A0A087WNQ0_MOUSE Loading...

Oocyte secreted protein 1

AlphaFold DB , UniProt , Accession A0A087WNQ0, Species MOUSE (Mus musculus, Mouse), Gene Oosp1, Length 50 aa.

						>A0A087WNQ0_MOUSE|A0A087WNQ0|Oosp1
MKPFVGLLGLLLLLSFMKTCADDWTVRVLISVKQKVEEISLVILLDGQKI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.4	Low	74.9	Confident	229 Å²	229	118.1 Å²	118.1	100%	1.128	65%	0.65	S	S	*	*				0	103.4	0	-65.4	-178.9	175.8	0	0	109.3
2	K	62.9	Low	76	Confident	180 Å²	180	116 Å²	116	78%	0.783	64%	0.636	S	S	*	*			trans	-168.8	47.4	162.7	-106.5	148.9	-178.7	175.1	0	114	F4 V5	K2-F4 PolarHBondContact O-N 3.45Å; K2-V5 HydrophobicContact CG-CG2 4.34Å
3	P	60.1	Low	77	Confident	101 Å²	101	115.4 Å²	115.4	66%	0.656	63%	0.631	S	S	*	*	S	Bend	trans	-71.5	-18.6	170.4	31	-34	0	0	0	113	V5	P3-V5 PolarHBondContact O-N 3.02Å
4	F	64.6	Low	77.7	Confident	159 Å²	159	114.5 Å²	114.5	70%	0.697	62%	0.624	S	S	*	*	H	α-helix	trans	-70.8	-25.7	-172.1	-80.4	-86	0	0	0	115.1	K2 L7 L8	K2-F4 PolarHBondContact O-N 3.45Å; F4-L7 PolarHBondContact O-N 3.33Å; F4-L8 WeakPolarHBondContact O-CB 3.48Å; F4-L8 PolarHBondContact O-N 3.02Å
5	V	69.8	Low	78.1	Confident	106 Å²	106	111.5 Å²	111.5	64%	0.642	62%	0.615	S	S	*	*	H	α-helix	trans	-69.8	-38.9	-176.5	179.6	0	0	0	0	111.4	K2 P3 G9	K2-V5 HydrophobicContact CG-CG2 4.34Å; P3-V5 PolarHBondContact O-N 3.02Å; V5-G9 PolarHBondContact O-N 3.47Å; V5-G9 VanDerWaalsContact O-N 3.14Å
6	G	80.1	Confident	78.5	Confident	56 Å²	56	112.8 Å²	112.8	58%	0.577	61%	0.613	S	S	*	*	H	α-helix	trans	-68.7	-38.3	176.6	0	0	0	0	0	112.8	G9 L10	G6-G9 PolarHBondContact O-N 3.14Å; G6-L10 PolarHBondContact O-N 3.4Å
7	L	85.6	Confident	78.7	Confident	107 Å²	107	113.8 Å²	113.8	56%	0.56	61%	0.614	S	S	*	*	H	α-helix	trans	-67.4	-41.1	177.7	-170.6	69.6	0	0	0	111.7	F4 G9 L10 L11	F4-L7 PolarHBondContact O-N 3.33Å; L7-G9 VanDerWaalsContact C-N 3.34Å; L7-L10 PolarHBondContact O-N 3.46Å; L7-L11 WeakPolarHBondContact O-CB 3.26Å; L7-L11 PolarHBondContact O-N 3.25Å
8	L	84.9	Confident	78.6	Confident	116 Å²	116	115.5 Å²	115.5	61%	0.607	62%	0.615	S	S	*	*	H	α-helix	trans	-63.3	-42	176.6	-147	87.9	0	0	0	111.2	F4 L11 L12	F4-L8 WeakPolarHBondContact O-CB 3.48Å; F4-L8 PolarHBondContact O-N 3.02Å; L8-L11 PolarHBondContact O-N 2.96Å; L8-L12 HydrophobicContact CG-CD1 4.44Å; L8-L12 VanDerWaalsContact O-CD1 3.27Å; L8-L12 WeakPolarHBondContact O-CD1 3.31Å; L8-L12 PolarHBondContact O-N 3.36Å
9	G	88	Confident	78.6	Confident	42 Å²	42	114.4 Å²	114.4	43%	0.433	61%	0.613	S	S	.	*	H	α-helix	trans	-62.5	-41.1	175.6	0	0	0	0	0	113	V5 G6 L7 L12 L13	V5-G9 PolarHBondContact O-N 3.47Å; V5-G9 VanDerWaalsContact O-N 3.14Å; G6-G9 PolarHBondContact O-N 3.14Å; L7-G9 VanDerWaalsContact C-N 3.34Å; G9-L12 PolarHBondContact O-N 3.42Å; G9-L13 PolarHBondContact O-N 3.04Å
10	L	89	Confident	78.4	Confident	92 Å²	92	112.8 Å²	112.8	48%	0.482	61%	0.61	S	S	.	*	H	α-helix	trans	-65.2	-40.3	175.3	-174.9	66.1	0	0	0	111.9	G6 L7 L13 L14	G6-L10 PolarHBondContact O-N 3.4Å; L7-L10 PolarHBondContact O-N 3.46Å; L10-L13 PolarHBondContact O-N 3.38Å; L10-L14 HydrophobicContact CG-CD1 4.24Å; L10-L14 WeakPolarHBondContact O-CG 3.47Å; L10-L14 PolarHBondContact O-N 2.96Å
11	L	88.9	Confident	78.3	Confident	111 Å²	111	109.5 Å²	109.5	58%	0.581	60%	0.599	S	S	*	*	H	α-helix	trans	-66.3	-38.9	179	-152.2	78.8	0	0	0	112.1	L7 L8 S15	L7-L11 WeakPolarHBondContact O-CB 3.26Å; L7-L11 PolarHBondContact O-N 3.25Å; L8-L11 PolarHBondContact O-N 2.96Å; L11-S15 PolarHBondContact O-N 3.48Å; L11-S15 PolarHBondContact O-OG 3.45Å
12	L	88.3	Confident	79.6	Confident	93 Å²	93	103 Å²	103	49%	0.487	57%	0.569	S	S	.	*	H	α-helix	trans	-62	-47.8	171.3	-97.9	95.9	0	0	0	110.8	L8 G9 L14 S15 F16	L8-L12 HydrophobicContact CG-CD1 4.44Å; L8-L12 VanDerWaalsContact O-CD1 3.27Å; L8-L12 WeakPolarHBondContact O-CD1 3.31Å; L8-L12 PolarHBondContact O-N 3.36Å; G9-L12 PolarHBondContact O-N 3.42Å; L12-L14 VanDerWaalsContact C-N 3.32Å; L12-L14 PolarHBondContact O-N 3.27Å; L12-S15 WeakPolarHBondContact O-CB 3.27Å; L12-S15 PolarHBondContact O-N 2.9Å; L12-S15 VanDerWaalsContact O-N 3.13Å; L12-F16 HydrophobicContact CD2-CE2 4.27Å; L12-F16 VanDerWaalsContact O-CD2 3.26Å; L12-F16 WeakPolarHBondContact O-CD2 3.36Å; L12-F16 PolarHBondContact O-N 3.13Å
13	L	89.1	Confident	80.3	Confident	108 Å²	108	98.1 Å²	98.1	57%	0.565	55%	0.551	S	S	*	*	H	α-helix	trans	-59.1	-43.5	-179.5	-173.7	68.1	0	0	0	112	G9 L10 F16 M17	G9-L13 PolarHBondContact O-N 3.04Å; L10-L13 PolarHBondContact O-N 3.38Å; L13-F16 PolarHBondContact O-N 3.01Å; L13-M17 VanDerWaalsContact O-CG 3.31Å; L13-M17 WeakPolarHBondContact O-CG 3.48Å; L13-M17 PolarHBondContact O-N 3.31Å
14	L	86.7	Confident	80.9	Confident	103 Å²	103	100.5 Å²	100.5	54%	0.539	55%	0.547	S	S	.	.	H	α-helix	trans	-65.3	-38.2	176.2	-71.4	170.2	0	0	0	112.3	L10 L12 M17 K18	L10-L14 HydrophobicContact CG-CD1 4.24Å; L10-L14 WeakPolarHBondContact O-CG 3.47Å; L10-L14 PolarHBondContact O-N 2.96Å; L12-L14 VanDerWaalsContact C-N 3.32Å; L12-L14 PolarHBondContact O-N 3.27Å; L14-M17 PolarHBondContact O-N 2.97Å; L14-K18 WeakPolarHBondContact O-CB 3.5Å; L14-K18 PolarHBondContact O-N 2.69Å
15	S	83.8	Confident	81.5	Confident	69 Å²	69	96.2 Å²	96.2	48%	0.483	53%	0.534	S	S	.	.	H	α-helix	trans	-64	-44.2	173.9	-70.6	0	0	0	0	111.8	L11 L12 M17 K18 T19	L11-S15 PolarHBondContact O-N 3.48Å; L11-S15 PolarHBondContact O-OG 3.45Å; L12-S15 WeakPolarHBondContact O-CB 3.27Å; L12-S15 PolarHBondContact O-N 2.9Å; L12-S15 VanDerWaalsContact O-N 3.13Å; S15-M17 PolarHBondContact O-N 2.66Å; S15-K18 PolarHBondContact O-N 3.16Å; S15-T19 PolarHBondContact O-N 3.47Å; S15-T19 PolarHBondContact O-OG1 2.88Å
16	F	83.8	Confident	81.7	Confident	133 Å²	133	94.6 Å²	94.6	58%	0.583	52%	0.524	S	S	*	.	H	α-helix	trans	-60.3	-45.7	175.5	-88.4	-74.9	0	0	0	111.9	L12 L13 K18 T19 C20	L12-F16 HydrophobicContact CD2-CE2 4.27Å; L12-F16 VanDerWaalsContact O-CD2 3.26Å; L12-F16 WeakPolarHBondContact O-CD2 3.36Å; L12-F16 PolarHBondContact O-N 3.13Å; L13-F16 PolarHBondContact O-N 3.01Å; F16-K18 VanDerWaalsContact C-N 3.29Å; F16-K18 PolarHBondContact O-N 3.19Å; F16-T19 PolarHBondContact O-N 3.03Å; F16-C20 WeakPolarHBondContact O-CB 3.43Å; F16-C20 PolarHBondContact O-N 3.5Å; F16-C20 PolarHBondContact O-SG 2.87Å
17	M	81.3	Confident	81.3	Confident	130 Å²	130	99.2 Å²	99.2	64%	0.64	52%	0.524	S	S	*	.	H	α-helix	trans	-59.2	-41	175.7	-73.4	-75.2	-73.8	0	0	111.7	L13 L14 S15 C20 A21	L13-M17 VanDerWaalsContact O-CG 3.31Å; L13-M17 WeakPolarHBondContact O-CG 3.48Å; L13-M17 PolarHBondContact O-N 3.31Å; L14-M17 PolarHBondContact O-N 2.97Å; S15-M17 PolarHBondContact O-N 2.66Å; M17-C20 PolarHBondContact O-N 2.9Å; M17-A21 WeakPolarHBondContact O-CB 3.48Å; M17-A21 PolarHBondContact O-N 3.25Å
18	K	77.2	Confident	80.9	Confident	144 Å²	144	97.6 Å²	97.6	63%	0.626	52%	0.519	S	S	*	.	H	α-helix	trans	-65.5	-43.9	176.3	-175.7	173.6	169.8	59.2	0	112	L14 S15 F16 A21 D22	L14-K18 WeakPolarHBondContact O-CB 3.5Å; L14-K18 PolarHBondContact O-N 2.69Å; S15-K18 PolarHBondContact O-N 3.16Å; F16-K18 VanDerWaalsContact C-N 3.29Å; F16-K18 PolarHBondContact O-N 3.19Å; K18-A21 CarbonylContact O-C 3.53Å; K18-A21 WeakPolarHBondContact O-CB 3.19Å; K18-A21 PolarHBondContact O-N 3.38Å; K18-D22 PolarHBondContact O-N 3.13Å
19	T	79.3	Confident	80.3	Confident	95 Å²	95	97.8 Å²	97.8	58%	0.583	52%	0.52	S	S	*	.	H	α-helix	trans	-64	-42.7	176.4	-59	0	0	0	0	111.8	S15 F16 A21 D22 D23	S15-T19 PolarHBondContact O-N 3.47Å; S15-T19 PolarHBondContact O-OG1 2.88Å; F16-T19 PolarHBondContact O-N 3.03Å; T19-A21 VanDerWaalsContact C-N 3.28Å; T19-A21 PolarHBondContact O-N 2.89Å; T19-D22 PolarHBondContact O-N 3.43Å; T19-D23 WeakPolarHBondContact O-CB 3.37Å; T19-D23 PolarHBondContact O-N 3.21Å
20	C	75.4	Confident	79.8	Confident	81 Å²	81	100.6 Å²	100.6	55%	0.547	52%	0.524	S	S	.	.	H	α-helix	trans	-62.7	-37.9	173.7	-67	0	0	0	0	111.8	F16 M17 D23 W24	F16-C20 WeakPolarHBondContact O-CB 3.43Å; F16-C20 PolarHBondContact O-N 3.5Å; F16-C20 PolarHBondContact O-SG 2.87Å; M17-C20 PolarHBondContact O-N 2.9Å; C20-D23 PolarHBondContact O-N 2.96Å; C20-W24 VanDerWaalsContact O-CD1 3.31Å; C20-W24 PolarHBondContact O-N 3.24Å; C20-W24 VanDerWaalsContact O-N 3.13Å
21	A	76.3	Confident	79	Confident	45 Å²	45	99.8 Å²	99.8	37%	0.372	53%	0.526	S	S	.	.	H	α-helix	trans	-70.7	-26.1	176.3	0	0	0	0	0	113.5	M17 K18 T19 W24 T25	M17-A21 WeakPolarHBondContact O-CB 3.48Å; M17-A21 PolarHBondContact O-N 3.25Å; K18-A21 CarbonylContact O-C 3.53Å; K18-A21 WeakPolarHBondContact O-CB 3.19Å; K18-A21 PolarHBondContact O-N 3.38Å; T19-A21 VanDerWaalsContact C-N 3.28Å; T19-A21 PolarHBondContact O-N 2.89Å; A21-W24 PolarHBondContact O-NE1 3.2Å; A21-T25 PolarHBondContact O-OG1 2.97Å
22	D	77.2	Confident	78.4	Confident	93 Å²	93	98.3 Å²	98.3	50%	0.497	52%	0.521	S	S	.	.	H	α-helix	trans	-79	-42.7	171.5	-108.6	-86.8	0	0	0	110.6	K18 T19 W24 T25 V26	K18-D22 PolarHBondContact O-N 3.13Å; T19-D22 PolarHBondContact O-N 3.43Å; D22-W24 PolarHBondContact O-N 2.9Å; D22-T25 WeakPolarHBondContact O-CB 3.3Å; D22-T25 PolarHBondContact O-N 3.46Å; D22-T25 VanDerWaalsContact O-N 3.16Å; D22-V26 WeakPolarHBondContact O-CG2 3.38Å; D22-V26 PolarHBondContact O-N 3.37Å
23	D	76.4	Confident	77.7	Confident	77 Å²	77	100 Å²	100	41%	0.412	52%	0.524	S	S	.	.	H	α-helix	trans	-67.2	-38.3	-175.1	-161.9	-115.2	0	0	0	113.3	T19 C20 R27	T19-D23 WeakPolarHBondContact O-CB 3.37Å; T19-D23 PolarHBondContact O-N 3.21Å; C20-D23 PolarHBondContact O-N 2.96Å; D23-R27 PolarHBondContact O-N 3.14Å; D23-R27 VanDerWaalsContact O-N 3.14Å; D23-R27 IonicContact OD1-CZ 2.98Å; D23-R27 IonicContact OD1-NH1 2.69Å; D23-R27 PolarHBondContact OD1-NH1 2.95Å; D23-R27 IonicContact OD1-NH2 2.66Å; D23-R27 PolarHBondContact OD1-NH2 3.16Å
24	W	73.6	Confident	77	Confident	150 Å²	150	101.2 Å²	101.2	57%	0.568	53%	0.527	S	S	*	.	H	α-helix	trans	-67.5	-38.8	171.9	84.8	-65.4	0	0	0	111.8	C20 A21 D22 R27 V28	C20-W24 VanDerWaalsContact O-CD1 3.31Å; C20-W24 PolarHBondContact O-N 3.24Å; C20-W24 VanDerWaalsContact O-N 3.13Å; A21-W24 PolarHBondContact O-NE1 3.2Å; D22-W24 PolarHBondContact O-N 2.9Å; W24-R27 PolarHBondContact O-N 3.48Å; W24-V28 HydrophobicContact CE3-CG2 4.05Å; W24-V28 HydrophobicContact CZ3-CG2 4.44Å; W24-V28 VanDerWaalsContact O-CG2 3.3Å; W24-V28 WeakPolarHBondContact O-CG2 3.46Å; W24-V28 PolarHBondContact O-N 3.47Å
25	T	76.1	Confident	76.3	Confident	69 Å²	69	102.8 Å²	102.8	42%	0.423	53%	0.53	S	S	.	.	H	α-helix	trans	-64.6	-43.8	-178.9	-58.7	0	0	0	0	110.4	A21 D22 V28 L29	A21-T25 PolarHBondContact O-OG1 2.97Å; D22-T25 WeakPolarHBondContact O-CB 3.3Å; D22-T25 PolarHBondContact O-N 3.46Å; D22-T25 VanDerWaalsContact O-N 3.16Å; T25-V28 PolarHBondContact O-N 2.73Å; T25-L29 VanDerWaalsContact O-CB 3.29Å; T25-L29 WeakPolarHBondContact O-CB 3.21Å; T25-L29 PolarHBondContact O-N 2.89Å
26	V	74.7	Confident	75.9	Confident	73 Å²	73	103.7 Å²	103.7	44%	0.442	53%	0.532	S	S	.	.	H	α-helix	trans	-62.2	-45.2	175.6	172.7	0	0	0	0	110.8	D22 V28 L29 I30	D22-V26 WeakPolarHBondContact O-CG2 3.38Å; D22-V26 PolarHBondContact O-N 3.37Å; V26-V28 PolarHBondContact O-N 2.72Å; V26-L29 PolarHBondContact O-N 3.28Å; V26-I30 HydrophobicContact CG1-CD1 3.66Å; V26-I30 HydrophobicContact CG1-CG1 4.39Å; V26-I30 WeakPolarHBondContact O-CB 3.38Å; V26-I30 WeakPolarHBondContact O-CD1 3.29Å; V26-I30 WeakPolarHBondContact O-CG1 3.21Å; V26-I30 PolarHBondContact O-N 3.49Å
27	R	72.9	Confident	75.3	Confident	152 Å²	152	102.4 Å²	102.4	57%	0.574	53%	0.528	S	S	*	.	H	α-helix	trans	-61	-43.6	176.3	-84.3	-162.9	-77.6	-89.2	-4.2	113	D23 W24 I30 S31	D23-R27 PolarHBondContact O-N 3.14Å; D23-R27 VanDerWaalsContact O-N 3.14Å; D23-R27 IonicContact OD1-CZ 2.98Å; D23-R27 IonicContact OD1-NH1 2.69Å; D23-R27 PolarHBondContact OD1-NH1 2.95Å; D23-R27 IonicContact OD1-NH2 2.66Å; D23-R27 PolarHBondContact OD1-NH2 3.16Å; W24-R27 PolarHBondContact O-N 3.48Å; R27-I30 PolarHBondContact O-N 2.98Å; R27-S31 WeakPolarHBondContact O-CB 3.49Å; R27-S31 PolarHBondContact O-N 3.28Å
28	V	75.6	Confident	74.9	Confident	74 Å²	74	102.5 Å²	102.5	45%	0.448	53%	0.527	S	S	.	.	H	α-helix	trans	-65.2	-44.2	177.5	172	0	0	0	0	110.5	W24 T25 V26 I30 S31 V32	W24-V28 HydrophobicContact CE3-CG2 4.05Å; W24-V28 HydrophobicContact CZ3-CG2 4.44Å; W24-V28 VanDerWaalsContact O-CG2 3.3Å; W24-V28 WeakPolarHBondContact O-CG2 3.46Å; W24-V28 PolarHBondContact O-N 3.47Å; T25-V28 PolarHBondContact O-N 2.73Å; V26-V28 PolarHBondContact O-N 2.72Å; V28-I30 PolarHBondContact O-N 2.89Å; V28-S31 PolarHBondContact O-N 2.93Å; V28-V32 HydrophobicContact CG1-CG2 4.3Å; V28-V32 VanDerWaalsContact O-CG2 3.3Å; V28-V32 WeakPolarHBondContact O-CG2 3.34Å; V28-V32 PolarHBondContact O-N 3.33Å
29	L	72.7	Confident	74.9	Confident	120 Å²	120	99.9 Å²	99.9	63%	0.628	52%	0.519	S	S	*	.	H	α-helix	trans	-61.2	-43.3	178.3	-171.4	70.4	0	0	0	111.6	T25 V26 V32 K33	T25-L29 VanDerWaalsContact O-CB 3.29Å; T25-L29 WeakPolarHBondContact O-CB 3.21Å; T25-L29 PolarHBondContact O-N 2.89Å; V26-L29 PolarHBondContact O-N 3.28Å; L29-V32 PolarHBondContact O-N 2.86Å; L29-K33 WeakPolarHBondContact O-CB 3.5Å; L29-K33 PolarHBondContact O-N 3.45Å
30	I	77.3	Confident	74.7	Confident	101 Å²	101	98.6 Å²	98.6	52%	0.518	51%	0.514	S	S	.	.	H	α-helix	trans	-63	-45.9	175.7	-66.8	164.2	0	0	0	110.6	V26 R27 V28 V32 K33 Q34	V26-I30 HydrophobicContact CG1-CD1 3.66Å; V26-I30 HydrophobicContact CG1-CG1 4.39Å; V26-I30 WeakPolarHBondContact O-CB 3.38Å; V26-I30 WeakPolarHBondContact O-CD1 3.29Å; V26-I30 WeakPolarHBondContact O-CG1 3.21Å; V26-I30 PolarHBondContact O-N 3.49Å; R27-I30 PolarHBondContact O-N 2.98Å; V28-I30 PolarHBondContact O-N 2.89Å; I30-V32 PolarHBondContact O-N 3.1Å; I30-K33 PolarHBondContact O-N 3.24Å; I30-Q34 WeakPolarHBondContact O-CB 3.38Å; I30-Q34 PolarHBondContact O-N 3.44Å
31	S	72.2	Confident	74.8	Confident	74 Å²	74	100 Å²	100	52%	0.517	52%	0.515	S	S	.	.	H	α-helix	trans	-63.8	-40.1	-179.3	-158	0	0	0	0	112.2	R27 V28 K35	R27-S31 WeakPolarHBondContact O-CB 3.49Å; R27-S31 PolarHBondContact O-N 3.28Å; V28-S31 PolarHBondContact O-N 2.93Å; S31-K35 WeakPolarHBondContact O-CB 3.19Å; S31-K35 PolarHBondContact O-N 2.87Å; S31-K35 VanDerWaalsContact O-N 3.1Å
32	V	77.8	Confident	74.8	Confident	80 Å²	80	102.2 Å²	102.2	49%	0.485	52%	0.524	S	S	.	.	H	α-helix	trans	-67.5	-45.8	174.2	173.5	0	0	0	0	110.9	V28 L29 I30 Q34 K35 V36	V28-V32 HydrophobicContact CG1-CG2 4.3Å; V28-V32 VanDerWaalsContact O-CG2 3.3Å; V28-V32 WeakPolarHBondContact O-CG2 3.34Å; V28-V32 PolarHBondContact O-N 3.33Å; L29-V32 PolarHBondContact O-N 2.86Å; I30-V32 PolarHBondContact O-N 3.1Å; V32-Q34 VanDerWaalsContact C-N 3.31Å; V32-Q34 PolarHBondContact O-N 3.02Å; V32-K35 PolarHBondContact O-N 3.39Å; V32-V36 HydrophobicContact CG1-CG2 4.21Å; V32-V36 WeakPolarHBondContact O-CB 3.49Å; V32-V36 VanDerWaalsContact O-CG2 3.26Å; V32-V36 WeakPolarHBondContact O-CG2 3.3Å; V32-V36 PolarHBondContact O-N 3.05Å
33	K	73.3	Confident	74.8	Confident	129 Å²	129	103.2 Å²	103.2	56%	0.561	53%	0.528	S	S	*	.	H	α-helix	trans	-61.4	-40.7	-179.8	-161.6	-89.6	-173.4	-170.5	0	111.4	L29 I30 V36 E37	L29-K33 WeakPolarHBondContact O-CB 3.5Å; L29-K33 PolarHBondContact O-N 3.45Å; I30-K33 PolarHBondContact O-N 3.24Å; K33-V36 PolarHBondContact O-N 3.45Å; K33-E37 IonicContact NZ-OE2 2.74Å; K33-E37 PolarHBondContact NZ-OE2 3.2Å; K33-E37 WeakPolarHBondContact O-CB 3.26Å; K33-E37 PolarHBondContact O-N 3.03Å
34	Q	74.5	Confident	74.6	Confident	133 Å²	133	105 Å²	105	62%	0.621	54%	0.537	S	S	*	.	H	α-helix	trans	-66.5	-41.2	176.5	-161.5	179.2	-3.1	0	0	111.9	I30 V32 E37 E38	I30-Q34 WeakPolarHBondContact O-CB 3.38Å; I30-Q34 PolarHBondContact O-N 3.44Å; V32-Q34 VanDerWaalsContact C-N 3.31Å; V32-Q34 PolarHBondContact O-N 3.02Å; Q34-E37 PolarHBondContact O-N 3.37Å; Q34-E38 PolarHBondContact O-N 3.38Å
35	K	71.2	Confident	74.5	Confident	137 Å²	137	103.1 Å²	103.1	60%	0.596	54%	0.537	S	S	*	.	H	α-helix	trans	-69.2	-36.6	177.9	-160	153.5	-173.2	169.1	0	112.8	S31 V32 I39	S31-K35 WeakPolarHBondContact O-CB 3.19Å; S31-K35 PolarHBondContact O-N 2.87Å; S31-K35 VanDerWaalsContact O-N 3.1Å; V32-K35 PolarHBondContact O-N 3.39Å; K35-I39 HydrophobicContact CG-CD1 4.27Å; K35-I39 WeakPolarHBondContact O-CD1 3.33Å; K35-I39 WeakPolarHBondContact O-CG1 3.48Å; K35-I39 PolarHBondContact O-N 3.34Å
36	V	75.7	Confident	74.3	Confident	88 Å²	88	105.4 Å²	105.4	53%	0.533	55%	0.547	S	S	.	.	H	α-helix	trans	-65.3	-41.5	173.4	171	0	0	0	0	111.1	V32 K33 I39 S40	V32-V36 HydrophobicContact CG1-CG2 4.21Å; V32-V36 WeakPolarHBondContact O-CB 3.49Å; V32-V36 VanDerWaalsContact O-CG2 3.26Å; V32-V36 WeakPolarHBondContact O-CG2 3.3Å; V32-V36 PolarHBondContact O-N 3.05Å; K33-V36 PolarHBondContact O-N 3.45Å; V36-I39 PolarHBondContact O-N 3.01Å; V36-S40 WeakPolarHBondContact O-CB 3.43Å; V36-S40 PolarHBondContact O-N 2.74Å
37	E	71.6	Confident	74	Confident	106 Å²	106	104.4 Å²	104.4	50%	0.495	55%	0.551	S	S	.	*	H	α-helix	trans	-65.2	-42.1	178.3	-160.5	168.3	97.8	0	0	111.6	K33 Q34 S40 L41	K33-E37 IonicContact NZ-OE2 2.74Å; K33-E37 PolarHBondContact NZ-OE2 3.2Å; K33-E37 WeakPolarHBondContact O-CB 3.26Å; K33-E37 PolarHBondContact O-N 3.03Å; Q34-E37 PolarHBondContact O-N 3.37Å; E37-S40 PolarHBondContact O-N 3.5Å; E37-L41 WeakPolarHBondContact O-CB 3.42Å; E37-L41 PolarHBondContact O-N 2.87Å
38	E	71.5	Confident	73.4	Confident	131 Å²	131	104.2 Å²	104.2	61%	0.612	56%	0.557	S	S	*	*	H	α-helix	trans	-60.9	-48.6	174.3	-173.3	179	88.1	0	0	112	Q34 S40 L41 V42	Q34-E38 PolarHBondContact O-N 3.38Å; E38-S40 VanDerWaalsContact C-N 3.32Å; E38-S40 PolarHBondContact O-N 2.99Å; E38-L41 PolarHBondContact O-N 2.95Å; E38-V42 WeakPolarHBondContact O-CG2 3.36Å; E38-V42 PolarHBondContact O-N 3.05Å
39	I	78	Confident	72.4	Confident	90 Å²	90	109.3 Å²	109.3	46%	0.462	57%	0.573	S	S	.	*	H	α-helix	trans	-60.8	-42.7	177.2	-67.5	162.4	0	0	0	110.7	K35 V36 L41 V42 I43	K35-I39 HydrophobicContact CG-CD1 4.27Å; K35-I39 WeakPolarHBondContact O-CD1 3.33Å; K35-I39 WeakPolarHBondContact O-CG1 3.48Å; K35-I39 PolarHBondContact O-N 3.34Å; V36-I39 PolarHBondContact O-N 3.01Å; I39-L41 VanDerWaalsContact C-N 3.3Å; I39-L41 PolarHBondContact O-N 3.42Å; I39-V42 PolarHBondContact O-N 3.41Å; I39-I43 HydrophobicContact CG2-CD1 3.78Å; I39-I43 HydrophobicContact CG2-CG1 4.48Å; I39-I43 VanDerWaalsContact O-CG1 3.3Å; I39-I43 WeakPolarHBondContact O-CG1 3.35Å; I39-I43 PolarHBondContact O-N 2.91Å
40	S	74.9	Confident	71.5	Confident	68 Å²	68	114 Å²	114	48%	0.476	60%	0.597	S	S	.	*	H	α-helix	trans	-65	-35.6	-179.7	-160.6	0	0	0	0	112.2	V36 E37 E38 L44	V36-S40 WeakPolarHBondContact O-CB 3.43Å; V36-S40 PolarHBondContact O-N 2.74Å; E37-S40 PolarHBondContact O-N 3.5Å; E38-S40 VanDerWaalsContact C-N 3.32Å; E38-S40 PolarHBondContact O-N 2.99Å; S40-L44 WeakPolarHBondContact O-CB 3.3Å; S40-L44 PolarHBondContact O-N 3.43Å; S40-L44 VanDerWaalsContact O-N 3.09Å
41	L	76.6	Confident	71.2	Confident	109 Å²	109	114.7 Å²	114.7	57%	0.571	60%	0.601	S	S	*	*	H	α-helix	trans	-71.9	-37.6	178.7	-147.3	147.8	0	0	0	111.4	E37 E38 I39 L44 L45	E37-L41 WeakPolarHBondContact O-CB 3.42Å; E37-L41 PolarHBondContact O-N 2.87Å; E38-L41 PolarHBondContact O-N 2.95Å; I39-L41 VanDerWaalsContact C-N 3.3Å; I39-L41 PolarHBondContact O-N 3.42Å; L41-L44 PolarHBondContact O-N 3.05Å; L41-L45 HydrophobicContact CD2-CD1 3.66Å; L41-L45 HydrophobicContact CD2-CG 4.18Å; L41-L45 WeakPolarHBondContact O-CB 3.38Å; L41-L45 WeakPolarHBondContact O-CG 3.36Å; L41-L45 PolarHBondContact O-N 3.35Å
42	V	76.6	Confident	71.1	Confident	92 Å²	92	116.8 Å²	116.8	56%	0.558	61%	0.605	S	S	*	*	H	α-helix	trans	-62.5	-46.3	173.2	172.2	0	0	0	0	111.3	E38 I39 L44 L45 D46	E38-V42 WeakPolarHBondContact O-CG2 3.36Å; E38-V42 PolarHBondContact O-N 3.05Å; I39-V42 PolarHBondContact O-N 3.41Å; V42-L44 VanDerWaalsContact C-N 3.3Å; V42-L44 PolarHBondContact O-N 3.25Å; V42-L45 PolarHBondContact O-N 2.88Å; V42-D46 WeakPolarHBondContact O-CB 3.3Å; V42-D46 PolarHBondContact O-N 3.41Å
43	I	76.9	Confident	70.8	Confident	114 Å²	114	118.9 Å²	118.9	59%	0.585	61%	0.612	S	S	*	*	H	α-helix	trans	-63.4	-38.6	178.1	-64.1	164.1	0	0	0	111.1	I39 D46 G47	I39-I43 HydrophobicContact CG2-CD1 3.78Å; I39-I43 HydrophobicContact CG2-CG1 4.48Å; I39-I43 VanDerWaalsContact O-CG1 3.3Å; I39-I43 WeakPolarHBondContact O-CG1 3.35Å; I39-I43 PolarHBondContact O-N 2.91Å; I43-D46 PolarHBondContact O-N 3.14Å; I43-G47 PolarHBondContact O-N 3.09Å
44	L	72.9	Confident	70.6	Confident	115 Å²	115	118.3 Å²	118.3	60%	0.602	62%	0.615	S	S	*	*	H	α-helix	trans	-71.8	-35.8	-178.4	-148.8	142.3	0	0	0	112	S40 L41 V42 Q48	S40-L44 WeakPolarHBondContact O-CB 3.3Å; S40-L44 PolarHBondContact O-N 3.43Å; S40-L44 VanDerWaalsContact O-N 3.09Å; L41-L44 PolarHBondContact O-N 3.05Å; V42-L44 VanDerWaalsContact C-N 3.3Å; V42-L44 PolarHBondContact O-N 3.25Å; L44-Q48 WeakPolarHBondContact O-CB 3.37Å; L44-Q48 PolarHBondContact O-N 3.4Å; L44-Q48 VanDerWaalsContact O-N 3.16Å
45	L	72.7	Confident	70.4	Confident	110 Å²	110	117.4 Å²	117.4	58%	0.576	62%	0.615	S	S	*	*	H	α-helix	trans	-70.6	-39.2	172.8	-73.8	171.8	0	0	0	112.5	L41 V42 Q48	L41-L45 HydrophobicContact CD2-CD1 3.66Å; L41-L45 HydrophobicContact CD2-CG 4.18Å; L41-L45 WeakPolarHBondContact O-CB 3.38Å; L41-L45 WeakPolarHBondContact O-CG 3.36Å; L41-L45 PolarHBondContact O-N 3.35Å; V42-L45 PolarHBondContact O-N 2.88Å; L45-Q48 PolarHBondContact O-N 3.33Å
46	D	71.9	Confident	70.3	Confident	117 Å²	117	116.1 Å²	116.1	63%	0.626	62%	0.616	S	S	*	*	H	α-helix	trans	-67.4	-42.4	176.5	-164.6	-109.1	0	0	0	111.1	V42 I43 Q48 K49	V42-D46 WeakPolarHBondContact O-CB 3.3Å; V42-D46 PolarHBondContact O-N 3.41Å; I43-D46 PolarHBondContact O-N 3.14Å; D46-Q48 VanDerWaalsContact C-N 3.28Å; D46-Q48 PolarHBondContact O-N 3.48Å; D46-K49 VanDerWaalsContact O-CB 3.3Å; D46-K49 WeakPolarHBondContact O-CB 3.48Å; D46-K49 PolarHBondContact O-N 3.16Å; D46-K49 VanDerWaalsContact O-N 3.14Å
47	G	67.4	Low	70	Confident	52 Å²	52	118.1 Å²	118.1	54%	0.536	62%	0.622	S	S	.	*	H	α-helix	trans	-68.6	-19.3	176.1	0	0	0	0	0	115	I43 K49	I43-G47 PolarHBondContact O-N 3.09Å; G47-K49 VanDerWaalsContact C-N 3.34Å
48	Q	59.4	Low	69.8	Low	149 Å²	149	119 Å²	119	70%	0.696	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.6	-1.5	173.7	-129.8	-164.4	88.4	0	0	113.4	L44 L45 D46 I50	L44-Q48 WeakPolarHBondContact O-CB 3.37Å; L44-Q48 PolarHBondContact O-N 3.4Å; L44-Q48 VanDerWaalsContact O-N 3.16Å; L45-Q48 PolarHBondContact O-N 3.33Å; D46-Q48 VanDerWaalsContact C-N 3.28Å; D46-Q48 PolarHBondContact O-N 3.48Å; Q48-I50 PolarHBondContact O-N 3.22Å
49	K	56.2	Low	69.7	Low	181 Å²	181	118 Å²	118	79%	0.787	63%	0.633	S	S	*	*			trans	-84.9	27.5	179.7	-147.4	179.4	-176.4	-179.4	0	113.1	D46 G47	D46-K49 VanDerWaalsContact O-CB 3.3Å; D46-K49 WeakPolarHBondContact O-CB 3.48Å; D46-K49 PolarHBondContact O-N 3.16Å; D46-K49 VanDerWaalsContact O-N 3.14Å; G47-K49 VanDerWaalsContact C-N 3.34Å
50	I	52.7	Low	68.9	Low	219 Å²	219	120.5 Å²	120.5	100%	1.123	65%	0.649	S	S	*	*			trans	-122.9	0	175	-51.8	175.5	0	0	0	109	Q48	Q48-I50 PolarHBondContact O-N 3.22Å

Retrieved 50 of 50 residues in 15.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).