	.	H	α-helix	trans	-64.7	-46	178	-174.9	-107.7	0	0	0	111.3	Q76 D77 A82 A83 I84	Q76-F80 PolarHBondContact O-N 2.61Å; D77-F80 WeakPolarHBondContact O-CB 3.18Å; D77-F80 PolarHBondContact O-N 3.3Å; D77-F80 VanDerWaalsContact O-N 3.14Å; F80-A82 PolarHBondContact O-N 3.41Å; F80-A83 WeakPolarHBondContact O-CB 3.18Å; F80-A83 PolarHBondContact O-N 2.9Å; F80-I84 HydrophobicContact CD1-CD1 3.75Å; F80-I84 HydrophobicContact CE1-CD1 3.37Å; F80-I84 HydrophobicContact CE1-CG1 4.36Å; F80-I84 HydrophobicContact CZ-CD1 3.83Å; F80-I84 HydrophobicContact CZ-CG1 4.46Å; F80-I84 WeakPolarHBondContact O-CG1 3.46Å; F80-I84 PolarHBondContact O-N 2.98Å
81	M	89.8	Confident	88.5	Confident	31 Å²	31	74 Å²	74	15%	0.153	38%	0.382	C	S	.	.	H	α-helix	trans	-60	-44.7	175.1	-172.8	60.2	68.7	0	0	111.6	F26 Y30 D77 A83 I84 L85 F106	F26-M81 HydrophobicContact CE1-CE 4.35Å; F26-M81 HydrophobicContact CE1-SD 4.26Å; F26-M81 HydrophobicContact CZ-CE 4.22Å; Y30-M81 HydrophobicContact CD1-CG 4.2Å; Y30-M81 HydrophobicContact CD2-CE 3.93Å; Y30-M81 HydrophobicContact CE1-CB 3.97Å; Y30-M81 HydrophobicContact CE1-CG 3.72Å; Y30-M81 HydrophobicContact CE2-CE 3.71Å; Y30-M81 HydrophobicContact CE2-CG 4.48Å; Y30-M81 HydrophobicContact CG-CE 4.42Å; D77-M81 WeakPolarHBondContact O-CB 3.36Å; D77-M81 PolarHBondContact O-N 3.37Å; M81-A83 VanDerWaalsContact C-N 3.34Å; M81-A83 PolarHBondContact O-N 3.11Å; M81-I84 PolarHBondContact O-N 3.36Å; M81-L85 HydrophobicContact CG-CD1 3.96Å; M81-L85 HydrophobicContact CG-CG 4.42Å; M81-L85 VanDerWaalsContact O-CG 3.27Å; M81-L85 WeakPolarHBondContact O-CG 3.29Å; M81-L85 PolarHBondContact O-N 3.39Å; M81-L85 HydrophobicContact SD-CD1 4.47Å; M81-L85 HydrophobicContact SD-CG 4.41Å; M81-F106 HydrophobicContact CG-CZ 4.31Å
82	A	88.3	Confident	88.1	Confident	22 Å²	22	71.8 Å²	71.8	18%	0.182	38%	0.378	C	S	.	.	H	α-helix	trans	-60.8	-42.1	175.2	0	0	0	0	0	112.1	M78 K79 F80 I84 L85 F86 F106	M78-A82 WeakPolarHBondContact O-CB 3.44Å; M78-A82 PolarHBondContact O-N 3.21Å; K79-A82 PolarHBondContact O-N 2.97Å; F80-A82 PolarHBondContact O-N 3.41Å; A82-I84 VanDerWaalsContact C-N 3.32Å; A82-I84 PolarHBondContact O-N 2.83Å; A82-L85 PolarHBondContact O-N 3.22Å; A82-F86 HydrophobicContact CB-CD2 4.2Å; A82-F86 HydrophobicContact CB-CE2 4.31Å; A82-F86 WeakPolarHBondContact O-CB 3.46Å; A82-F86 WeakPolarHBondContact O-CD2 3.44Å; A82-F86 PolarHBondContact O-N 2.89Å; A82-F106 HydrophobicContact CB-CE1 4.08Å
83	A	89.7	Confident	87.2	Confident	65 Å²	65	72 Å²	72	54%	0.537	38%	0.376	S	S	.	.	H	α-helix	trans	-61.3	-40.1	177	0	0	0	0	0	112.2	K79 F80 M81 S87	K79-A83 WeakPolarHBondContact O-CB 3.39Å; K79-A83 PolarHBondContact O-N 3.3Å; F80-A83 WeakPolarHBondContact O-CB 3.18Å; F80-A83 PolarHBondContact O-N 2.9Å; M81-A83 VanDerWaalsContact C-N 3.34Å; M81-A83 PolarHBondContact O-N 3.11Å; A83-S87 PolarHBondContact O-N 3.2Å; A83-S87 VanDerWaalsContact O-N 3.14Å
84	I	86.6	Confident	86.6	Confident	69 Å²	69	71.3 Å²	71.3	35%	0.354	37%	0.367	S	S	.	.	H	α-helix	trans	-63.9	-53.1	174.1	-67.2	167.8	0	0	0	110.3	F80 M81 A82 F86 S87 C90	F80-I84 HydrophobicContact CD1-CD1 3.75Å; F80-I84 HydrophobicContact CE1-CD1 3.37Å; F80-I84 HydrophobicContact CE1-CG1 4.36Å; F80-I84 HydrophobicContact CZ-CD1 3.83Å; F80-I84 HydrophobicContact CZ-CG1 4.46Å; F80-I84 WeakPolarHBondContact O-CG1 3.46Å; F80-I84 PolarHBondContact O-N 2.98Å; M81-I84 PolarHBondContact O-N 3.36Å; A82-I84 VanDerWaalsContact C-N 3.32Å; A82-I84 PolarHBondContact O-N 2.83Å; I84-F86 VanDerWaalsContact C-N 3.28Å; I84-F86 PolarHBondContact O-N 2.69Å; I84-S87 WeakPolarHBondContact O-CB 3.39Å; I84-S87 PolarHBondContact O-N 3.06Å; I84-S87 PolarHBondContact O-OG 3.01Å; I84-C90 VanDerWaalsContact O-CB 3.31Å; I84-C90 WeakPolarHBondContact O-CB 3.43Å; I84-C90 PolarHBondContact O-SG 3.33Å
85	L	83.6	Confident	86	Confident	9 Å²	9	72.4 Å²	72.4	5%	0.047	38%	0.376	C	S	.	.	H	α-helix	trans	-62.8	-35.3	-175.3	-67	168.3	0	0	0	112.7	L27 M81 A82 C90 Y94 I102 F106	L27-L85 HydrophobicContact CD1-CD1 4.3Å; L27-L85 HydrophobicContact CD2-CD1 3.45Å; L27-L85 VanDerWaalsContact CD2-CD1 3.45Å; L27-L85 HydrophobicContact CD2-CD2 4.17Å; L27-L85 HydrophobicContact CD2-CG 4.41Å; M81-L85 HydrophobicContact CG-CD1 3.96Å; M81-L85 HydrophobicContact CG-CG 4.42Å; M81-L85 VanDerWaalsContact O-CG 3.27Å; M81-L85 WeakPolarHBondContact O-CG 3.29Å; M81-L85 PolarHBondContact O-N 3.39Å; M81-L85 HydrophobicContact SD-CD1 4.47Å; M81-L85 HydrophobicContact SD-CG 4.41Å; A82-L85 PolarHBondContact O-N 3.22Å; L85-C90 WeakPolarHBondContact O-CB 3.14Å; L85-Y94 WeakPolarHBondContact CD2-OH 3.38Å; L85-Y94 WeakPolarHBondContact O-CE2 3.33Å; L85-I102 HydrophobicContact CD1-CG2 4.29Å; L85-F106 HydrophobicContact CD1-CE2 3.49Å; L85-F106 VanDerWaalsContact CD1-CE2 3.49Å; L85-F106 HydrophobicContact CD1-CZ 3.65Å
86	F	84.9	Confident	85.5	Confident	53 Å²	53	78.6 Å²	78.6	23%	0.232	40%	0.398	C	S	.	.	T	Hydrogen-bonded Turn	trans	-96.2	8.7	-178.7	-62.1	-60.3	0	0	0	113.9	A82 I84 K91 I102 L103	A82-F86 HydrophobicContact CB-CD2 4.2Å; A82-F86 HydrophobicContact CB-CE2 4.31Å; A82-F86 WeakPolarHBondContact O-CB 3.46Å; A82-F86 WeakPolarHBondContact O-CD2 3.44Å; A82-F86 PolarHBondContact O-N 2.89Å; I84-F86 VanDerWaalsContact C-N 3.28Å; I84-F86 PolarHBondContact O-N 2.69Å; F86-K91 WeakPolarHBondContact O-CD 3.43Å; F86-K91 WeakPolarHBondContact O-CE 3.33Å; F86-K91 PolarHBondContact O-NZ 3.31Å; F86-I102 HydrophobicContact CE1-CG2 4.15Å; F86-I102 HydrophobicContact CZ-CG2 3.82Å; F86-L103 HydrophobicContact CE1-CD2 3.73Å; F86-L103 HydrophobicContact CE1-CG 4.05Å; F86-L103 HydrophobicContact CE2-CD2 4.35Å; F86-L103 HydrophobicContact CZ-CD2 3.45Å; F86-L103 VanDerWaalsContact CZ-CD2 3.45Å; F86-L103 HydrophobicContact CZ-CG 4.05Å
87	S	86.5	Confident	84.9	Confident	26 Å²	26	79.9 Å²	79.9	18%	0.182	40%	0.404	C	S	.	.	S	Bend	trans	-63.5	152.7	171.3	93.7	0	0	0	0	110.8	A83 I84 E89 C90 K91	A83-S87 PolarHBondContact O-N 3.2Å; A83-S87 VanDerWaalsContact O-N 3.14Å; I84-S87 WeakPolarHBondContact O-CB 3.39Å; I84-S87 PolarHBondContact O-N 3.06Å; I84-S87 PolarHBondContact O-OG 3.01Å; S87-E89 WeakPolarHBondContact CB-OE2 3.35Å; S87-E89 PolarHBondContact O-N 3.45Å; S87-E89 PolarHBondContact OG-N 2.73Å; S87-E89 PolarHBondContact OG-OE2 3.32Å; S87-C90 PolarHBondContact O-N 3.06Å; S87-C90 PolarHBondContact OG-N 3.29Å; S87-K91 WeakPolarHBondContact O-CB 3.4Å; S87-K91 WeakPolarHBondContact O-CG 3.45Å; S87-K91 PolarHBondContact O-N 3.28Å
88	P	85.3	Confident	84.2	Confident	102 Å²	102	78.3 Å²	78.3	66%	0.662	40%	0.396	S	S	*	.	H	α-helix	trans	-54.9	-37.8	176.6	-25.1	34.9	0	0	0	112.8	S92	P88-S92 PolarHBondContact O-N 3.46Å; P88-S92 VanDerWaalsContact O-N 3.16Å
89	E	83	Confident	83.7	Confident	122 Å²	122	77.5 Å²	77.5	57%	0.57	39%	0.392	S	S	*	.	H	α-helix	trans	-64.5	-52.1	179.9	-53.6	77.9	-170.5	0	0	110.8	S87 S92 Y93	S87-E89 WeakPolarHBondContact CB-OE2 3.35Å; S87-E89 PolarHBondContact O-N 3.45Å; S87-E89 PolarHBondContact OG-N 2.73Å; S87-E89 PolarHBondContact OG-OE2 3.32Å; E89-S92 WeakPolarHBondContact O-CB 3.13Å; E89-S92 PolarHBondContact O-N 3.14Å; E89-S92 PolarHBondContact O-OG 3.45Å; E89-Y93 WeakPolarHBondContact O-CD2 3.4Å; E89-Y93 WeakPolarHBondContact O-CE2 2.81Å
90	C	80.1	Confident	83.4	Confident	31 Å²	31	75.6 Å²	75.6	21%	0.209	39%	0.388	C	S	.	.	H	α-helix	trans	-66.6	-39.5	179.2	-76.4	0	0	0	0	112.4	I84 L85 S87 S92 Y93 Y94	I84-C90 VanDerWaalsContact O-CB 3.31Å; I84-C90 WeakPolarHBondContact O-CB 3.43Å; I84-C90 PolarHBondContact O-SG 3.33Å; L85-C90 WeakPolarHBondContact O-CB 3.14Å; S87-C90 PolarHBondContact O-N 3.06Å; S87-C90 PolarHBondContact OG-N 3.29Å; C90-S92 PolarHBondContact O-N 3.05Å; C90-Y93 PolarHBondContact O-N 3.44Å; C90-Y94 HydrophobicContact CB-CE2 4.11Å; C90-Y94 WeakPolarHBondContact O-CD2 3.36Å; C90-Y94 WeakPolarHBondContact O-CE2 3.37Å
91	K	81.5	Confident	82.8	Confident	94 Å²	94	72.1 Å²	72.1	41%	0.409	38%	0.376	S	S	.	.	H	α-helix	trans	-59.1	-32	176.8	-79.1	174.4	171.4	154.7	0	112.8	F86 S87 Y93 Y94 L99	F86-K91 WeakPolarHBondContact O-CD 3.43Å; F86-K91 WeakPolarHBondContact O-CE 3.33Å; F86-K91 PolarHBondContact O-NZ 3.31Å; S87-K91 WeakPolarHBondContact O-CB 3.4Å; S87-K91 WeakPolarHBondContact O-CG 3.45Å; S87-K91 PolarHBondContact O-N 3.28Å; K91-Y93 PolarHBondContact O-N 3.4Å; K91-Y94 PolarHBondContact O-N 3.06Å; K91-Y94 VanDerWaalsContact O-N 3.14Å; K91-L99 HydrophobicContact CD-CD1 4.44Å; K91-L99 HydrophobicContact CG-CD1 4.01Å
92	S	81.8	Confident	82.4	Confident	90 Å²	90	70.7 Å²	70.7	63%	0.629	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.9	-21.4	177.4	78	0	0	0	0	113.3	P88 E89 C90	P88-S92 PolarHBondContact O-N 3.46Å; P88-S92 VanDerWaalsContact O-N 3.16Å; E89-S92 WeakPolarHBondContact O-CB 3.13Å; E89-S92 PolarHBondContact O-N 3.14Å; E89-S92 PolarHBondContact O-OG 3.45Å; C90-S92 PolarHBondContact O-N 3.05Å
93	Y	74.5	Confident	82	Confident	157 Å²	157	73.2 Å²	73.2	62%	0.616	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.5	-6.1	178.6	-63.5	-79.5	0	0	0	114.2	E89 C90 K91	E89-Y93 WeakPolarHBondContact O-CD2 3.4Å; E89-Y93 WeakPolarHBondContact O-CE2 2.81Å; C90-Y93 PolarHBondContact O-N 3.44Å; K91-Y93 PolarHBondContact O-N 3.4Å
94	Y	77.1	Confident	81.7	Confident	45 Å²	45	73.4 Å²	73.4	18%	0.176	37%	0.371	C	S	.	.			trans	-103.5	141.7	-175.2	-57.1	-34.7	0	0	0	112.6	L85 C90 K91 V98 I102	L85-Y94 WeakPolarHBondContact CD2-OH 3.38Å; L85-Y94 WeakPolarHBondContact O-CE2 3.33Å; C90-Y94 HydrophobicContact CB-CE2 4.11Å; C90-Y94 WeakPolarHBondContact O-CD2 3.36Å; C90-Y94 WeakPolarHBondContact O-CE2 3.37Å; K91-Y94 PolarHBondContact O-N 3.06Å; K91-Y94 VanDerWaalsContact O-N 3.14Å; Y94-V98 HydrophobicContact CD1-CG1 3.75Å; Y94-V98 HydrophobicContact CE1-CG1 4.43Å; Y94-V98 HydrophobicContact CG-CG1 3.99Å; Y94-I102 HydrophobicContact CD1-CD1 4.49Å; Y94-I102 HydrophobicContact CD2-CD1 3.94Å; Y94-I102 HydrophobicContact CE1-CD1 4.3Å; Y94-I102 HydrophobicContact CE2-CD1 3.73Å; Y94-I102 HydrophobicContact CG-CD1 4.34Å
95	T	80.2	Confident	81.2	Confident	46 Å²	46	73 Å²	73	28%	0.282	37%	0.367	S	S	.	.			trans	-74.1	160.2	160.6	60.2	0	0	0	0	109.6	K20 E97 V98 L99	K20-T95 HydrophobicContact CD-CG2 4.09Å; K20-T95 VanDerWaalsContact CE-CG2 3.45Å; T95-E97 PolarHBondContact O-N 3.19Å; T95-V98 PolarHBondContact O-N 3.02Å; T95-V98 VanDerWaalsContact O-N 3.16Å; T95-V98 WeakPolarHBondContact OG1-CG2 3.41Å; T95-V98 PolarHBondContact OG1-N 3.45Å; T95-L99 PolarHBondContact O-N 3.36Å
96	K	80.8	Confident	80.7	Confident	188 Å²	188	75.4 Å²	75.4	82%	0.817	38%	0.377	S	S	*	.	H	α-helix	trans	-52.7	-38.5	173.1	-66.8	-177.6	179.8	178.8	0	112.1	L99 I100	K96-L99 PolarHBondContact O-N 3.02Å; K96-I100 WeakPolarHBondContact O-CG1 3.46Å; K96-I100 PolarHBondContact O-N 3.39Å
97	E	81.4	Confident	79.9	Confident	139 Å²	139	77 Å²	77	65%	0.65	40%	0.395	S	S	*	.	H	α-helix	trans	-64.6	-47.1	177.8	-175.4	-179.3	-174.4	0	0	112.9	T95 L99 I100 N101	T95-E97 PolarHBondContact O-N 3.19Å; E97-L99 VanDerWaalsContact C-N 3.26Å; E97-L99 PolarHBondContact O-N 3.17Å; E97-I100 PolarHBondContact O-N 3.35Å; E97-N101 PolarHBondContact O-N 3.47Å; E97-N101 PolarHBondContact O-ND2 3.32Å
98	V	78.8	Confident	78.5	Confident	9 Å²	9	82.6 Å²	82.6	6%	0.055	42%	0.416	C	S	.	.	H	α-helix	trans	-59.9	-42.2	176	169.7	0	0	0	0	110.1	K20 Y94 T95 I100 N101 I102	K20-V98 HydrophobicContact CB-CG2 4.2Å; K20-V98 HydrophobicContact CG-CG2 4.24Å; Y94-V98 HydrophobicContact CD1-CG1 3.75Å; Y94-V98 HydrophobicContact CE1-CG1 4.43Å; Y94-V98 HydrophobicContact CG-CG1 3.99Å; T95-V98 PolarHBondContact O-N 3.02Å; T95-V98 VanDerWaalsContact O-N 3.16Å; T95-V98 WeakPolarHBondContact OG1-CG2 3.41Å; T95-V98 PolarHBondContact OG1-N 3.45Å; V98-I100 PolarHBondContact O-N 3.2Å; V98-N101 PolarHBondContact O-N 2.78Å; V98-I102 HydrophobicContact CG1-CD1 3.81Å; V98-I102 HydrophobicContact CG1-CG1 4.29Å; V98-I102 VanDerWaalsContact O-CG1 3.25Å; V98-I102 WeakPolarHBondContact O-CG1 3.35Å; V98-I102 PolarHBondContact O-N 3.24Å
99	L	80.6	Confident	76.4	Confident	49 Å²	49	90.9 Å²	90.9	26%	0.257	44%	0.441	S	S	.	.	H	α-helix	trans	-63	-40	178.8	-169	139.8	0	0	0	112.7	K91 T95 K96 E97 I102 L103	K91-L99 HydrophobicContact CD-CD1 4.44Å; K91-L99 HydrophobicContact CG-CD1 4.01Å; T95-L99 PolarHBondContact O-N 3.36Å; K96-L99 PolarHBondContact O-N 3.02Å; E97-L99 VanDerWaalsContact C-N 3.26Å; E97-L99 PolarHBondContact O-N 3.17Å; L99-I102 PolarHBondContact O-N 3.34Å; L99-L103 HydrophobicContact CD2-CD1 3.7Å; L99-L103 HydrophobicContact CD2-CG 4.48Å; L99-L103 WeakPolarHBondContact O-CG 3.41Å; L99-L103 PolarHBondContact O-N 2.97Å
100	I	84	Confident	76.1	Confident	107 Å²	107	89.3 Å²	89.3	55%	0.549	44%	0.435	S	S	.	.	H	α-helix	trans	-62.6	-44.6	173.9	-69.7	165	0	0	0	110.7	K96 E97 V98 I102 L103 D104	K96-I100 WeakPolarHBondContact O-CG1 3.46Å; K96-I100 PolarHBondContact O-N 3.39Å; E97-I100 PolarHBondContact O-N 3.35Å; V98-I100 PolarHBondContact O-N 3.2Å; I100-I102 PolarHBondContact O-N 3.2Å; I100-L103 WeakPolarHBondContact O-CB 3.37Å; I100-L103 PolarHBondContact O-N 2.81Å; I100-D104 PolarHBondContact O-N 2.7Å
101	N	81.3	Confident	75.9	Confident	61 Å²	61	92.4 Å²	92.4	33%	0.326	45%	0.447	S	S	.	.	H	α-helix	trans	-66.3	-37	179.9	-71.4	-28.3	0	0	0	112.5	L24 E97 V98 D104 K105	L24-N101 HydrophobicContact CD1-CB 3.91Å; L24-N101 HydrophobicContact CD2-CB 3.66Å; L24-N101 HydrophobicContact CG-CB 4.44Å; E97-N101 PolarHBondContact O-N 3.47Å; E97-N101 PolarHBondContact O-ND2 3.32Å; V98-N101 PolarHBondContact O-N 2.78Å; N101-D104 PolarHBondContact O-N 2.97Å; N101-K105 WeakPolarHBondContact O-CG 3.38Å; N101-K105 PolarHBondContact O-N 2.95Å
102	I	79.9	Confident	75.6	Confident	0 Å²	0	92.3 Å²	92.3	0%	0	45%	0.449	C	S	.	.	H	α-helix	trans	-61	-47.2	172.1	-66.2	170	0	0	0	109.5	L24 L27 L85 F86 Y94 V98 L99 I100 D104 K105 F106	L24-I102 HydrophobicContact CD2-CG1 4.2Å; L27-I102 HydrophobicContact CD1-CB 4.27Å; L27-I102 HydrophobicContact CD1-CD1 4.38Å; L27-I102 HydrophobicContact CD1-CG1 3.67Å; L27-I102 HydrophobicContact CD1-CG2 3.99Å; L85-I102 HydrophobicContact CD1-CG2 4.29Å; F86-I102 HydrophobicContact CE1-CG2 4.15Å; F86-I102 HydrophobicContact CZ-CG2 3.82Å; Y94-I102 HydrophobicContact CD1-CD1 4.49Å; Y94-I102 HydrophobicContact CD2-CD1 3.94Å; Y94-I102 HydrophobicContact CE1-CD1 4.3Å; Y94-I102 HydrophobicContact CE2-CD1 3.73Å; Y94-I102 HydrophobicContact CG-CD1 4.34Å; V98-I102 HydrophobicContact CG1-CD1 3.81Å; V98-I102 HydrophobicContact CG1-CG1 4.29Å; V98-I102 VanDerWaalsContact O-CG1 3.25Å; V98-I102 WeakPolarHBondContact O-CG1 3.35Å; V98-I102 PolarHBondContact O-N 3.24Å; L99-I102 PolarHBondContact O-N 3.34Å; I100-I102 PolarHBondContact O-N 3.2Å; I102-D104 VanDerWaalsContact C-N 3.35Å; I102-D104 PolarHBondContact O-N 2.95Å; I102-K105 PolarHBondContact O-N 3.42Å; I102-F106 HydrophobicContact CG2-CD2 4.08Å; I102-F106 HydrophobicContact CG2-CE2 4.14Å; I102-F106 WeakPolarHBondContact O-CD2 3.49Å; I102-F106 PolarHBondContact O-N 3.11Å
103	L	81.3	Confident	75.2	Confident	75 Å²	75	92.4 Å²	92.4	39%	0.393	44%	0.438	S	S	.	.	H	α-helix	trans	-60.9	-40.6	179.2	-72.8	167.1	0	0	0	112.7	F86 L99 I100 K105 F106 S107	F86-L103 HydrophobicContact CE1-CD2 3.73Å; F86-L103 HydrophobicContact CE1-CG 4.05Å; F86-L103 HydrophobicContact CE2-CD2 4.35Å; F86-L103 HydrophobicContact CZ-CD2 3.45Å; F86-L103 VanDerWaalsContact CZ-CD2 3.45Å; F86-L103 HydrophobicContact CZ-CG 4.05Å; L99-L103 HydrophobicContact CD2-CD1 3.7Å; L99-L103 HydrophobicContact CD2-CG 4.48Å; L99-L103 WeakPolarHBondContact O-CG 3.41Å; L99-L103 PolarHBondContact O-N 2.97Å; I100-L103 WeakPolarHBondContact O-CB 3.37Å; I100-L103 PolarHBondContact O-N 2.81Å; L103-K105 VanDerWaalsContact C-N 3.35Å; L103-K105 PolarHBondContact O-N 3.23Å; L103-F106 PolarHBondContact O-N 3.28Å; L103-S107 VanDerWaalsContact O-CB 3.26Å; L103-S107 WeakPolarHBondContact O-CB 3.24Å; L103-S107 PolarHBondContact O-N 3.21Å; L103-S107 PolarHBondContact O-OG 3Å
104	D	83.1	Confident	75.2	Confident	70 Å²	70	88.4 Å²	88.4	37%	0.374	43%	0.427	S	S	.	.	H	α-helix	trans	-60.3	-43.2	175.4	178.7	63.9	0	0	0	111.8	I100 N101 I102 F106 S107 K108	I100-D104 PolarHBondContact O-N 2.7Å; N101-D104 PolarHBondContact O-N 2.97Å; I102-D104 VanDerWaalsContact C-N 3.35Å; I102-D104 PolarHBondContact O-N 2.95Å; D104-F106 VanDerWaalsContact C-N 3.31Å; D104-F106 PolarHBondContact O-N 3.27Å; D104-S107 PolarHBondContact O-N 2.55Å; D104-S107 VanDerWaalsContact O-N 3.11Å; D104-K108 PolarHBondContact O-N 2.96Å; D104-K108 IonicContact OD1-NZ 2.72Å; D104-K108 WeakPolarHBondContact OD2-CE 3.46Å; D104-K108 IonicContact OD2-NZ 2.81Å; D104-K108 PolarHBondContact OD2-NZ 2.89Å
105	K	76.1	Confident	75.1	Confident	61 Å²	61	91.3 Å²	91.3	27%	0.265	44%	0.444	S	S	.	.	H	α-helix	trans	-63.1	-34.8	178.9	-72.4	-77.5	-179.3	170.1	0	113.2	S28 L31 N101 I102 L103	S28-K105 WeakPolarHBondContact OG-CE 2.95Å; S28-K105 PolarHBondContact OG-NZ 2.71Å; L31-K105 HydrophobicContact CD1-CB 4.11Å; N101-K105 WeakPolarHBondContact O-CG 3.38Å; N101-K105 PolarHBondContact O-N 2.95Å; I102-K105 PolarHBondContact O-N 3.42Å; L103-K105 VanDerWaalsContact C-N 3.35Å; L103-K105 PolarHBondContact O-N 3.23Å
106	F	72.1	Confident	74.8	Confident	58 Å²	58	94.5 Å²	94.5	25%	0.254	46%	0.455	S	S	.	.	H	α-helix	trans	-81.9	-20.3	175.2	-83	-92	0	0	0	113.2	L27 M81 A82 L85 I102 L103 D104	L27-F106 HydrophobicContact CD2-CE2 4.28Å; M81-F106 HydrophobicContact CG-CZ 4.31Å; A82-F106 HydrophobicContact CB-CE1 4.08Å; L85-F106 HydrophobicContact CD1-CE2 3.49Å; L85-F106 VanDerWaalsContact CD1-CE2 3.49Å; L85-F106 HydrophobicContact CD1-CZ 3.65Å; I102-F106 HydrophobicContact CG2-CD2 4.08Å; I102-F106 HydrophobicContact CG2-CE2 4.14Å; I102-F106 WeakPolarHBondContact O-CD2 3.49Å; I102-F106 PolarHBondContact O-N 3.11Å; L103-F106 PolarHBondContact O-N 3.28Å; D104-F106 VanDerWaalsContact C-N 3.31Å; D104-F106 PolarHBondContact O-N 3.27Å
107	S	68.6	Low	74.3	Confident	88 Å²	88	87.3 Å²	87.3	62%	0.615	43%	0.427	S	S	*	.	H	α-helix	trans	-91.6	-17.7	-177.4	-59.9	0	0	0	0	113.5	L103 D104 K109	L103-S107 VanDerWaalsContact O-CB 3.26Å; L103-S107 WeakPolarHBondContact O-CB 3.24Å; L103-S107 PolarHBondContact O-N 3.21Å; L103-S107 PolarHBondContact O-OG 3Å; D104-S107 PolarHBondContact O-N 2.55Å; D104-S107 VanDerWaalsContact O-N 3.11Å; S107-K109 VanDerWaalsContact C-N 3.29Å; S107-K109 PolarHBondContact O-N 3.4Å
108	K	56.6	Low	73.7	Confident	142 Å²	142	83 Å²	83	62%	0.617	41%	0.409	S	S	*	.			trans	-67.1	89.1	169.7	-81.4	172.5	174	152.8	0	109.9	D104	D104-K108 PolarHBondContact O-N 2.96Å; D104-K108 IonicContact OD1-NZ 2.72Å; D104-K108 WeakPolarHBondContact OD2-CE 3.46Å; D104-K108 IonicContact OD2-NZ 2.81Å; D104-K108 PolarHBondContact OD2-NZ 2.89Å
109	K	42.2	Very low	73.3	Confident	276 Å²	276	89.7 Å²	89.7	100%	1.2	44%	0.441	S	S	*	.			trans	-68	0	167.7	-113.9	-175.9	179.4	-178.1	0	111.4	S107	S107-K109 VanDerWaalsContact C-N 3.29Å; S107-K109 PolarHBondContact O-N 3.4Å

Retrieved 109 of 109 residues in 32.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).