A0A087WNQ6_MOUSE Loading...

Sycp3 like Y-linked

AlphaFold DB , UniProt , Accession A0A087WNQ6, Species MOUSE (Mus musculus, Mouse), Gene Sly, Length 110 aa.

						>A0A087WNQ6_MOUSE|A0A087WNQ6|Sly
METLKVFLGTGDVRNDIYKTLHIKRKWMETYVKESFKGSNQKLERFCKTNERERKNINNKFCEQYITTFQKSDMDVQKFNEEKEKSVNSCQKEQQALKLSKCSQNQTLEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.2	Low	52.4	Low	198 Å²	198	118.3 Å²	118.3	98%	0.975	64%	0.64	S	S	*	*				0	-30	0	-147.5	-175.5	-94.9	0	0	112
2	E	52.5	Low	54.1	Low	163 Å²	163	116.6 Å²	116.6	76%	0.762	63%	0.63	S	S	*	*	H	α-helix	trans	-67	-36.8	176.1	-71	176.9	147	0	0	114.5	L4 K5 V6	E2-L4 VanDerWaalsContact C-N 3.26Å; E2-L4 PolarHBondContact O-N 3.14Å; E2-K5 PolarHBondContact O-N 3.37Å; E2-K5 VanDerWaalsContact O-N 3.1Å; E2-V6 PolarHBondContact O-N 3.41Å
3	T	50.5	Low	56	Low	121 Å²	121	114.4 Å²	114.4	74%	0.742	62%	0.623	S	S	*	*	H	α-helix	trans	-62.5	-31.1	178.1	-9.3	0	0	0	0	113.1	F7	T3-F7 WeakPolarHBondContact O-CB 3.44Å; T3-F7 PolarHBondContact O-N 2.99Å; T3-F7 VanDerWaalsContact O-N 3.12Å
4	L	49.5	Very low	57.8	Low	122 Å²	122	117.8 Å²	117.8	64%	0.639	62%	0.622	S	S	*	*	H	α-helix	trans	-75	-33.8	174.7	-103.5	133.5	0	0	0	112.3	E2 F7 L8	E2-L4 VanDerWaalsContact C-N 3.26Å; E2-L4 PolarHBondContact O-N 3.14Å; L4-F7 PolarHBondContact O-N 3.14Å; L4-L8 WeakPolarHBondContact O-CB 3.32Å; L4-L8 VanDerWaalsContact O-CG 3.23Å; L4-L8 WeakPolarHBondContact O-CG 3.34Å; L4-L8 PolarHBondContact O-N 3.12Å
5	K	49.3	Very low	59.8	Low	161 Å²	161	115.3 Å²	115.3	70%	0.7	61%	0.61	S	S	*	*	H	α-helix	trans	-69.7	-38.2	173.7	-80	-176	176.4	178.4	0	112.3	E2 G9	E2-K5 PolarHBondContact O-N 3.37Å; E2-K5 VanDerWaalsContact O-N 3.1Å; K5-G9 PolarHBondContact O-N 2.98Å
6	V	54	Low	61.7	Low	96 Å²	96	112.4 Å²	112.4	58%	0.582	59%	0.594	S	S	*	*	H	α-helix	trans	-64	-44.7	173	176	0	0	0	0	110.4	E2 G9 T10	E2-V6 PolarHBondContact O-N 3.41Å; V6-G9 PolarHBondContact O-N 3.32Å; V6-T10 HydrophobicContact CG1-CG2 4.46Å; V6-T10 VanDerWaalsContact O-CG2 3.24Å; V6-T10 WeakPolarHBondContact O-CG2 3.44Å; V6-T10 PolarHBondContact O-N 3.02Å; V6-T10 PolarHBondContact O-OG1 3.05Å
7	F	47.6	Very low	63.5	Low	164 Å²	164	111.2 Å²	111.2	72%	0.719	59%	0.587	S	S	*	*	H	α-helix	trans	-65.1	-43.2	178.8	-158.3	-97.7	0	0	0	112.6	T3 L4 T10 G11	T3-F7 WeakPolarHBondContact O-CB 3.44Å; T3-F7 PolarHBondContact O-N 2.99Å; T3-F7 VanDerWaalsContact O-N 3.12Å; L4-F7 PolarHBondContact O-N 3.14Å; F7-T10 WeakPolarHBondContact CA-OG1 3.34Å; F7-T10 PolarHBondContact O-N 3.34Å; F7-T10 PolarHBondContact O-OG1 3.42Å; F7-G11 PolarHBondContact O-N 3.01Å; F7-G11 VanDerWaalsContact O-N 3.15Å
8	L	51.4	Low	65.2	Low	122 Å²	122	113.6 Å²	113.6	64%	0.639	59%	0.588	S	S	*	*	H	α-helix	trans	-66.9	-39.1	175.6	-71.1	169	0	0	0	112.7	L4 G11 D12	L4-L8 WeakPolarHBondContact O-CB 3.32Å; L4-L8 VanDerWaalsContact O-CG 3.23Å; L4-L8 WeakPolarHBondContact O-CG 3.34Å; L4-L8 PolarHBondContact O-N 3.12Å; L8-G11 PolarHBondContact O-N 2.99Å; L8-D12 PolarHBondContact O-N 3.36Å
9	G	55	Low	66.8	Low	41 Å²	41	112.8 Å²	112.8	42%	0.423	58%	0.58	S	S	.	*	H	α-helix	trans	-66.5	-34.8	174.2	0	0	0	0	0	113.5	K5 V6 V13	K5-G9 PolarHBondContact O-N 2.98Å; V6-G9 PolarHBondContact O-N 3.32Å; G9-V13 WeakPolarHBondContact O-CG2 3.37Å; G9-V13 PolarHBondContact O-N 3.23Å
10	T	54	Low	68.2	Low	73 Å²	73	111.8 Å²	111.8	45%	0.448	58%	0.579	S	S	.	*	H	α-helix	trans	-73.2	-25	175.1	58.2	0	0	0	0	113.9	V6 F7 R14	V6-T10 HydrophobicContact CG1-CG2 4.46Å; V6-T10 VanDerWaalsContact O-CG2 3.24Å; V6-T10 WeakPolarHBondContact O-CG2 3.44Å; V6-T10 PolarHBondContact O-N 3.02Å; V6-T10 PolarHBondContact O-OG1 3.05Å; F7-T10 WeakPolarHBondContact CA-OG1 3.34Å; F7-T10 PolarHBondContact O-N 3.34Å; F7-T10 PolarHBondContact O-OG1 3.42Å; T10-R14 WeakPolarHBondContact O-CB 3.48Å; T10-R14 PolarHBondContact O-N 3.34Å; T10-R14 VanDerWaalsContact O-N 3.13Å
11	G	60.7	Low	69.5	Low	40 Å²	40	111.3 Å²	111.3	41%	0.412	58%	0.577	S	S	.	*	H	α-helix	trans	-68.4	-37.5	174.9	0	0	0	0	0	113	F7 L8 N15	F7-G11 PolarHBondContact O-N 3.01Å; F7-G11 VanDerWaalsContact O-N 3.15Å; L8-G11 PolarHBondContact O-N 2.99Å; G11-N15 PolarHBondContact O-N 2.95Å; G11-N15 VanDerWaalsContact O-N 3.13Å
12	D	71.8	Confident	71.7	Confident	98 Å²	98	106.4 Å²	106.4	52%	0.524	55%	0.552	S	S	.	*	H	α-helix	trans	-69	-47.2	177.7	-162.4	25.9	0	0	0	111.6	L8 R14 N15 D16	L8-D12 PolarHBondContact O-N 3.36Å; D12-R14 VanDerWaalsContact C-N 3.31Å; D12-R14 PolarHBondContact O-N 3.46Å; D12-N15 WeakPolarHBondContact O-CB 3.31Å; D12-N15 PolarHBondContact O-N 2.88Å; D12-N15 VanDerWaalsContact O-N 3.15Å; D12-D16 PolarHBondContact O-N 3.23Å
13	V	79	Confident	73.8	Confident	88 Å²	88	104.3 Å²	104.3	53%	0.533	54%	0.544	S	S	.	.	H	α-helix	trans	-58.7	-42.1	174.9	175.7	0	0	0	0	111.8	G9 D16 I17	G9-V13 WeakPolarHBondContact O-CG2 3.37Å; G9-V13 PolarHBondContact O-N 3.23Å; V13-D16 PolarHBondContact O-N 3.46Å; V13-I17 HydrophobicContact CG1-CD1 3.91Å; V13-I17 VanDerWaalsContact O-CG1 3.24Å; V13-I17 WeakPolarHBondContact O-CG1 3.44Å; V13-I17 PolarHBondContact O-N 3.25Å
14	R	81.7	Confident	76.1	Confident	162 Å²	162	104.1 Å²	104.1	61%	0.611	53%	0.533	S	S	*	.	H	α-helix	trans	-63.1	-43.7	177.6	-176.6	-175.3	-64.6	-146.9	1.4	111.6	T10 D12 D16 I17 Y18	T10-R14 WeakPolarHBondContact O-CB 3.48Å; T10-R14 PolarHBondContact O-N 3.34Å; T10-R14 VanDerWaalsContact O-N 3.13Å; D12-R14 VanDerWaalsContact C-N 3.31Å; D12-R14 PolarHBondContact O-N 3.46Å; R14-D16 VanDerWaalsContact C-N 3.33Å; R14-I17 PolarHBondContact O-N 3.44Å; R14-Y18 HydrophobicContact CG-CD2 3.85Å; R14-Y18 HydrophobicContact CG-CE2 3.57Å; R14-Y18 WeakPolarHBondContact O-CD2 3.42Å; R14-Y18 PolarHBondContact O-N 3Å
15	N	87.8	Confident	78.4	Confident	81 Å²	81	103.4 Å²	103.4	43%	0.433	52%	0.522	S	S	.	.	H	α-helix	trans	-62.3	-42.3	178.5	-171.4	32.2	0	0	0	111.4	G11 D12 Y18 K19	G11-N15 PolarHBondContact O-N 2.95Å; G11-N15 VanDerWaalsContact O-N 3.13Å; D12-N15 WeakPolarHBondContact O-CB 3.31Å; D12-N15 PolarHBondContact O-N 2.88Å; D12-N15 VanDerWaalsContact O-N 3.15Å; N15-Y18 PolarHBondContact O-N 3.2Å; N15-K19 WeakPolarHBondContact ND2-CE 3.31Å; N15-K19 PolarHBondContact ND2-NZ 2.97Å; N15-K19 WeakPolarHBondContact O-CG 3.46Å; N15-K19 PolarHBondContact O-N 3.39Å
16	D	90	Very high	80.7	Confident	69 Å²	69	100.2 Å²	100.2	37%	0.369	51%	0.508	S	S	.	.	H	α-helix	trans	-69.5	-34.3	178.1	-73.3	-12.6	0	0	0	113.1	D12 V13 R14 K19 T20	D12-D16 PolarHBondContact O-N 3.23Å; V13-D16 PolarHBondContact O-N 3.46Å; R14-D16 VanDerWaalsContact C-N 3.33Å; D16-K19 PolarHBondContact O-N 2.88Å; D16-K19 IonicContact OD1-NZ 2.97Å; D16-K19 PolarHBondContact OD1-NZ 3.45Å; D16-T20 VanDerWaalsContact O-CB 3.31Å; D16-T20 WeakPolarHBondContact O-CB 3.48Å; D16-T20 PolarHBondContact O-N 3Å; D16-T20 PolarHBondContact O-OG1 3.43Å
17	I	92.1	Very high	82.8	Confident	92 Å²	92	103.5 Å²	103.5	47%	0.472	51%	0.51	S	S	.	.	H	α-helix	trans	-60.2	-47.8	168.8	-70.1	164.8	0	0	0	110.2	V13 R14 K19 T20 L21	V13-I17 HydrophobicContact CG1-CD1 3.91Å; V13-I17 VanDerWaalsContact O-CG1 3.24Å; V13-I17 WeakPolarHBondContact O-CG1 3.44Å; V13-I17 PolarHBondContact O-N 3.25Å; R14-I17 PolarHBondContact O-N 3.44Å; I17-K19 PolarHBondContact O-N 2.95Å; I17-T20 PolarHBondContact O-N 3.08Å; I17-L21 HydrophobicContact CG2-CD1 3.82Å; I17-L21 HydrophobicContact CG2-CG 4.29Å; I17-L21 WeakPolarHBondContact O-CB 3.5Å; I17-L21 VanDerWaalsContact O-CG 3.29Å; I17-L21 WeakPolarHBondContact O-CG 3.41Å; I17-L21 PolarHBondContact O-N 3.49Å
18	Y	95	Very high	85.2	Confident	153 Å²	153	99.3 Å²	99.3	60%	0.6	49%	0.494	S	S	*	.	H	α-helix	trans	-62.3	-43.5	178.7	-82.5	-65.8	0	0	0	112.7	R14 N15 L21 H22	R14-Y18 HydrophobicContact CG-CD2 3.85Å; R14-Y18 HydrophobicContact CG-CE2 3.57Å; R14-Y18 WeakPolarHBondContact O-CD2 3.42Å; R14-Y18 PolarHBondContact O-N 3Å; N15-Y18 PolarHBondContact O-N 3.2Å; Y18-L21 PolarHBondContact O-N 3.37Å; Y18-H22 WeakPolarHBondContact O-CB 3.36Å; Y18-H22 PolarHBondContact O-N 2.86Å
19	K	94.4	Very high	87.5	Confident	99 Å²	99	97.6 Å²	97.6	43%	0.43	48%	0.482	S	S	.	.	H	α-helix	trans	-60.1	-46.9	174.9	-69.7	173.4	-161.6	153.7	0	111.1	N15 D16 I17 L21 H22 I23	N15-K19 WeakPolarHBondContact ND2-CE 3.31Å; N15-K19 PolarHBondContact ND2-NZ 2.97Å; N15-K19 WeakPolarHBondContact O-CG 3.46Å; N15-K19 PolarHBondContact O-N 3.39Å; D16-K19 PolarHBondContact O-N 2.88Å; D16-K19 IonicContact OD1-NZ 2.97Å; D16-K19 PolarHBondContact OD1-NZ 3.45Å; I17-K19 PolarHBondContact O-N 2.95Å; K19-L21 PolarHBondContact O-N 3.45Å; K19-H22 WeakPolarHBondContact O-CB 3.29Å; K19-H22 PolarHBondContact O-N 3.45Å; K19-I23 VanDerWaalsContact O-CG1 3.32Å; K19-I23 WeakPolarHBondContact O-CG1 3.37Å; K19-I23 PolarHBondContact O-N 3.3Å
20	T	95.6	Very high	89.5	Confident	92 Å²	92	99.5 Å²	99.5	56%	0.564	49%	0.486	S	S	*	.	H	α-helix	trans	-61.6	-45.8	179.6	-58.9	0	0	0	0	111.5	D16 I17 H22 I23 K24	D16-T20 VanDerWaalsContact O-CB 3.31Å; D16-T20 WeakPolarHBondContact O-CB 3.48Å; D16-T20 PolarHBondContact O-N 3Å; D16-T20 PolarHBondContact O-OG1 3.43Å; I17-T20 PolarHBondContact O-N 3.08Å; T20-H22 VanDerWaalsContact C-N 3.33Å; T20-H22 PolarHBondContact O-N 3.42Å; T20-I23 PolarHBondContact O-N 2.97Å; T20-K24 WeakPolarHBondContact O-CB 3.41Å; T20-K24 PolarHBondContact O-N 3.5Å
21	L	96.3	Very high	91.6	Very high	103 Å²	103	102.6 Å²	102.6	54%	0.539	49%	0.49	S	S	.	.	H	α-helix	trans	-62.7	-40	175.7	-72.1	174.5	0	0	0	111.9	I17 Y18 K19 K24 R25	I17-L21 HydrophobicContact CG2-CD1 3.82Å; I17-L21 HydrophobicContact CG2-CG 4.29Å; I17-L21 WeakPolarHBondContact O-CB 3.5Å; I17-L21 VanDerWaalsContact O-CG 3.29Å; I17-L21 WeakPolarHBondContact O-CG 3.41Å; I17-L21 PolarHBondContact O-N 3.49Å; Y18-L21 PolarHBondContact O-N 3.37Å; K19-L21 PolarHBondContact O-N 3.45Å; L21-K24 PolarHBondContact O-N 3.32Å; L21-R25 WeakPolarHBondContact O-CB 3.33Å; L21-R25 PolarHBondContact O-N 3.36Å
22	H	96.6	Very high	93.4	Very high	95 Å²	95	104.1 Å²	104.1	44%	0.44	49%	0.492	S	S	.	.	H	α-helix	trans	-62.9	-47.1	176.9	-172	103.8	0	0	0	111.7	Y18 K19 T20 R25 K26	Y18-H22 WeakPolarHBondContact O-CB 3.36Å; Y18-H22 PolarHBondContact O-N 2.86Å; K19-H22 WeakPolarHBondContact O-CB 3.29Å; K19-H22 PolarHBondContact O-N 3.45Å; T20-H22 VanDerWaalsContact C-N 3.33Å; T20-H22 PolarHBondContact O-N 3.42Å; H22-R25 PolarHBondContact CE1-NH2 2.92Å; H22-R25 PolarHBondContact ND1-NH2 3.49Å; H22-R25 PolarHBondContact O-N 3.31Å; H22-K26 WeakPolarHBondContact O-CG 3.38Å; H22-K26 PolarHBondContact O-N 3.32Å
23	I	97.5	Very high	94.7	Very high	118 Å²	118	106.3 Å²	106.3	61%	0.605	50%	0.496	S	S	*	.	H	α-helix	trans	-60.7	-48.1	176.9	-68.2	164.9	0	0	0	110.1	K19 T20 R25 K26 W27	K19-I23 VanDerWaalsContact O-CG1 3.32Å; K19-I23 WeakPolarHBondContact O-CG1 3.37Å; K19-I23 PolarHBondContact O-N 3.3Å; T20-I23 PolarHBondContact O-N 2.97Å; I23-R25 VanDerWaalsContact C-N 3.31Å; I23-R25 PolarHBondContact O-N 3.45Å; I23-K26 PolarHBondContact O-N 2.98Å; I23-W27 WeakPolarHBondContact O-CB 3.39Å; I23-W27 PolarHBondContact O-N 2.97Å
24	K	97.8	Very high	95.6	Very high	118 Å²	118	106.4 Å²	106.4	51%	0.513	49%	0.491	S	S	.	.	H	α-helix	trans	-58.9	-42.9	178.3	-172.3	176.2	-173.2	-73.5	0	111.6	T20 L21 W27 M28	T20-K24 WeakPolarHBondContact O-CB 3.41Å; T20-K24 PolarHBondContact O-N 3.5Å; L21-K24 PolarHBondContact O-N 3.32Å; K24-W27 PolarHBondContact O-N 3.16Å; K24-M28 HydrophobicContact CG-CE 4.15Å; K24-M28 HydrophobicContact CG-SD 4.37Å; K24-M28 PolarHBondContact NZ-SD 2.96Å; K24-M28 VanDerWaalsContact NZ-SD 3.45Å; K24-M28 VanDerWaalsContact O-CG 3.3Å; K24-M28 WeakPolarHBondContact O-CG 3.33Å; K24-M28 PolarHBondContact O-N 3.17Å
25	R	98.1	Very high	96.4	Very high	106 Å²	106	101 Å²	101	40%	0.4	48%	0.478	S	S	.	.	H	α-helix	trans	-62	-48.7	176	178.3	177.6	57.7	100.6	-6.5	111.6	L21 H22 I23 W27 M28 E29	L21-R25 WeakPolarHBondContact O-CB 3.33Å; L21-R25 PolarHBondContact O-N 3.36Å; H22-R25 PolarHBondContact CE1-NH2 2.92Å; H22-R25 PolarHBondContact ND1-NH2 3.49Å; H22-R25 PolarHBondContact O-N 3.31Å; I23-R25 VanDerWaalsContact C-N 3.31Å; I23-R25 PolarHBondContact O-N 3.45Å; R25-W27 VanDerWaalsContact C-N 3.3Å; R25-W27 PolarHBondContact O-N 2.96Å; R25-M28 PolarHBondContact O-N 3.32Å; R25-E29 HydrophobicContact CG-CG 4.31Å; R25-E29 VanDerWaalsContact CG-OE1 3.28Å; R25-E29 WeakPolarHBondContact CG-OE1 3.45Å; R25-E29 IonicContact CZ-OE1 3.87Å; R25-E29 IonicContact NH1-OE1 2.89Å; R25-E29 PolarHBondContact NH1-OE1 3.11Å; R25-E29 WeakPolarHBondContact O-CB 3.46Å; R25-E29 WeakPolarHBondContact O-CG 3.4Å; R25-E29 PolarHBondContact O-N 3.29Å
26	K	98.4	Very high	96.9	Very high	95 Å²	95	103.4 Å²	103.4	41%	0.413	49%	0.485	S	S	.	.	H	α-helix	trans	-61.1	-40	178.9	-76.6	-73.7	163.2	-150.7	0	112.6	H22 I23 E29 T30	H22-K26 WeakPolarHBondContact O-CG 3.38Å; H22-K26 PolarHBondContact O-N 3.32Å; I23-K26 PolarHBondContact O-N 2.98Å; K26-E29 IonicContact NZ-OE2 3.52Å; K26-E29 PolarHBondContact NZ-OE2 3.28Å; K26-T30 WeakPolarHBondContact O-CB 3.26Å; K26-T30 PolarHBondContact O-N 3.05Å; K26-T30 PolarHBondContact O-OG1 3.4Å
27	W	98.3	Very high	97.3	Very high	165 Å²	165	105.1 Å²	105.1	63%	0.625	49%	0.489	S	S	*	.	H	α-helix	trans	-62.8	-46.9	174.4	-179	87.8	0	0	0	111.6	I23 K24 R25 T30 Y31	I23-W27 WeakPolarHBondContact O-CB 3.39Å; I23-W27 PolarHBondContact O-N 2.97Å; K24-W27 PolarHBondContact O-N 3.16Å; R25-W27 VanDerWaalsContact C-N 3.3Å; R25-W27 PolarHBondContact O-N 2.96Å; W27-T30 PolarHBondContact O-N 3.21Å; W27-Y31 HydrophobicContact CH2-CD2 4.45Å; W27-Y31 HydrophobicContact CH2-CG 4.4Å; W27-Y31 HydrophobicContact CZ2-CD2 4.46Å; W27-Y31 WeakPolarHBondContact O-CB 3.1Å; W27-Y31 PolarHBondContact O-N 2.88Å
28	M	98.4	Very high	97.5	Very high	75 Å²	75	102.5 Å²	102.5	37%	0.369	48%	0.484	S	S	.	.	H	α-helix	trans	-63.7	-44.1	177.2	-70.2	-176.9	-54.3	0	0	112.3	K24 R25 T30 Y31 V32	K24-M28 HydrophobicContact CG-CE 4.15Å; K24-M28 HydrophobicContact CG-SD 4.37Å; K24-M28 PolarHBondContact NZ-SD 2.96Å; K24-M28 VanDerWaalsContact NZ-SD 3.45Å; K24-M28 VanDerWaalsContact O-CG 3.3Å; K24-M28 WeakPolarHBondContact O-CG 3.33Å; K24-M28 PolarHBondContact O-N 3.17Å; R25-M28 PolarHBondContact O-N 3.32Å; M28-T30 VanDerWaalsContact C-N 3.29Å; M28-T30 PolarHBondContact O-N 3.03Å; M28-Y31 PolarHBondContact O-N 3.48Å; M28-V32 WeakPolarHBondContact O-CB 3.26Å; M28-V32 VanDerWaalsContact O-CG2 3.31Å; M28-V32 WeakPolarHBondContact O-CG2 3.5Å; M28-V32 PolarHBondContact O-N 3.36Å
29	E	98.4	Very high	97.7	Very high	86 Å²	86	98.7 Å²	98.7	40%	0.402	48%	0.48	S	S	.	.	H	α-helix	trans	-55.2	-46	175.3	-75.3	170.8	-170.4	0	0	110.7	R25 K26 K33	R25-E29 HydrophobicContact CG-CG 4.31Å; R25-E29 VanDerWaalsContact CG-OE1 3.28Å; R25-E29 WeakPolarHBondContact CG-OE1 3.45Å; R25-E29 IonicContact CZ-OE1 3.87Å; R25-E29 IonicContact NH1-OE1 2.89Å; R25-E29 PolarHBondContact NH1-OE1 3.11Å; R25-E29 WeakPolarHBondContact O-CB 3.46Å; R25-E29 WeakPolarHBondContact O-CG 3.4Å; R25-E29 PolarHBondContact O-N 3.29Å; K26-E29 IonicContact NZ-OE2 3.52Å; K26-E29 PolarHBondContact NZ-OE2 3.28Å; E29-K33 WeakPolarHBondContact O-CB 3.26Å; E29-K33 PolarHBondContact O-N 3.41Å; E29-K33 VanDerWaalsContact O-N 3.1Å
30	T	98.4	Very high	97.9	Very high	81 Å²	81	98.6 Å²	98.6	50%	0.497	49%	0.485	S	S	.	.	H	α-helix	trans	-68.1	-45.7	179	-54.8	0	0	0	0	111.7	K26 W27 M28 V32 K33 E34	K26-T30 WeakPolarHBondContact O-CB 3.26Å; K26-T30 PolarHBondContact O-N 3.05Å; K26-T30 PolarHBondContact O-OG1 3.4Å; W27-T30 PolarHBondContact O-N 3.21Å; M28-T30 VanDerWaalsContact C-N 3.29Å; M28-T30 PolarHBondContact O-N 3.03Å; T30-V32 PolarHBondContact O-N 2.95Å; T30-K33 PolarHBondContact O-N 3.27Å; T30-E34 HydrophobicContact CG2-CG 4.5Å; T30-E34 PolarHBondContact O-N 3.01Å
31	Y	98.3	Very high	98	Very high	139 Å²	139	98.5 Å²	98.5	55%	0.545	48%	0.478	S	S	.	.	H	α-helix	trans	-59.1	-47	179.5	173.6	-97.4	0	0	0	111.9	W27 M28 S35	W27-Y31 HydrophobicContact CH2-CD2 4.45Å; W27-Y31 HydrophobicContact CH2-CG 4.4Å; W27-Y31 HydrophobicContact CZ2-CD2 4.46Å; W27-Y31 WeakPolarHBondContact O-CB 3.1Å; W27-Y31 PolarHBondContact O-N 2.88Å; M28-Y31 PolarHBondContact O-N 3.48Å; Y31-S35 WeakPolarHBondContact O-CB 3.47Å; Y31-S35 PolarHBondContact O-N 3.4Å; Y31-S35 PolarHBondContact O-OG 3.42Å
32	V	98.5	Very high	98.1	Very high	72 Å²	72	101.5 Å²	101.5	44%	0.436	49%	0.486	S	S	.	.	H	α-helix	trans	-62.7	-46.7	177.4	171.2	0	0	0	0	109.9	M28 T30 E34 S35 F36	M28-V32 WeakPolarHBondContact O-CB 3.26Å; M28-V32 VanDerWaalsContact O-CG2 3.31Å; M28-V32 WeakPolarHBondContact O-CG2 3.5Å; M28-V32 PolarHBondContact O-N 3.36Å; T30-V32 PolarHBondContact O-N 2.95Å; V32-E34 PolarHBondContact O-N 3.4Å; V32-S35 PolarHBondContact O-N 3.24Å; V32-F36 HydrophobicContact CG1-CD2 3.6Å; V32-F36 HydrophobicContact CG1-CE2 3.73Å; V32-F36 WeakPolarHBondContact O-CD2 3.4Å; V32-F36 PolarHBondContact O-N 2.96Å
33	K	98.4	Very high	98.2	Very high	144 Å²	144	101.9 Å²	101.9	63%	0.626	49%	0.491	S	S	*	.	H	α-helix	trans	-57.3	-50	179.5	-177	-177.5	177.3	-175.8	0	112.5	E29 T30 S35 F36 K37	E29-K33 WeakPolarHBondContact O-CB 3.26Å; E29-K33 PolarHBondContact O-N 3.41Å; E29-K33 VanDerWaalsContact O-N 3.1Å; T30-K33 PolarHBondContact O-N 3.27Å; K33-S35 VanDerWaalsContact C-N 3.34Å; K33-F36 PolarHBondContact O-N 3.42Å; K33-K37 WeakPolarHBondContact O-CB 3.46Å; K33-K37 PolarHBondContact O-N 3.26Å
34	E	98.1	Very high	98.3	Very high	90 Å²	90	101 Å²	101	42%	0.421	48%	0.484	S	S	.	.	H	α-helix	trans	-69.7	-34.4	-179.2	-66.7	-54.3	130.2	0	0	111.8	T30 V32 K37 G38	T30-E34 HydrophobicContact CG2-CG 4.5Å; T30-E34 PolarHBondContact O-N 3.01Å; V32-E34 PolarHBondContact O-N 3.4Å; E34-K37 PolarHBondContact O-N 3.37Å; E34-K37 IonicContact OE2-NZ 2.8Å; E34-G38 PolarHBondContact O-N 2.94Å
35	S	97.9	Very high	98.3	Very high	47 Å²	47	103.9 Å²	103.9	33%	0.329	49%	0.492	S	S	.	.	H	α-helix	trans	-64.6	-44	175.6	-64.2	0	0	0	0	112.3	Y31 V32 K33 S39	Y31-S35 WeakPolarHBondContact O-CB 3.47Å; Y31-S35 PolarHBondContact O-N 3.4Å; Y31-S35 PolarHBondContact O-OG 3.42Å; V32-S35 PolarHBondContact O-N 3.24Å; K33-S35 VanDerWaalsContact C-N 3.34Å; S35-S39 WeakPolarHBondContact O-CB 3.37Å; S35-S39 PolarHBondContact O-N 3.42Å; S35-S39 PolarHBondContact O-OG 3.47Å
36	F	98.1	Very high	98.3	Very high	132 Å²	132	105.4 Å²	105.4	58%	0.579	50%	0.502	S	S	*	.	H	α-helix	trans	-65.1	-42.8	173.8	-91.9	-79.4	0	0	0	111.8	V32 K33 G38 S39 N40	V32-F36 HydrophobicContact CG1-CD2 3.6Å; V32-F36 HydrophobicContact CG1-CE2 3.73Å; V32-F36 WeakPolarHBondContact O-CD2 3.4Å; V32-F36 PolarHBondContact O-N 2.96Å; K33-F36 PolarHBondContact O-N 3.42Å; F36-G38 PolarHBondContact O-N 3.47Å; F36-S39 PolarHBondContact O-N 3.13Å; F36-N40 WeakPolarHBondContact O-CB 3.33Å; F36-N40 PolarHBondContact O-N 2.97Å
37	K	98.2	Very high	98.3	Very high	105 Å²	105	104 Å²	104	46%	0.457	50%	0.503	S	S	.	.	H	α-helix	trans	-59.7	-48.1	177.4	-178.6	-177.1	171	-165.6	0	111.7	K33 E34 N40 Q41	K33-K37 WeakPolarHBondContact O-CB 3.46Å; K33-K37 PolarHBondContact O-N 3.26Å; E34-K37 PolarHBondContact O-N 3.37Å; E34-K37 IonicContact OE2-NZ 2.8Å; K37-N40 PolarHBondContact O-N 2.91Å; K37-Q41 WeakPolarHBondContact O-CG 3.46Å; K37-Q41 PolarHBondContact O-N 3.39Å
38	G	97.8	Very high	98.4	Very high	37 Å²	37	101.5 Å²	101.5	38%	0.381	50%	0.497	S	S	.	.	H	α-helix	trans	-62.2	-43.1	177.2	0	0	0	0	0	112.5	E34 F36 Q41 K42	E34-G38 PolarHBondContact O-N 2.94Å; F36-G38 PolarHBondContact O-N 3.47Å; G38-Q41 PolarHBondContact O-N 2.9Å; G38-K42 PolarHBondContact O-N 2.88Å
39	S	98.1	Very high	98.4	Very high	74 Å²	74	101.1 Å²	101.1	52%	0.517	50%	0.499	S	S	.	.	H	α-helix	trans	-63.6	-45	177.6	-59.1	0	0	0	0	112.1	S35 F36 Q41 K42 L43	S35-S39 WeakPolarHBondContact O-CB 3.37Å; S35-S39 PolarHBondContact O-N 3.42Å; S35-S39 PolarHBondContact O-OG 3.47Å; F36-S39 PolarHBondContact O-N 3.13Å; S39-Q41 PolarHBondContact O-N 3.29Å; S39-K42 PolarHBondContact O-N 3.23Å; S39-L43 PolarHBondContact O-N 2.9Å
40	N	98.4	Very high	98.4	Very high	97 Å²	97	100.9 Å²	100.9	52%	0.519	50%	0.5	S	S	.	.	H	α-helix	trans	-63.5	-42.2	177.6	-77.1	-2.5	0	0	0	111.9	F36 K37 K42 L43 E44	F36-N40 WeakPolarHBondContact O-CB 3.33Å; F36-N40 PolarHBondContact O-N 2.97Å; K37-N40 PolarHBondContact O-N 2.91Å; N40-K42 VanDerWaalsContact C-N 3.31Å; N40-K42 PolarHBondContact O-N 3.36Å; N40-L43 PolarHBondContact O-N 2.86Å; N40-E44 WeakPolarHBondContact O-CB 3.4Å; N40-E44 PolarHBondContact O-N 3.11Å
41	Q	98.4	Very high	98.4	Very high	89 Å²	89	103.5 Å²	103.5	42%	0.416	51%	0.507	S	S	.	.	H	α-helix	trans	-62.2	-38.5	175.5	-74.9	-179.8	-6	0	0	112.2	K37 G38 S39 R45	K37-Q41 WeakPolarHBondContact O-CG 3.46Å; K37-Q41 PolarHBondContact O-N 3.39Å; G38-Q41 PolarHBondContact O-N 2.9Å; S39-Q41 PolarHBondContact O-N 3.29Å; Q41-R45 WeakPolarHBondContact O-CB 3.48Å; Q41-R45 VanDerWaalsContact O-CG 3.28Å; Q41-R45 WeakPolarHBondContact O-CG 3.41Å; Q41-R45 PolarHBondContact O-N 3.1Å
42	K	98.4	Very high	98.4	Very high	166 Å²	166	104.5 Å²	104.5	72%	0.722	51%	0.51	S	S	*	.	H	α-helix	trans	-65.4	-44.1	176	-171.9	176.1	-179.5	-179.5	0	111.3	G38 S39 N40 R45 F46	G38-K42 PolarHBondContact O-N 2.88Å; S39-K42 PolarHBondContact O-N 3.23Å; N40-K42 VanDerWaalsContact C-N 3.31Å; N40-K42 PolarHBondContact O-N 3.36Å; K42-R45 PolarHBondContact O-N 3.41Å; K42-F46 WeakPolarHBondContact O-CB 3.38Å; K42-F46 PolarHBondContact O-N 2.88Å
43	L	98.6	Very high	98.4	Very high	103 Å²	103	105.3 Å²	105.3	54%	0.539	51%	0.509	S	S	.	.	H	α-helix	trans	-62.5	-46.3	176.7	-178.1	61.3	0	0	0	111.4	S39 N40 R45 F46 C47	S39-L43 PolarHBondContact O-N 2.9Å; N40-L43 PolarHBondContact O-N 2.86Å; L43-R45 PolarHBondContact O-N 3.4Å; L43-F46 WeakPolarHBondContact O-CB 3.37Å; L43-F46 PolarHBondContact O-N 2.84Å; L43-F46 VanDerWaalsContact O-N 3.16Å; L43-C47 PolarHBondContact O-N 3.39Å; L43-C47 PolarHBondContact O-SG 2.92Å; L43-C47 VanDerWaalsContact O-SG 3.35Å
44	E	98.6	Very high	98.4	Very high	99 Å²	99	107.1 Å²	107.1	46%	0.463	51%	0.512	S	S	.	.	H	α-helix	trans	-60.2	-45.4	178.6	-171.2	-170.6	169.1	0	0	111.7	N40 F46 C47 K48	N40-E44 WeakPolarHBondContact O-CB 3.4Å; N40-E44 PolarHBondContact O-N 3.11Å; E44-F46 VanDerWaalsContact C-N 3.33Å; E44-F46 PolarHBondContact O-N 3.2Å; E44-C47 PolarHBondContact O-N 3.23Å; E44-K48 HydrophobicContact CG-CD 4.21Å; E44-K48 WeakPolarHBondContact O-CB 3.45Å; E44-K48 WeakPolarHBondContact O-CG 3.36Å; E44-K48 PolarHBondContact O-N 3.29Å; E44-K48 WeakPolarHBondContact OE1-CE 3.36Å; E44-K48 IonicContact OE1-NZ 2.63Å; E44-K48 PolarHBondContact OE1-NZ 3.45Å
45	R	98.6	Very high	98.5	Very high	179 Å²	179	109.3 Å²	109.3	68%	0.675	52%	0.52	S	S	*	.	H	α-helix	trans	-60.2	-43.5	175	-74.1	178.5	-171.5	-154.7	4.2	111.6	Q41 K42 L43 K48 T49	Q41-R45 WeakPolarHBondContact O-CB 3.48Å; Q41-R45 VanDerWaalsContact O-CG 3.28Å; Q41-R45 WeakPolarHBondContact O-CG 3.41Å; Q41-R45 PolarHBondContact O-N 3.1Å; K42-R45 PolarHBondContact O-N 3.41Å; L43-R45 PolarHBondContact O-N 3.4Å; R45-K48 PolarHBondContact O-N 3.04Å; R45-T49 WeakPolarHBondContact O-CB 3.44Å; R45-T49 PolarHBondContact O-N 3.03Å; R45-T49 PolarHBondContact O-OG1 3.2Å; R45-T49 VanDerWaalsContact O-OG1 3.06Å
46	F	98.6	Very high	98.5	Very high	138 Å²	138	110 Å²	110	61%	0.605	52%	0.52	S	S	*	.	H	α-helix	trans	-61	-49	177.1	176.7	-97	0	0	0	111.5	K42 L43 E44 K48 T49 N50	K42-F46 WeakPolarHBondContact O-CB 3.38Å; K42-F46 PolarHBondContact O-N 2.88Å; L43-F46 WeakPolarHBondContact O-CB 3.37Å; L43-F46 PolarHBondContact O-N 2.84Å; L43-F46 VanDerWaalsContact O-N 3.16Å; E44-F46 VanDerWaalsContact C-N 3.33Å; E44-F46 PolarHBondContact O-N 3.2Å; F46-K48 PolarHBondContact O-N 2.91Å; F46-T49 PolarHBondContact O-N 3.27Å; F46-N50 WeakPolarHBondContact O-CB 3.43Å; F46-N50 PolarHBondContact O-N 2.85Å
47	C	98.6	Very high	98.5	Very high	66 Å²	66	109 Å²	109	45%	0.446	52%	0.52	S	S	.	.	H	α-helix	trans	-59	-47	177.9	-69.8	0	0	0	0	112	L43 E44 T49 N50 E51	L43-C47 PolarHBondContact O-N 3.39Å; L43-C47 PolarHBondContact O-SG 2.92Å; L43-C47 VanDerWaalsContact O-SG 3.35Å; E44-C47 PolarHBondContact O-N 3.23Å; C47-T49 PolarHBondContact O-N 3.09Å; C47-N50 PolarHBondContact O-N 3.06Å; C47-E51 WeakPolarHBondContact O-CB 3.42Å; C47-E51 PolarHBondContact O-N 3.34Å
48	K	98.7	Very high	98.5	Very high	113 Å²	113	108.4 Å²	108.4	49%	0.491	52%	0.521	S	S	.	.	H	α-helix	trans	-62.3	-42.2	178.3	-76.6	176.4	170.7	173	0	112.6	E44 R45 F46 R52	E44-K48 HydrophobicContact CG-CD 4.21Å; E44-K48 WeakPolarHBondContact O-CB 3.45Å; E44-K48 WeakPolarHBondContact O-CG 3.36Å; E44-K48 PolarHBondContact O-N 3.29Å; E44-K48 WeakPolarHBondContact OE1-CE 3.36Å; E44-K48 IonicContact OE1-NZ 2.63Å; E44-K48 PolarHBondContact OE1-NZ 3.45Å; R45-K48 PolarHBondContact O-N 3.04Å; F46-K48 PolarHBondContact O-N 2.91Å; K48-R52 WeakPolarHBondContact O-CB 3.37Å; K48-R52 PolarHBondContact O-N 3.36Å
49	T	98.7	Very high	98.5	Very high	67 Å²	67	110 Å²	110	41%	0.411	52%	0.521	S	S	.	.	H	α-helix	trans	-64.6	-46.4	175.9	-64	0	0	0	0	110.6	R45 F46 C47 E51 R52 E53	R45-T49 WeakPolarHBondContact O-CB 3.44Å; R45-T49 PolarHBondContact O-N 3.03Å; R45-T49 PolarHBondContact O-OG1 3.2Å; R45-T49 VanDerWaalsContact O-OG1 3.06Å; F46-T49 PolarHBondContact O-N 3.27Å; C47-T49 PolarHBondContact O-N 3.09Å; T49-E51 PolarHBondContact O-N 2.88Å; T49-R52 PolarHBondContact O-N 3.43Å; T49-E53 WeakPolarHBondContact O-CG 3.39Å; T49-E53 PolarHBondContact O-N 3.22Å
50	N	98.6	Very high	98.5	Very high	80 Å²	80	112 Å²	112	43%	0.428	52%	0.52	S	S	.	.	H	α-helix	trans	-60.5	-43.5	178.2	179.5	73	0	0	0	112.3	F46 C47 E53 R54	F46-N50 WeakPolarHBondContact O-CB 3.43Å; F46-N50 PolarHBondContact O-N 2.85Å; C47-N50 PolarHBondContact O-N 3.06Å; N50-E53 PolarHBondContact O-N 3.21Å; N50-R54 WeakPolarHBondContact O-CG 3.47Å; N50-R54 PolarHBondContact O-N 2.8Å
51	E	98.7	Very high	98.5	Very high	137 Å²	137	112.4 Å²	112.4	64%	0.64	52%	0.518	S	S	*	.	H	α-helix	trans	-61	-44.7	175.5	-173.7	-176.3	174.7	0	0	111.8	C47 T49 R54 K55	C47-E51 WeakPolarHBondContact O-CB 3.42Å; C47-E51 PolarHBondContact O-N 3.34Å; T49-E51 PolarHBondContact O-N 2.88Å; E51-R54 PolarHBondContact O-N 3.29Å; E51-K55 PolarHBondContact O-N 3.33Å
52	R	98.7	Very high	98.5	Very high	159 Å²	159	110.6 Å²	110.6	60%	0.6	51%	0.514	S	S	*	.	H	α-helix	trans	-60.7	-46.6	177.3	-172.5	-169.6	-59.6	140.6	1.3	111.9	K48 T49 K55 N56	K48-R52 WeakPolarHBondContact O-CB 3.37Å; K48-R52 PolarHBondContact O-N 3.36Å; T49-R52 PolarHBondContact O-N 3.43Å; R52-K55 PolarHBondContact O-N 2.96Å; R52-N56 WeakPolarHBondContact O-CB 3.39Å; R52-N56 PolarHBondContact O-N 3.37Å
53	E	98.7	Very high	98.5	Very high	90 Å²	90	108.5 Å²	108.5	42%	0.421	51%	0.507	S	S	.	.	H	α-helix	trans	-63.7	-42.3	179.2	-69.6	-50.9	138.1	0	0	111.6	T49 N50 K55 N56 I57	T49-E53 WeakPolarHBondContact O-CG 3.39Å; T49-E53 PolarHBondContact O-N 3.22Å; N50-E53 PolarHBondContact O-N 3.21Å; E53-K55 VanDerWaalsContact C-N 3.33Å; E53-K55 PolarHBondContact O-N 3.28Å; E53-N56 WeakPolarHBondContact O-CB 3.33Å; E53-N56 PolarHBondContact O-N 2.88Å; E53-I57 WeakPolarHBondContact O-CG1 3.32Å; E53-I57 PolarHBondContact O-N 3.45Å
54	R	98.6	Very high	98.4	Very high	181 Å²	181	109.4 Å²	109.4	68%	0.683	51%	0.509	S	S	*	.	H	α-helix	trans	-59.9	-43.7	174.6	-72.8	-175.7	72.2	154.6	3.8	111.9	N50 E51 I57 N58	N50-R54 WeakPolarHBondContact O-CG 3.47Å; N50-R54 PolarHBondContact O-N 2.8Å; E51-R54 PolarHBondContact O-N 3.29Å; R54-I57 PolarHBondContact O-N 3.4Å; R54-N58 WeakPolarHBondContact O-CB 3.37Å; R54-N58 PolarHBondContact O-N 3.02Å
55	K	98.6	Very high	98.4	Very high	137 Å²	137	110.1 Å²	110.1	60%	0.596	51%	0.508	S	S	*	.	H	α-helix	trans	-64.1	-41.2	176.6	-171.8	174.7	-178.7	176.8	0	111.8	E51 R52 E53 N58 N59	E51-K55 PolarHBondContact O-N 3.33Å; R52-K55 PolarHBondContact O-N 2.96Å; E53-K55 VanDerWaalsContact C-N 3.33Å; E53-K55 PolarHBondContact O-N 3.28Å; K55-N58 PolarHBondContact O-N 3.42Å; K55-N59 WeakPolarHBondContact O-CB 3.45Å; K55-N59 PolarHBondContact O-N 3.23Å; K55-N59 PolarHBondContact O-OD1 3.04Å
56	N	98.5	Very high	98.4	Very high	61 Å²	61	105.8 Å²	105.8	33%	0.326	50%	0.497	S	S	.	.	H	α-helix	trans	-61	-47.8	177.4	-177	35.7	0	0	0	111.8	R52 E53 N59 K60	R52-N56 WeakPolarHBondContact O-CB 3.39Å; R52-N56 PolarHBondContact O-N 3.37Å; E53-N56 WeakPolarHBondContact O-CB 3.33Å; E53-N56 PolarHBondContact O-N 2.88Å; N56-N59 PolarHBondContact O-N 2.88Å; N56-K60 WeakPolarHBondContact O-CG 3.44Å; N56-K60 PolarHBondContact O-N 3.41Å; N56-K60 WeakPolarHBondContact OD1-CE 3.35Å
57	I	98.3	Very high	98.4	Very high	112 Å²	112	103.5 Å²	103.5	57%	0.574	49%	0.494	S	S	*	.	H	α-helix	trans	-61.3	-47.2	176.8	-66.9	165.2	0	0	0	110.4	E53 R54 N59 K60 F61	E53-I57 WeakPolarHBondContact O-CG1 3.32Å; E53-I57 PolarHBondContact O-N 3.45Å; R54-I57 PolarHBondContact O-N 3.4Å; I57-N59 PolarHBondContact O-N 3.38Å; I57-K60 PolarHBondContact O-N 3.02Å; I57-F61 WeakPolarHBondContact O-CB 3.44Å; I57-F61 PolarHBondContact O-N 2.95Å
58	N	98.4	Very high	98.3	Very high	92 Å²	92	104.9 Å²	104.9	49%	0.492	50%	0.501	S	S	.	.	H	α-helix	trans	-60.1	-45.7	179	-173.4	79.5	0	0	0	111.8	R54 K55 F61 C62	R54-N58 WeakPolarHBondContact O-CB 3.37Å; R54-N58 PolarHBondContact O-N 3.02Å; K55-N58 PolarHBondContact O-N 3.42Å; N58-F61 PolarHBondContact O-N 3.4Å; N58-C62 WeakPolarHBondContact O-CB 3.33Å; N58-C62 PolarHBondContact O-N 3.35Å; N58-C62 PolarHBondContact O-SG 2.88Å
59	N	98.4	Very high	98.3	Very high	70 Å²	70	105.4 Å²	105.4	37%	0.374	50%	0.504	S	S	.	.	H	α-helix	trans	-62.1	-47.4	179.5	-73.6	1.4	0	0	0	111.9	K55 N56 I57 F61 C62 E63	K55-N59 WeakPolarHBondContact O-CB 3.45Å; K55-N59 PolarHBondContact O-N 3.23Å; K55-N59 PolarHBondContact O-OD1 3.04Å; N56-N59 PolarHBondContact O-N 2.88Å; I57-N59 PolarHBondContact O-N 3.38Å; N59-F61 VanDerWaalsContact C-N 3.27Å; N59-F61 PolarHBondContact O-N 3Å; N59-C62 PolarHBondContact O-N 3.36Å; N59-E63 WeakPolarHBondContact O-CG 3.36Å; N59-E63 PolarHBondContact O-N 3.49Å
60	K	98.1	Very high	98.3	Very high	115 Å²	115	107.7 Å²	107.7	50%	0.5	51%	0.51	S	S	.	.	H	α-helix	trans	-58.2	-41.2	176.6	-73.4	176.4	177.8	-179.4	0	112	N56 I57 Q64	N56-K60 WeakPolarHBondContact O-CG 3.44Å; N56-K60 PolarHBondContact O-N 3.41Å; N56-K60 WeakPolarHBondContact OD1-CE 3.35Å; I57-K60 PolarHBondContact O-N 3.02Å; K60-Q64 WeakPolarHBondContact O-CG 3.43Å; K60-Q64 PolarHBondContact O-N 3.04Å
61	F	97.4	Very high	98.3	Very high	106 Å²	106	110.3 Å²	110.3	47%	0.465	52%	0.517	S	S	.	.	H	α-helix	trans	-66.9	-45.9	177	-170.6	-100.2	0	0	0	111.5	I57 N58 N59 E63 Q64 Y65	I57-F61 WeakPolarHBondContact O-CB 3.44Å; I57-F61 PolarHBondContact O-N 2.95Å; N58-F61 PolarHBondContact O-N 3.4Å; N59-F61 VanDerWaalsContact C-N 3.27Å; N59-F61 PolarHBondContact O-N 3Å; F61-E63 VanDerWaalsContact C-N 3.33Å; F61-E63 PolarHBondContact O-N 2.88Å; F61-Q64 WeakPolarHBondContact O-CB 3.47Å; F61-Q64 PolarHBondContact O-N 3.48Å; F61-Y65 AromaticContact CD1-CD2 3.86Å; F61-Y65 HydrophobicContact CD1-CD2 3.86Å; F61-Y65 AromaticContact CD1-CE2 3.8Å; F61-Y65 HydrophobicContact CD1-CE2 3.8Å; F61-Y65 HydrophobicContact CD2-CD2 4.48Å; F61-Y65 HydrophobicContact CD2-CE2 4.06Å; F61-Y65 AromaticContact CE1-CD2 3.67Å; F61-Y65 HydrophobicContact CE1-CD2 3.67Å; F61-Y65 AromaticContact CE1-CE2 3.18Å; F61-Y65 HydrophobicContact CE1-CE2 3.18Å; F61-Y65 AromaticContact CE1-CZ 3.69Å; F61-Y65 HydrophobicContact CE2-CD2 4.32Å; F61-Y65 AromaticContact CE2-CE2 3.49Å; F61-Y65 HydrophobicContact CE2-CE2 3.49Å; F61-Y65 VanDerWaalsContact CE2-CE2 3.49Å; F61-Y65 HydrophobicContact CG-CD2 4.3Å; F61-Y65 HydrophobicContact CG-CE2 4.23Å; F61-Y65 AromaticContact CZ-CD2 3.96Å; F61-Y65 HydrophobicContact CZ-CD2 3.96Å; F61-Y65 AromaticContact CZ-CE2 3.04Å; F61-Y65 HydrophobicContact CZ-CE2 3.04Å; F61-Y65 AromaticContact CZ-CZ 3.49Å; F61-Y65 VanDerWaalsContact CZ-CZ 3.49Å; F61-Y65 WeakPolarHBondContact CZ-OH 3.36Å; F61-Y65 WeakPolarHBondContact O-CD2 3.35Å; F61-Y65 PolarHBondContact O-N 2.95Å; F61-Y65 VanDerWaalsContact O-N 3.09Å
62	C	98.2	Very high	98.3	Very high	52 Å²	52	106.4 Å²	106.4	35%	0.351	51%	0.505	S	S	.	.	H	α-helix	trans	-59.2	-42.4	175.7	-71	0	0	0	0	112.4	N58 N59 Q64 Y65 I66	N58-C62 WeakPolarHBondContact O-CB 3.33Å; N58-C62 PolarHBondContact O-N 3.35Å; N58-C62 PolarHBondContact O-SG 2.88Å; N59-C62 PolarHBondContact O-N 3.36Å; C62-Q64 VanDerWaalsContact C-N 3.32Å; C62-Q64 PolarHBondContact O-N 3.46Å; C62-Y65 PolarHBondContact O-N 3.42Å; C62-I66 VanDerWaalsContact O-CG1 3.26Å; C62-I66 WeakPolarHBondContact O-CG1 3.28Å; C62-I66 PolarHBondContact O-N 3.42Å
63	E	98.2	Very high	98.3	Very high	121 Å²	121	103.5 Å²	103.5	57%	0.565	50%	0.502	S	S	*	.	H	α-helix	trans	-59	-42.3	176.5	-76.1	170.5	-171	0	0	112.2	N59 F61 T67	N59-E63 WeakPolarHBondContact O-CG 3.36Å; N59-E63 PolarHBondContact O-N 3.49Å; F61-E63 VanDerWaalsContact C-N 3.33Å; F61-E63 PolarHBondContact O-N 2.88Å; E63-T67 WeakPolarHBondContact O-CB 3.46Å; E63-T67 PolarHBondContact O-N 3.28Å; E63-T67 PolarHBondContact O-OG1 3.43Å
64	Q	98.1	Very high	98.3	Very high	123 Å²	123	105.2 Å²	105.2	58%	0.575	51%	0.511	S	S	*	.	H	α-helix	trans	-61.3	-47.7	175	-71.7	176.7	-4.1	0	0	111.4	K60 F61 C62 T67 T68	K60-Q64 WeakPolarHBondContact O-CG 3.43Å; K60-Q64 PolarHBondContact O-N 3.04Å; F61-Q64 WeakPolarHBondContact O-CB 3.47Å; F61-Q64 PolarHBondContact O-N 3.48Å; C62-Q64 VanDerWaalsContact C-N 3.32Å; C62-Q64 PolarHBondContact O-N 3.46Å; Q64-T67 PolarHBondContact O-N 2.93Å; Q64-T68 PolarHBondContact O-N 3.48Å; Q64-T68 PolarHBondContact O-OG1 3.3Å; Q64-T68 VanDerWaalsContact O-OG1 3.06Å
65	Y	97.6	Very high	98.3	Very high	113 Å²	113	100.7 Å²	100.7	44%	0.443	50%	0.5	S	S	.	.	H	α-helix	trans	-62.9	-45.3	179.3	-88.3	-105.2	0	0	0	112.3	F61 C62 T67 T68 F69	F61-Y65 AromaticContact CD1-CD2 3.86Å; F61-Y65 HydrophobicContact CD1-CD2 3.86Å; F61-Y65 AromaticContact CD1-CE2 3.8Å; F61-Y65 HydrophobicContact CD1-CE2 3.8Å; F61-Y65 HydrophobicContact CD2-CD2 4.48Å; F61-Y65 HydrophobicContact CD2-CE2 4.06Å; F61-Y65 AromaticContact CE1-CD2 3.67Å; F61-Y65 HydrophobicContact CE1-CD2 3.67Å; F61-Y65 AromaticContact CE1-CE2 3.18Å; F61-Y65 HydrophobicContact CE1-CE2 3.18Å; F61-Y65 AromaticContact CE1-CZ 3.69Å; F61-Y65 HydrophobicContact CE2-CD2 4.32Å; F61-Y65 AromaticContact CE2-CE2 3.49Å; F61-Y65 HydrophobicContact CE2-CE2 3.49Å; F61-Y65 VanDerWaalsContact CE2-CE2 3.49Å; F61-Y65 HydrophobicContact CG-CD2 4.3Å; F61-Y65 HydrophobicContact CG-CE2 4.23Å; F61-Y65 AromaticContact CZ-CD2 3.96Å; F61-Y65 HydrophobicContact CZ-CD2 3.96Å; F61-Y65 AromaticContact CZ-CE2 3.04Å; F61-Y65 HydrophobicContact CZ-CE2 3.04Å; F61-Y65 AromaticContact CZ-CZ 3.49Å; F61-Y65 VanDerWaalsContact CZ-CZ 3.49Å; F61-Y65 WeakPolarHBondContact CZ-OH 3.36Å; F61-Y65 WeakPolarHBondContact O-CD2 3.35Å; F61-Y65 PolarHBondContact O-N 2.95Å; F61-Y65 VanDerWaalsContact O-N 3.09Å; C62-Y65 PolarHBondContact O-N 3.42Å; Y65-T67 VanDerWaalsContact C-N 3.28Å; Y65-T67 PolarHBondContact O-N 3.22Å; Y65-T68 PolarHBondContact O-N 2.9Å; Y65-F69 HydrophobicContact CD1-CD2 4.48Å; Y65-F69 AromaticContact CD1-CE2 3.65Å; Y65-F69 HydrophobicContact CD1-CE2 3.65Å; Y65-F69 HydrophobicContact CD1-CZ 4.14Å; Y65-F69 HydrophobicContact CG-CE2 4.41Å; Y65-F69 WeakPolarHBondContact O-CB 3.4Å; Y65-F69 WeakPolarHBondContact O-CD2 3.28Å; Y65-F69 PolarHBondContact O-N 2.63Å
66	I	98.3	Very high	98.3	Very high	89 Å²	89	97.8 Å²	97.8	46%	0.456	49%	0.494	S	S	.	.	H	α-helix	trans	-56.9	-47.5	177.1	-70.5	164.3	0	0	0	109.7	C62 T68 F69 Q70	C62-I66 VanDerWaalsContact O-CG1 3.26Å; C62-I66 WeakPolarHBondContact O-CG1 3.28Å; C62-I66 PolarHBondContact O-N 3.42Å; I66-T68 PolarHBondContact O-N 2.85Å; I66-F69 PolarHBondContact O-N 3Å; I66-Q70 HydrophobicContact CG2-CG 4.37Å; I66-Q70 WeakPolarHBondContact O-CB 3.34Å; I66-Q70 VanDerWaalsContact O-CG 3.26Å; I66-Q70 WeakPolarHBondContact O-CG 3.35Å; I66-Q70 PolarHBondContact O-N 3.06Å
67	T	98.3	Very high	98.3	Very high	89 Å²	89	100.8 Å²	100.8	55%	0.546	51%	0.506	S	S	.	.	H	α-helix	trans	-61.7	-43.9	179	-54.7	0	0	0	0	111.5	E63 Q64 Y65 K71	E63-T67 WeakPolarHBondContact O-CB 3.46Å; E63-T67 PolarHBondContact O-N 3.28Å; E63-T67 PolarHBondContact O-OG1 3.43Å; Q64-T67 PolarHBondContact O-N 2.93Å; Y65-T67 VanDerWaalsContact C-N 3.28Å; Y65-T67 PolarHBondContact O-N 3.22Å; T67-K71 WeakPolarHBondContact O-CB 3.47Å; T67-K71 PolarHBondContact O-N 2.97Å
68	T	98.4	Very high	98.3	Very high	96 Å²	96	101.1 Å²	101.1	59%	0.589	50%	0.503	S	S	*	.	H	α-helix	trans	-64.6	-43.8	178.3	-59.9	0	0	0	0	112	Q64 Y65 I66 K71 S72	Q64-T68 PolarHBondContact O-N 3.48Å; Q64-T68 PolarHBondContact O-OG1 3.3Å; Q64-T68 VanDerWaalsContact O-OG1 3.06Å; Y65-T68 PolarHBondContact O-N 2.9Å; I66-T68 PolarHBondContact O-N 2.85Å; T68-K71 PolarHBondContact O-N 3.46Å; T68-S72 WeakPolarHBondContact O-CB 3.49Å; T68-S72 PolarHBondContact O-N 3.16Å
69	F	98.4	Very high	98.4	Very high	123 Å²	123	102.9 Å²	102.9	54%	0.539	51%	0.507	S	S	.	.	H	α-helix	trans	-67.4	-43	178.7	-74.2	-56.2	0	0	0	112.1	Y65 I66 K71 S72 D73	Y65-F69 HydrophobicContact CD1-CD2 4.48Å; Y65-F69 AromaticContact CD1-CE2 3.65Å; Y65-F69 HydrophobicContact CD1-CE2 3.65Å; Y65-F69 HydrophobicContact CD1-CZ 4.14Å; Y65-F69 HydrophobicContact CG-CE2 4.41Å; Y65-F69 WeakPolarHBondContact O-CB 3.4Å; Y65-F69 WeakPolarHBondContact O-CD2 3.28Å; Y65-F69 PolarHBondContact O-N 2.63Å; I66-F69 PolarHBondContact O-N 3Å; F69-K71 VanDerWaalsContact C-N 3.29Å; F69-K71 PolarHBondContact O-N 3.44Å; F69-S72 WeakPolarHBondContact O-CB 3.35Å; F69-S72 PolarHBondContact O-N 3.02Å; F69-S72 VanDerWaalsContact O-N 3.11Å; F69-D73 PolarHBondContact O-N 3.47Å
70	Q	98.5	Very high	98.4	Very high	115 Å²	115	103.4 Å²	103.4	54%	0.537	51%	0.51	S	S	.	.	H	α-helix	trans	-58	-43.5	174.6	-75	174.7	-19.5	0	0	111.7	I66 D73 M74	I66-Q70 HydrophobicContact CG2-CG 4.37Å; I66-Q70 WeakPolarHBondContact O-CB 3.34Å; I66-Q70 VanDerWaalsContact O-CG 3.26Å; I66-Q70 WeakPolarHBondContact O-CG 3.35Å; I66-Q70 PolarHBondContact O-N 3.06Å; Q70-D73 PolarHBondContact O-N 3.33Å; Q70-M74 WeakPolarHBondContact O-CG 3.21Å; Q70-M74 PolarHBondContact O-N 3.45Å; Q70-M74 VanDerWaalsContact O-N 3.1Å
71	K	98.5	Very high	98.4	Very high	135 Å²	135	103.1 Å²	103.1	59%	0.587	51%	0.51	S	S	*	.	H	α-helix	trans	-63.2	-44.7	174.9	-176.3	178.6	176.7	-176.9	0	111.7	T67 T68 F69 D73 M74 D75	T67-K71 WeakPolarHBondContact O-CB 3.47Å; T67-K71 PolarHBondContact O-N 2.97Å; T68-K71 PolarHBondContact O-N 3.46Å; F69-K71 VanDerWaalsContact C-N 3.29Å; F69-K71 PolarHBondContact O-N 3.44Å; K71-D73 VanDerWaalsContact C-N 3.3Å; K71-D73 PolarHBondContact O-N 2.96Å; K71-M74 WeakPolarHBondContact O-CB 3.31Å; K71-M74 PolarHBondContact O-N 3.27Å; K71-D75 VanDerWaalsContact O-CG 3.29Å; K71-D75 PolarHBondContact O-N 2.91Å
72	S	98.6	Very high	98.4	Very high	55 Å²	55	102.8 Å²	102.8	39%	0.385	51%	0.51	S	S	.	.	H	α-helix	trans	-58.9	-42.3	177.3	-173.6	0	0	0	0	111.9	T68 F69 D75 V76	T68-S72 WeakPolarHBondContact O-CB 3.49Å; T68-S72 PolarHBondContact O-N 3.16Å; F69-S72 WeakPolarHBondContact O-CB 3.35Å; F69-S72 PolarHBondContact O-N 3.02Å; F69-S72 VanDerWaalsContact O-N 3.11Å; S72-D75 PolarHBondContact O-N 3.5Å; S72-V76 WeakPolarHBondContact O-CG2 3.47Å; S72-V76 PolarHBondContact O-N 2.9Å
73	D	98.7	Very high	98.5	Very high	99 Å²	99	106 Å²	106	53%	0.529	52%	0.518	S	S	.	.	H	α-helix	trans	-64	-42.1	178	-71	-21.3	0	0	0	111.3	F69 Q70 K71 V76 Q77	F69-D73 PolarHBondContact O-N 3.47Å; Q70-D73 PolarHBondContact O-N 3.33Å; K71-D73 VanDerWaalsContact C-N 3.3Å; K71-D73 PolarHBondContact O-N 2.96Å; D73-V76 PolarHBondContact O-N 2.98Å; D73-Q77 WeakPolarHBondContact O-CG 3.32Å; D73-Q77 PolarHBondContact O-N 2.86Å
74	M	98.6	Very high	98.5	Very high	125 Å²	125	106.1 Å²	106.1	62%	0.616	52%	0.519	S	S	*	.	H	α-helix	trans	-62.7	-42.8	173.8	-70.3	178.3	61.8	0	0	112.2	Q70 K71 V76 Q77 K78	Q70-M74 WeakPolarHBondContact O-CG 3.21Å; Q70-M74 PolarHBondContact O-N 3.45Å; Q70-M74 VanDerWaalsContact O-N 3.1Å; K71-M74 WeakPolarHBondContact O-CB 3.31Å; K71-M74 PolarHBondContact O-N 3.27Å; M74-V76 VanDerWaalsContact C-N 3.31Å; M74-V76 PolarHBondContact O-N 3.36Å; M74-Q77 PolarHBondContact O-N 3.33Å; M74-K78 WeakPolarHBondContact O-CB 3.48Å; M74-K78 PolarHBondContact O-N 3.22Å
75	D	98.7	Very high	98.5	Very high	86 Å²	86	106.8 Å²	106.8	46%	0.46	52%	0.52	S	S	.	.	H	α-helix	trans	-63.8	-39.1	178.8	-71.1	-23.1	0	0	0	110.8	K71 S72 K78 F79	K71-D75 VanDerWaalsContact O-CG 3.29Å; K71-D75 PolarHBondContact O-N 2.91Å; S72-D75 PolarHBondContact O-N 3.5Å; D75-K78 PolarHBondContact O-N 3.42Å; D75-F79 WeakPolarHBondContact O-CB 3.15Å; D75-F79 PolarHBondContact O-N 3Å
76	V	98.8	Very high	98.5	Very high	77 Å²	77	105.1 Å²	105.1	47%	0.467	53%	0.525	S	S	.	.	H	α-helix	trans	-64.7	-43.4	173.7	169.3	0	0	0	0	111.7	S72 D73 M74 F79 N80	S72-V76 WeakPolarHBondContact O-CG2 3.47Å; S72-V76 PolarHBondContact O-N 2.9Å; D73-V76 PolarHBondContact O-N 2.98Å; M74-V76 VanDerWaalsContact C-N 3.31Å; M74-V76 PolarHBondContact O-N 3.36Å; V76-F79 PolarHBondContact O-N 3.49Å; V76-N80 PolarHBondContact O-N 2.85Å; V76-N80 PolarHBondContact O-ND2 3.06Å
77	Q	98.6	Very high	98.5	Very high	124 Å²	124	104 Å²	104	58%	0.579	52%	0.521	S	S	*	.	H	α-helix	trans	-59.9	-49.2	175.7	-75	177.8	-8.1	0	0	111.1	D73 M74 F79 N80 E81	D73-Q77 WeakPolarHBondContact O-CG 3.32Å; D73-Q77 PolarHBondContact O-N 2.86Å; M74-Q77 PolarHBondContact O-N 3.33Å; Q77-F79 VanDerWaalsContact C-N 3.35Å; Q77-F79 PolarHBondContact O-N 3.48Å; Q77-N80 WeakPolarHBondContact O-CB 3.3Å; Q77-N80 PolarHBondContact O-N 3.04Å; Q77-N80 VanDerWaalsContact O-N 3.13Å; Q77-E81 PolarHBondContact O-N 2.8Å
78	K	98.7	Very high	98.5	Very high	118 Å²	118	103 Å²	103	51%	0.513	51%	0.513	S	S	.	.	H	α-helix	trans	-60.9	-43.2	178.7	-172.8	-179	176.4	-170.6	0	112.1	M74 D75 N80 E81 E82	M74-K78 WeakPolarHBondContact O-CB 3.48Å; M74-K78 PolarHBondContact O-N 3.22Å; D75-K78 PolarHBondContact O-N 3.42Å; K78-N80 VanDerWaalsContact C-N 3.29Å; K78-N80 PolarHBondContact O-N 3.16Å; K78-E81 PolarHBondContact O-N 2.97Å; K78-E82 VanDerWaalsContact CE-OE1 3.26Å; K78-E82 WeakPolarHBondContact CE-OE1 3.32Å; K78-E82 PolarHBondContact O-N 2.85Å
79	F	98.6	Very high	98.5	Very high	130 Å²	130	101.2 Å²	101.2	57%	0.57	51%	0.505	S	S	*	.	H	α-helix	trans	-58.4	-42.3	175.2	173.5	-97.3	0	0	0	111.7	D75 V76 Q77 E82 K83	D75-F79 WeakPolarHBondContact O-CB 3.15Å; D75-F79 PolarHBondContact O-N 3Å; V76-F79 PolarHBondContact O-N 3.49Å; Q77-F79 VanDerWaalsContact C-N 3.35Å; Q77-F79 PolarHBondContact O-N 3.48Å; F79-E82 PolarHBondContact O-N 3.44Å; F79-K83 HydrophobicContact CE1-CD 4.4Å; F79-K83 VanDerWaalsContact O-CB 3.29Å; F79-K83 WeakPolarHBondContact O-CB 3.42Å; F79-K83 PolarHBondContact O-N 3.03Å
80	N	98.6	Very high	98.5	Very high	81 Å²	81	99 Å²	99	43%	0.433	50%	0.503	S	S	.	.	H	α-helix	trans	-66	-40.2	178.7	-73.5	-32.6	0	0	0	112.3	V76 Q77 K78 K83 E84	V76-N80 PolarHBondContact O-N 2.85Å; V76-N80 PolarHBondContact O-ND2 3.06Å; Q77-N80 WeakPolarHBondContact O-CB 3.3Å; Q77-N80 PolarHBondContact O-N 3.04Å; Q77-N80 VanDerWaalsContact O-N 3.13Å; K78-N80 VanDerWaalsContact C-N 3.29Å; K78-N80 PolarHBondContact O-N 3.16Å; N80-K83 PolarHBondContact O-N 3.1Å; N80-E84 PolarHBondContact O-N 3.26Å
81	E	98.6	Very high	98.5	Very high	109 Å²	109	98.3 Å²	98.3	51%	0.509	50%	0.5	S	S	.	.	H	α-helix	trans	-62.2	-44	174.6	-69.2	178.8	-168.7	0	0	112.2	Q77 K78 E84 K85	Q77-E81 PolarHBondContact O-N 2.8Å; K78-E81 PolarHBondContact O-N 2.97Å; E81-E84 PolarHBondContact O-N 3.2Å; E81-K85 WeakPolarHBondContact O-CG 3.45Å; E81-K85 PolarHBondContact O-N 3.4Å; E81-K85 VanDerWaalsContact O-N 3.11Å
82	E	98.6	Very high	98.5	Very high	98 Å²	98	99.1 Å²	99.1	46%	0.458	50%	0.504	S	S	.	.	H	α-helix	trans	-64.6	-43.6	177.2	-73.1	-179.5	-176	0	0	111.1	K78 F79 E84 K85 S86	K78-E82 VanDerWaalsContact CE-OE1 3.26Å; K78-E82 WeakPolarHBondContact CE-OE1 3.32Å; K78-E82 PolarHBondContact O-N 2.85Å; F79-E82 PolarHBondContact O-N 3.44Å; E82-E84 VanDerWaalsContact C-N 3.34Å; E82-E84 PolarHBondContact O-N 3.46Å; E82-K85 PolarHBondContact O-N 3.38Å; E82-S86 PolarHBondContact O-N 3.31Å; E82-S86 PolarHBondContact O-OG 3.04Å
83	K	98.4	Very high	98.4	Very high	120 Å²	120	102.6 Å²	102.6	52%	0.522	51%	0.514	S	S	.	.	H	α-helix	trans	-57	-46.7	174.8	178.5	-172.1	171.6	-174.1	0	111.5	F79 N80 K85 S86 V87	F79-K83 HydrophobicContact CE1-CD 4.4Å; F79-K83 VanDerWaalsContact O-CB 3.29Å; F79-K83 WeakPolarHBondContact O-CB 3.42Å; F79-K83 PolarHBondContact O-N 3.03Å; N80-K83 PolarHBondContact O-N 3.1Å; K83-K85 PolarHBondContact O-N 2.93Å; K83-S86 PolarHBondContact O-N 3.3Å; K83-V87 HydrophobicContact CG-CG2 4.49Å; K83-V87 VanDerWaalsContact O-CG2 3.31Å; K83-V87 WeakPolarHBondContact O-CG2 3.39Å; K83-V87 PolarHBondContact O-N 2.96Å
84	E	98.4	Very high	98.4	Very high	124 Å²	124	102.8 Å²	102.8	58%	0.579	51%	0.511	S	S	*	.	H	α-helix	trans	-62	-43.6	179.6	-172	178.4	172.7	0	0	111.6	N80 E81 E82 S86 V87 N88	N80-E84 PolarHBondContact O-N 3.26Å; E81-E84 PolarHBondContact O-N 3.2Å; E82-E84 VanDerWaalsContact C-N 3.34Å; E82-E84 PolarHBondContact O-N 3.46Å; E84-S86 PolarHBondContact O-N 2.75Å; E84-V87 PolarHBondContact O-N 2.97Å; E84-N88 WeakPolarHBondContact O-CB 3.4Å; E84-N88 VanDerWaalsContact O-CG 3.25Å; E84-N88 PolarHBondContact O-N 2.84Å; E84-N88 PolarHBondContact O-ND2 2.91Å
85	K	98.4	Very high	98.4	Very high	136 Å²	136	102.7 Å²	102.7	59%	0.591	51%	0.51	S	S	*	.	H	α-helix	trans	-58.6	-46.5	174.7	-71.2	168.7	-173.7	165.7	0	111.7	E81 E82 K83 N88 S89	E81-K85 WeakPolarHBondContact O-CG 3.45Å; E81-K85 PolarHBondContact O-N 3.4Å; E81-K85 VanDerWaalsContact O-N 3.11Å; E82-K85 PolarHBondContact O-N 3.38Å; K83-K85 PolarHBondContact O-N 2.93Å; K85-N88 PolarHBondContact O-N 3.21Å; K85-S89 PolarHBondContact O-N 3.45Å
86	S	98.3	Very high	98.3	Very high	79 Å²	79	101.5 Å²	101.5	55%	0.552	51%	0.511	S	S	*	.	H	α-helix	trans	-63.2	-42.9	178.2	-65	0	0	0	0	112.4	E82 K83 E84 N88 S89 C90	E82-S86 PolarHBondContact O-N 3.31Å; E82-S86 PolarHBondContact O-OG 3.04Å; K83-S86 PolarHBondContact O-N 3.3Å; E84-S86 PolarHBondContact O-N 2.75Å; S86-N88 VanDerWaalsContact C-N 3.35Å; S86-N88 PolarHBondContact O-N 2.89Å; S86-S89 PolarHBondContact O-N 3.21Å; S86-C90 WeakPolarHBondContact O-CB 3.44Å; S86-C90 PolarHBondContact O-N 3.45Å
87	V	98.4	Very high	98.3	Very high	64 Å²	64	102.3 Å²	102.3	39%	0.388	51%	0.513	S	S	.	.	H	α-helix	trans	-60	-46.2	176	169	0	0	0	0	110.7	K83 E84 S89 C90 Q91	K83-V87 HydrophobicContact CG-CG2 4.49Å; K83-V87 VanDerWaalsContact O-CG2 3.31Å; K83-V87 WeakPolarHBondContact O-CG2 3.39Å; K83-V87 PolarHBondContact O-N 2.96Å; E84-V87 PolarHBondContact O-N 2.97Å; V87-S89 PolarHBondContact O-N 2.83Å; V87-C90 PolarHBondContact O-N 3.46Å; V87-Q91 WeakPolarHBondContact O-CG 3.29Å; V87-Q91 PolarHBondContact O-N 2.96Å
88	N	98.2	Very high	98.2	Very high	69 Å²	69	102.7 Å²	102.7	37%	0.369	51%	0.512	S	S	.	.	H	α-helix	trans	-63.4	-39.9	178.9	-71.2	-22.9	0	0	0	112.3	E84 K85 S86 K92	E84-N88 WeakPolarHBondContact O-CB 3.4Å; E84-N88 VanDerWaalsContact O-CG 3.25Å; E84-N88 PolarHBondContact O-N 2.84Å; E84-N88 PolarHBondContact O-ND2 2.91Å; K85-N88 PolarHBondContact O-N 3.21Å; S86-N88 VanDerWaalsContact C-N 3.35Å; S86-N88 PolarHBondContact O-N 2.89Å; N88-K92 WeakPolarHBondContact O-CG 3.31Å; N88-K92 PolarHBondContact O-N 3.34Å; N88-K92 VanDerWaalsContact O-N 3.17Å
89	S	98.3	Very high	98.2	Very high	59 Å²	59	103.1 Å²	103.1	41%	0.413	52%	0.52	S	S	.	.	H	α-helix	trans	-63.8	-47.2	175.4	-161.9	0	0	0	0	111.5	K85 S86 V87 Q91 K92 E93	K85-S89 PolarHBondContact O-N 3.45Å; S86-S89 PolarHBondContact O-N 3.21Å; V87-S89 PolarHBondContact O-N 2.83Å; S89-Q91 VanDerWaalsContact C-N 3.31Å; S89-Q91 PolarHBondContact O-N 3.36Å; S89-K92 PolarHBondContact O-N 2.97Å; S89-K92 VanDerWaalsContact O-N 3.16Å; S89-E93 PolarHBondContact O-N 2.92Å
90	C	98	Very high	98.1	Very high	76 Å²	76	100.4 Å²	100.4	51%	0.514	52%	0.517	S	S	.	.	H	α-helix	trans	-60.3	-40.9	179	-175.3	0	0	0	0	111.8	S86 V87 K92 E93 Q94	S86-C90 WeakPolarHBondContact O-CB 3.44Å; S86-C90 PolarHBondContact O-N 3.45Å; V87-C90 PolarHBondContact O-N 3.46Å; C90-K92 PolarHBondContact O-N 3.47Å; C90-E93 PolarHBondContact O-N 2.9Å; C90-Q94 VanDerWaalsContact O-CB 3.31Å; C90-Q94 WeakPolarHBondContact O-CB 3.32Å; C90-Q94 PolarHBondContact O-N 3.15Å
91	Q	98.3	Very high	98	Very high	101 Å²	101	102.1 Å²	102.1	47%	0.472	52%	0.52	S	S	.	.	H	α-helix	trans	-62.5	-42.6	175.6	-75.5	-178.8	-4.6	0	0	112.6	V87 S89 Q94 Q95	V87-Q91 WeakPolarHBondContact O-CG 3.29Å; V87-Q91 PolarHBondContact O-N 2.96Å; S89-Q91 VanDerWaalsContact C-N 3.31Å; S89-Q91 PolarHBondContact O-N 3.36Å; Q91-Q94 PolarHBondContact O-N 3.13Å; Q91-Q95 WeakPolarHBondContact O-CG 3.46Å; Q91-Q95 PolarHBondContact O-N 3.49Å
92	K	98.1	Very high	97.9	Very high	151 Å²	151	99.9 Å²	99.9	66%	0.657	52%	0.516	S	S	*	.	H	α-helix	trans	-62.8	-46.7	176.6	-72.5	176.4	-178.7	-179.6	0	111.5	N88 S89 C90 Q94 Q95 A96	N88-K92 WeakPolarHBondContact O-CG 3.31Å; N88-K92 PolarHBondContact O-N 3.34Å; N88-K92 VanDerWaalsContact O-N 3.17Å; S89-K92 PolarHBondContact O-N 2.97Å; S89-K92 VanDerWaalsContact O-N 3.16Å; C90-K92 PolarHBondContact O-N 3.47Å; K92-Q94 VanDerWaalsContact C-N 3.32Å; K92-Q94 PolarHBondContact O-N 3.02Å; K92-Q95 PolarHBondContact O-N 3.47Å; K92-A96 PolarHBondContact O-N 3.23Å
93	E	97.9	Very high	97.8	Very high	128 Å²	128	98.4 Å²	98.4	60%	0.598	52%	0.517	S	S	*	.	H	α-helix	trans	-61.3	-41.3	176	-74.1	176.1	-170.2	0	0	111.8	S89 C90 Q95 A96 L97	S89-E93 PolarHBondContact O-N 2.92Å; C90-E93 PolarHBondContact O-N 2.9Å; E93-Q95 VanDerWaalsContact C-N 3.34Å; E93-Q95 PolarHBondContact O-N 2.93Å; E93-A96 PolarHBondContact O-N 2.88Å; E93-L97 WeakPolarHBondContact O-CB 3.43Å; E93-L97 PolarHBondContact O-N 2.96Å
94	Q	98.1	Very high	97.6	Very high	103 Å²	103	98.4 Å²	98.4	48%	0.481	52%	0.519	S	S	.	.	H	α-helix	trans	-62.6	-40.1	177	-168.2	-174.3	22.3	0	0	112	C90 Q91 K92 K98	C90-Q94 VanDerWaalsContact O-CB 3.31Å; C90-Q94 WeakPolarHBondContact O-CB 3.32Å; C90-Q94 PolarHBondContact O-N 3.15Å; Q91-Q94 PolarHBondContact O-N 3.13Å; K92-Q94 VanDerWaalsContact C-N 3.32Å; K92-Q94 PolarHBondContact O-N 3.02Å; Q94-K98 WeakPolarHBondContact O-CG 3.44Å; Q94-K98 PolarHBondContact O-N 3.37Å; Q94-K98 VanDerWaalsContact O-N 3.08Å
95	Q	98.1	Very high	97.4	Very high	124 Å²	124	97.1 Å²	97.1	58%	0.579	52%	0.516	S	S	*	.	H	α-helix	trans	-65.7	-46.2	174.8	-73.5	179.6	8.7	0	0	111.6	Q91 K92 E93 L97 K98 L99	Q91-Q95 WeakPolarHBondContact O-CG 3.46Å; Q91-Q95 PolarHBondContact O-N 3.49Å; K92-Q95 PolarHBondContact O-N 3.47Å; E93-Q95 VanDerWaalsContact C-N 3.34Å; E93-Q95 PolarHBondContact O-N 2.93Å; Q95-L97 VanDerWaalsContact C-N 3.3Å; Q95-L97 PolarHBondContact O-N 2.77Å; Q95-K98 PolarHBondContact O-N 2.92Å; Q95-L99 WeakPolarHBondContact O-CG 3.47Å; Q95-L99 PolarHBondContact O-N 2.91Å
96	A	97.8	Very high	97.1	Very high	60 Å²	60	96.8 Å²	96.8	50%	0.496	52%	0.516	S	S	.	.	H	α-helix	trans	-58.8	-42.6	176.9	0	0	0	0	0	111.8	K92 E93 K98 L99 S100	K92-A96 PolarHBondContact O-N 3.23Å; E93-A96 PolarHBondContact O-N 2.88Å; A96-K98 PolarHBondContact O-N 3.49Å; A96-L99 PolarHBondContact O-N 3.27Å; A96-S100 WeakPolarHBondContact O-CB 3.35Å; A96-S100 PolarHBondContact O-N 3.3Å
97	L	97.8	Very high	96.8	Very high	94 Å²	94	97.6 Å²	97.6	49%	0.492	52%	0.518	S	S	.	.	H	α-helix	trans	-63.5	-41.4	176.9	-175.8	65.9	0	0	0	112.3	E93 Q95 S100 K101	E93-L97 WeakPolarHBondContact O-CB 3.43Å; E93-L97 PolarHBondContact O-N 2.96Å; Q95-L97 VanDerWaalsContact C-N 3.3Å; Q95-L97 PolarHBondContact O-N 2.77Å; L97-S100 PolarHBondContact O-N 2.94Å; L97-K101 WeakPolarHBondContact O-CG 3.43Å; L97-K101 PolarHBondContact O-N 3.49Å
98	K	97.6	Very high	96.4	Very high	132 Å²	132	100.7 Å²	100.7	57%	0.574	53%	0.531	S	S	*	.	H	α-helix	trans	-61.5	-44.6	176	-75.8	173.8	-179	178.7	0	111.6	Q94 Q95 A96 K101 C102	Q94-K98 WeakPolarHBondContact O-CG 3.44Å; Q94-K98 PolarHBondContact O-N 3.37Å; Q94-K98 VanDerWaalsContact O-N 3.08Å; Q95-K98 PolarHBondContact O-N 2.92Å; A96-K98 PolarHBondContact O-N 3.49Å; K98-K101 PolarHBondContact O-N 3.44Å; K98-C102 PolarHBondContact O-N 3.38Å
99	L	97.4	Very high	95.9	Very high	128 Å²	128	105.7 Å²	105.7	67%	0.67	55%	0.553	S	S	*	*	H	α-helix	trans	-63.9	-44.7	178.1	-69.9	172.5	0	0	0	111.7	Q95 A96 K101 C102 S103	Q95-L99 WeakPolarHBondContact O-CG 3.47Å; Q95-L99 PolarHBondContact O-N 2.91Å; A96-L99 PolarHBondContact O-N 3.27Å; L99-K101 PolarHBondContact O-N 2.89Å; L99-C102 PolarHBondContact O-N 3.34Å; L99-S103 PolarHBondContact O-N 3.4Å
100	S	97	Very high	94.6	Very high	72 Å²	72	109.4 Å²	109.4	50%	0.503	59%	0.587	S	S	.	*	H	α-helix	trans	-58.5	-46.3	176.1	175.5	0	0	0	0	111.8	A96 L97 C102 S103 Q104	A96-S100 WeakPolarHBondContact O-CB 3.35Å; A96-S100 PolarHBondContact O-N 3.3Å; L97-S100 PolarHBondContact O-N 2.94Å; S100-C102 PolarHBondContact O-N 2.81Å; S100-S103 PolarHBondContact O-N 2.94Å; S100-Q104 WeakPolarHBondContact O-CB 3.24Å; S100-Q104 PolarHBondContact O-N 3.12Å
101	K	96.8	Very high	94.4	Very high	117 Å²	117	111.1 Å²	111.1	51%	0.509	59%	0.591	S	S	.	*	H	α-helix	trans	-60.6	-42.5	175.5	-74.4	179.5	178.4	-175.4	0	112.7	L97 K98 L99 Q104 N105	L97-K101 WeakPolarHBondContact O-CG 3.43Å; L97-K101 PolarHBondContact O-N 3.49Å; K98-K101 PolarHBondContact O-N 3.44Å; L99-K101 PolarHBondContact O-N 2.89Å; K101-Q104 PolarHBondContact O-N 3.15Å; K101-N105 VanDerWaalsContact O-CG 3.27Å; K101-N105 PolarHBondContact O-N 3.42Å
102	C	96.2	Very high	94.2	Very high	63 Å²	63	111.6 Å²	111.6	43%	0.426	60%	0.597	S	S	.	*	H	α-helix	trans	-62.1	-46.9	178	-172.4	0	0	0	0	111.7	K98 L99 S100 N105 Q106	K98-C102 PolarHBondContact O-N 3.38Å; L99-C102 PolarHBondContact O-N 3.34Å; S100-C102 PolarHBondContact O-N 2.81Å; C102-N105 PolarHBondContact O-N 3.16Å; C102-Q106 WeakPolarHBondContact O-CG 3.24Å; C102-Q106 PolarHBondContact O-N 3.13Å
103	S	95.5	Very high	94	Very high	66 Å²	66	109.4 Å²	109.4	46%	0.462	59%	0.593	S	S	.	*	H	α-helix	trans	-62.7	-42	177.9	178.7	0	0	0	0	112	L99 S100 Q106 T107	L99-S103 PolarHBondContact O-N 3.4Å; S100-S103 PolarHBondContact O-N 2.94Å; S103-Q106 PolarHBondContact O-N 3.32Å; S103-T107 PolarHBondContact O-N 3Å; S103-T107 PolarHBondContact O-OG1 2.91Å
104	Q	94.8	Very high	93.7	Very high	121 Å²	121	108.3 Å²	108.3	57%	0.565	59%	0.593	S	S	*	*	H	α-helix	trans	-62	-45.6	176.4	-171.2	173.4	31	0	0	111.8	S100 K101 T107 L108	S100-Q104 WeakPolarHBondContact O-CB 3.24Å; S100-Q104 PolarHBondContact O-N 3.12Å; K101-Q104 PolarHBondContact O-N 3.15Å; Q104-T107 PolarHBondContact O-N 3.48Å; Q104-L108 HydrophobicContact CG-CD1 4.47Å; Q104-L108 WeakPolarHBondContact O-CG 3.23Å; Q104-L108 PolarHBondContact O-N 3.1Å; Q104-L108 VanDerWaalsContact O-N 3.12Å
105	N	94.8	Very high	93.5	Very high	97 Å²	97	108.6 Å²	108.6	52%	0.519	60%	0.6	S	S	.	*	H	α-helix	trans	-62.9	-42.7	176.6	-70.3	-9.7	0	0	0	111.9	K101 C102 T107 L108 E109	K101-N105 VanDerWaalsContact O-CG 3.27Å; K101-N105 PolarHBondContact O-N 3.42Å; C102-N105 PolarHBondContact O-N 3.16Å; N105-T107 PolarHBondContact O-N 3.28Å; N105-L108 PolarHBondContact O-N 3.41Å; N105-L108 VanDerWaalsContact O-N 3.14Å; N105-E109 WeakPolarHBondContact O-CG 3.35Å; N105-E109 PolarHBondContact O-N 3.03Å; N105-E109 VanDerWaalsContact O-N 3.14Å
106	Q	91.9	Very high	93.2	Very high	128 Å²	128	107.6 Å²	107.6	60%	0.598	60%	0.602	S	S	*	*	H	α-helix	trans	-59.6	-36.5	175.7	-75.1	172.6	-10	0	0	112.6	C102 S103 A110	C102-Q106 WeakPolarHBondContact O-CG 3.24Å; C102-Q106 PolarHBondContact O-N 3.13Å; S103-Q106 PolarHBondContact O-N 3.32Å; Q106-A110 PolarHBondContact O-N 3.39Å
107	T	92.3	Very high	92.8	Very high	96 Å²	96	111 Å²	111	59%	0.589	61%	0.609	S	S	*	*	H	α-helix	trans	-70.4	-32.7	177.4	-52.1	0	0	0	0	112.1	S103 Q104 N105	S103-T107 PolarHBondContact O-N 3Å; S103-T107 PolarHBondContact O-OG1 2.91Å; Q104-T107 PolarHBondContact O-N 3.48Å; N105-T107 PolarHBondContact O-N 3.28Å
108	L	90.5	Very high	92.4	Very high	129 Å²	129	112.3 Å²	112.3	68%	0.675	62%	0.618	S	S	*	*	H	α-helix	trans	-75.5	-26.2	178.5	-71.3	169.3	0	0	0	113.1	Q104 N105	Q104-L108 HydrophobicContact CG-CD1 4.47Å; Q104-L108 WeakPolarHBondContact O-CG 3.23Å; Q104-L108 PolarHBondContact O-N 3.1Å; Q104-L108 VanDerWaalsContact O-N 3.12Å; N105-L108 PolarHBondContact O-N 3.41Å; N105-L108 VanDerWaalsContact O-N 3.14Å
109	E	87.7	Confident	92	Very high	174 Å²	174	110.7 Å²	110.7	81%	0.813	62%	0.622	S	S	*	*			trans	-89.3	-4.9	179	-62.8	-73.8	162.9	0	0	113.3	N105	N105-E109 WeakPolarHBondContact O-CG 3.35Å; N105-E109 PolarHBondContact O-N 3.03Å; N105-E109 VanDerWaalsContact O-N 3.14Å
110	A	69.2	Low	91.5	Very high	137 Å²	137	109.1 Å²	109.1	100%	1.132	62%	0.617	S	S	*	*			trans	-98.6	0	-179.6	0	0	0	0	0	112.1	Q106	Q106-A110 PolarHBondContact O-N 3.39Å

Retrieved 110 of 110 residues in 47.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).