A0A087WNQ9_MOUSE Loading...

PHD finger protein 3

AlphaFold DB , UniProt , Accession A0A087WNQ9, Species MOUSE (Mus musculus, Mouse), Gene Phf3, Length 53 aa.

						>A0A087WNQ9_MOUSE|A0A087WNQ9|Phf3
MDIVDTFNHLIPTEHLDDALFLGSNLENEVCEDFSTSQNVLEDSLKNMLSDKD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.4	Low	61.4	Low	183 Å²	183	110.5 Å²	110.5	90%	0.901	57%	0.569	S	S	*	*				0	112.7	0	-169.9	144.7	158.9	0	104.7	D5	M1-D5 HydrophobicContact CG-CB 4.21Å
2	D	66	Low	61.2	Low	118 Å²	118	107.4 Å²	107.4	63%	0.631	56%	0.562	S	S	*	*			trans	-64.5	144	-174.8	-77.3	-31	0	0	109.1	V4 D5 T6	D2-V4 PolarHBondContact O-N 3.38Å; D2-V4 VanDerWaalsContact O-N 3.08Å; D2-D5 WeakPolarHBondContact O-CB 3.45Å; D2-D5 PolarHBondContact O-N 3.48Å; D2-T6 PolarHBondContact O-N 3.05Å
3	I	61.9	Low	60.9	Low	116 Å²	116	107.9 Å²	107.9	60%	0.595	57%	0.572	S	S	*	*	H	α-helix	trans	-56.1	-29.1	-179.8	-171.1	168.4	0	0	111.6	T6 F7	I3-T6 WeakPolarHBondContact O-CB 3.13Å; I3-T6 PolarHBondContact O-N 2.79Å; I3-F7 HydrophobicContact CD1-CE2 3.68Å; I3-F7 HydrophobicContact CD1-CZ 4.37Å; I3-F7 HydrophobicContact CG1-CD2 3.78Å; I3-F7 HydrophobicContact CG1-CE2 3.32Å; I3-F7 HydrophobicContact CG1-CZ 4.24Å; I3-F7 WeakPolarHBondContact O-CD2 3.47Å; I3-F7 PolarHBondContact O-N 3.47Å; I3-F7 VanDerWaalsContact O-N 3.15Å
4	V	57.9	Low	61	Low	90 Å²	90	111.4 Å²	111.4	55%	0.545	58%	0.583	S	S	.	*	H	α-helix	trans	-62.4	-42.8	173.6	-176.9	0	0	0	111.9	D2 T6 F7 N8	D2-V4 PolarHBondContact O-N 3.38Å; D2-V4 VanDerWaalsContact O-N 3.08Å; V4-T6 VanDerWaalsContact C-N 3.25Å; V4-T6 PolarHBondContact O-N 3.06Å; V4-F7 PolarHBondContact O-N 2.88Å; V4-N8 WeakPolarHBondContact O-CB 3.15Å; V4-N8 PolarHBondContact O-N 3.41Å; V4-N8 PolarHBondContact O-ND2 2.77Å; V4-N8 VanDerWaalsContact O-ND2 3.16Å
5	D	63.8	Low	60.6	Low	74 Å²	74	110.9 Å²	110.9	40%	0.396	58%	0.577	S	S	.	*	H	α-helix	trans	-65.7	-30.8	175.9	-71.5	-28.4	0	0	111.9	M1 D2 H9	M1-D5 HydrophobicContact CG-CB 4.21Å; D2-D5 WeakPolarHBondContact O-CB 3.45Å; D2-D5 PolarHBondContact O-N 3.48Å; D5-H9 PolarHBondContact O-CD2 2.88Å; D5-H9 PolarHBondContact O-NE2 3.14Å
6	T	61.3	Low	60.7	Low	66 Å²	66	107.8 Å²	107.8	41%	0.405	56%	0.561	S	S	.	*	H	α-helix	trans	-71.1	-38	177.4	-52.8	0	0	0	111.4	D2 I3 V4	D2-T6 PolarHBondContact O-N 3.05Å; I3-T6 WeakPolarHBondContact O-CB 3.13Å; I3-T6 PolarHBondContact O-N 2.79Å; V4-T6 VanDerWaalsContact C-N 3.25Å; V4-T6 PolarHBondContact O-N 3.06Å
7	F	60.4	Low	60.9	Low	119 Å²	119	108.9 Å²	108.9	52%	0.522	57%	0.568	S	S	.	*	H	α-helix	trans	-79.9	-27.2	179.4	-70.1	-59.7	0	0	114	I3 V4 H9 L10	I3-F7 HydrophobicContact CD1-CE2 3.68Å; I3-F7 HydrophobicContact CD1-CZ 4.37Å; I3-F7 HydrophobicContact CG1-CD2 3.78Å; I3-F7 HydrophobicContact CG1-CE2 3.32Å; I3-F7 HydrophobicContact CG1-CZ 4.24Å; I3-F7 WeakPolarHBondContact O-CD2 3.47Å; I3-F7 PolarHBondContact O-N 3.47Å; I3-F7 VanDerWaalsContact O-N 3.15Å; V4-F7 PolarHBondContact O-N 2.88Å; F7-H9 PolarHBondContact O-N 2.93Å; F7-H9 VanDerWaalsContact O-N 3.1Å; F7-L10 HydrophobicContact CD1-CD1 3.79Å; F7-L10 HydrophobicContact CE1-CD1 4.21Å; F7-L10 PolarHBondContact O-N 3.38Å
8	N	59.6	Low	61	Low	97 Å²	97	108.7 Å²	108.7	52%	0.519	57%	0.567	S	S	.	*	T	Hydrogen-bonded Turn	trans	-59.6	-20.1	174.9	-78.7	-29.5	0	0	113.6	V4	V4-N8 WeakPolarHBondContact O-CB 3.15Å; V4-N8 PolarHBondContact O-N 3.41Å; V4-N8 PolarHBondContact O-ND2 2.77Å; V4-N8 VanDerWaalsContact O-ND2 3.16Å
9	H	60.6	Low	61	Low	145 Å²	145	105.9 Å²	105.9	67%	0.671	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.6	-9.7	177.3	-55.7	-40.2	0	0	113.9	D5 F7	D5-H9 PolarHBondContact O-CD2 2.88Å; D5-H9 PolarHBondContact O-NE2 3.14Å; F7-H9 PolarHBondContact O-N 2.93Å; F7-H9 VanDerWaalsContact O-N 3.1Å
10	L	64.3	Low	61.1	Low	119 Å²	119	106.1 Å²	106.1	62%	0.623	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.7	-12.2	-177.5	-70.3	169.4	0	0	112.7	F7	F7-L10 HydrophobicContact CD1-CD1 3.79Å; F7-L10 HydrophobicContact CE1-CD1 4.21Å; F7-L10 PolarHBondContact O-N 3.38Å
11	I	61.8	Low	61	Low	88 Å²	88	108.4 Å²	108.4	45%	0.451	57%	0.568	S	S	.	*	S	Bend	trans	-118.7	104.3	176.7	-55.3	-176.3	0	0	107.8	T13 L16	I11-T13 PolarHBondContact O-N 3.44Å; I11-L16 HydrophobicContact CG2-CB 4.28Å; I11-L16 HydrophobicContact CG2-CD1 4.03Å
12	P	58.9	Low	60.9	Low	74 Å²	74	105.1 Å²	105.1	48%	0.481	55%	0.554	S	S	.	*			trans	-57.8	110.8	168.4	-18.5	30.7	0	0	108.1	E14 H15	P12-E14 HydrophobicContact CB-CG 3.84Å; P12-E14 PolarHBondContact O-N 2.83Å; P12-H15 PolarHBondContact O-N 2.84Å
13	T	57.2	Low	60.3	Low	114 Å²	114	100.7 Å²	100.7	70%	0.699	54%	0.536	S	S	*	.	G	3₁₀ helix	trans	-59.1	-19.8	-176.3	-32.4	0	0	0	111.9	I11 H15	I11-T13 PolarHBondContact O-N 3.44Å; T13-H15 VanDerWaalsContact C-N 3.27Å; T13-H15 PolarHBondContact O-N 3.47Å
14	E	62.3	Low	59.9	Low	156 Å²	156	98.6 Å²	98.6	73%	0.729	53%	0.531	S	S	*	.	G	3₁₀ helix	trans	-66.9	-16.9	176.1	64.2	-172.8	132.2	0	115.2	P12	P12-E14 HydrophobicContact CB-CG 3.84Å; P12-E14 PolarHBondContact O-N 2.83Å
15	H	55.6	Low	59.5	Low	105 Å²	105	99.3 Å²	99.3	49%	0.486	53%	0.532	S	S	.	.	G	3₁₀ helix	trans	-124.8	7.2	178.9	-66.3	-55.9	0	0	113.6	P12 T13 D17 D18 A19	P12-H15 PolarHBondContact O-N 2.84Å; T13-H15 VanDerWaalsContact C-N 3.27Å; T13-H15 PolarHBondContact O-N 3.47Å; H15-D17 VanDerWaalsContact C-N 3.33Å; H15-D17 PolarHBondContact O-N 2.99Å; H15-D18 IonicContact ND1-OD2 3.59Å; H15-D18 PolarHBondContact O-N 2.94Å; H15-A19 VanDerWaalsContact O-CB 3.27Å; H15-A19 WeakPolarHBondContact O-CB 3.05Å; H15-A19 PolarHBondContact O-N 2.99Å
16	L	62.7	Low	58.9	Low	60 Å²	60	100.8 Å²	100.8	31%	0.314	54%	0.539	S	S	.	.	H	α-helix	trans	-65.8	-37.1	179.7	-179.2	57.7	0	0	111.6	I11 A19 L20	I11-L16 HydrophobicContact CG2-CB 4.28Å; I11-L16 HydrophobicContact CG2-CD1 4.03Å; L16-A19 PolarHBondContact O-N 3.41Å; L16-L20 HydrophobicContact CD1-CD1 4.11Å; L16-L20 HydrophobicContact CD1-CD2 4.49Å; L16-L20 HydrophobicContact CD1-CG 3.95Å; L16-L20 HydrophobicContact CG-CD1 3.93Å; L16-L20 HydrophobicContact CG-CG 4.27Å; L16-L20 WeakPolarHBondContact O-CB 3.49Å; L16-L20 WeakPolarHBondContact O-CG 3.37Å; L16-L20 PolarHBondContact O-N 3.33Å
17	D	63.5	Low	58.6	Low	128 Å²	128	105.5 Å²	105.5	68%	0.684	56%	0.557	S	S	*	*	H	α-helix	trans	-64.9	-40.6	176.8	-66.5	-30.3	0	0	111.7	H15 F21	H15-D17 VanDerWaalsContact C-N 3.33Å; H15-D17 PolarHBondContact O-N 2.99Å; D17-F21 WeakPolarHBondContact O-CB 3.32Å; D17-F21 PolarHBondContact O-N 2.72Å
18	D	62.7	Low	58.3	Low	104 Å²	104	106.4 Å²	106.4	56%	0.556	57%	0.567	S	S	*	*	H	α-helix	trans	-69.2	-38.5	175.3	-64.8	-31.3	0	0	111.8	H15 F21 L22	H15-D18 IonicContact ND1-OD2 3.59Å; H15-D18 PolarHBondContact O-N 2.94Å; D18-F21 PolarHBondContact O-N 3.35Å; D18-L22 WeakPolarHBondContact O-CB 3.17Å; D18-L22 PolarHBondContact O-N 3.49Å
19	A	60.9	Low	57.9	Low	57 Å²	57	109.8 Å²	109.8	47%	0.471	58%	0.58	S	S	.	*	H	α-helix	trans	-71.9	-34.7	178.1	0	0	0	0	112.6	H15 L16 L22 G23	H15-A19 VanDerWaalsContact O-CB 3.27Å; H15-A19 WeakPolarHBondContact O-CB 3.05Å; H15-A19 PolarHBondContact O-N 2.99Å; L16-A19 PolarHBondContact O-N 3.41Å; A19-L22 PolarHBondContact O-N 3.28Å; A19-G23 WeakPolarHBondContact O-CA 3.36Å; A19-G23 PolarHBondContact O-N 2.91Å
20	L	62.4	Low	57.4	Low	108 Å²	108	106.4 Å²	106.4	57%	0.565	57%	0.569	S	S	*	*	H	α-helix	trans	-69	-37.3	171.6	-73	170.4	0	0	111	L16 G23 S24	L16-L20 HydrophobicContact CD1-CD1 4.11Å; L16-L20 HydrophobicContact CD1-CD2 4.49Å; L16-L20 HydrophobicContact CD1-CG 3.95Å; L16-L20 HydrophobicContact CG-CD1 3.93Å; L16-L20 HydrophobicContact CG-CG 4.27Å; L16-L20 WeakPolarHBondContact O-CB 3.49Å; L16-L20 WeakPolarHBondContact O-CG 3.37Å; L16-L20 PolarHBondContact O-N 3.33Å; L20-G23 PolarHBondContact O-N 3.34Å; L20-S24 PolarHBondContact O-N 3.2Å
21	F	59.2	Low	56.8	Low	156 Å²	156	104.6 Å²	104.6	68%	0.684	57%	0.565	S	S	*	*	H	α-helix	trans	-65.1	-41.3	173.1	-173.6	-101.8	0	0	112	D17 D18 S24	D17-F21 WeakPolarHBondContact O-CB 3.32Å; D17-F21 PolarHBondContact O-N 2.72Å; D18-F21 PolarHBondContact O-N 3.35Å; F21-S24 PolarHBondContact O-OG 2.66Å
22	L	55.4	Low	56.4	Low	114 Å²	114	108.4 Å²	108.4	60%	0.597	58%	0.582	S	S	*	*	H	α-helix	trans	-73.2	-33.6	173.6	-165.3	64	0	0	112.5	D18 A19 S24 N25 L26	D18-L22 WeakPolarHBondContact O-CB 3.17Å; D18-L22 PolarHBondContact O-N 3.49Å; A19-L22 PolarHBondContact O-N 3.28Å; L22-S24 VanDerWaalsContact C-N 3.3Å; L22-S24 PolarHBondContact O-N 3.49Å; L22-N25 PolarHBondContact O-N 3.09Å; L22-N25 VanDerWaalsContact O-N 3.07Å; L22-L26 PolarHBondContact O-N 3.16Å
23	G	52.9	Low	56.1	Low	25 Å²	25	110.5 Å²	110.5	26%	0.258	59%	0.588	S	S	.	*	H	α-helix	trans	-62.5	-34.2	176.9	0	0	0	0	113.1	A19 L20 N25 L26 E27	A19-G23 WeakPolarHBondContact O-CA 3.36Å; A19-G23 PolarHBondContact O-N 2.91Å; L20-G23 PolarHBondContact O-N 3.34Å; G23-N25 PolarHBondContact O-N 2.91Å; G23-L26 PolarHBondContact O-N 3.16Å; G23-E27 PolarHBondContact O-N 2.86Å
24	S	54.1	Low	55.9	Low	71 Å²	71	110.5 Å²	110.5	50%	0.497	58%	0.579	S	S	.	*	H	α-helix	trans	-67.6	-12.5	173.6	65.8	0	0	0	114.7	L20 F21 L22	L20-S24 PolarHBondContact O-N 3.2Å; F21-S24 PolarHBondContact O-OG 2.66Å; L22-S24 VanDerWaalsContact C-N 3.3Å; L22-S24 PolarHBondContact O-N 3.49Å
25	N	49.3	Very low	55.6	Low	106 Å²	106	106.1 Å²	106.1	57%	0.567	57%	0.566	S	S	*	*	H	α-helix	trans	-94.1	-19.3	168.2	-81	-84.7	0	0	113.1	L22 G23	L22-N25 PolarHBondContact O-N 3.09Å; L22-N25 VanDerWaalsContact O-N 3.07Å; G23-N25 PolarHBondContact O-N 2.91Å
26	L	52.7	Low	55.7	Low	105 Å²	105	105.7 Å²	105.7	55%	0.55	57%	0.571	S	S	.	*	H	α-helix	trans	-81	-22	-178.2	-74.6	166.1	0	0	113.3	L22 G23 N28	L22-L26 PolarHBondContact O-N 3.16Å; G23-L26 PolarHBondContact O-N 3.16Å; L26-N28 PolarHBondContact O-N 2.99Å
27	E	54.5	Low	55.4	Low	165 Å²	165	105.8 Å²	105.8	77%	0.771	58%	0.576	S	S	*	*	H	α-helix	trans	-67.5	-14.4	174.3	-67.4	-174.7	112.5	0	113	G23	G23-E27 PolarHBondContact O-N 2.86Å
28	N	53.3	Low	55.3	Low	138 Å²	138	104.5 Å²	104.5	74%	0.738	57%	0.566	S	S	*	*	H	α-helix	trans	-104.9	-27.4	-172	-161.9	46.6	0	0	115	L26	L26-N28 PolarHBondContact O-N 2.99Å
29	E	50.8	Low	55.4	Low	167 Å²	167	104.4 Å²	104.4	78%	0.78	57%	0.566	S	S	*	*	H	α-helix	trans	-101.8	-16.8	-178.2	-68.7	-175.9	174.2	0	113.7
30	V	51	Low	55.8	Low	74 Å²	74	106.8 Å²	106.8	45%	0.448	57%	0.574	S	S	.	*	S	Bend	trans	-106.2	43.7	-177.4	-170.4	0	0	0	110.5	F34	V30-F34 HydrophobicContact CG1-CD2 3.82Å; V30-F34 WeakPolarHBondContact O-CB 3.25Å
31	C	52.6	Low	56.2	Low	81 Å²	81	106 Å²	106	55%	0.547	57%	0.57	S	S	.	*	S	Bend	trans	-110.9	-38.4	176.6	-169.8	0	0	0	111.5	S35	C31-S35 PolarHBondContact O-N 3.22Å; C31-S35 PolarHBondContact O-OG 3.26Å
32	E	52.7	Low	57	Low	169 Å²	169	103.5 Å²	103.5	79%	0.79	56%	0.56	S	S	*	*	H	α-helix	trans	-76.8	-42.2	179.7	-65	-166.3	136.6	0	112.4	F34 S35	E32-F34 VanDerWaalsContact C-N 3.31Å; E32-F34 PolarHBondContact O-N 3.37Å; E32-S35 PolarHBondContact O-N 3.31Å
33	D	52.9	Low	58	Low	117 Å²	117	103 Å²	103	63%	0.626	56%	0.558	S	S	*	*	H	α-helix	trans	-74	-22.6	174.7	-79.6	-21.1	0	0	113.1	S35 T36 S37	D33-S35 VanDerWaalsContact C-N 3.33Å; D33-T36 PolarHBondContact O-OG1 3.42Å; D33-T36 VanDerWaalsContact O-OG1 3.09Å; D33-S37 VanDerWaalsContact O-CB 3.22Å; D33-S37 WeakPolarHBondContact O-CB 3.3Å; D33-S37 PolarHBondContact O-N 3.06Å; D33-S37 VanDerWaalsContact O-N 3.16Å; D33-S37 PolarHBondContact O-OG 3.44Å
34	F	53	Low	59.3	Low	114 Å²	114	104.9 Å²	104.9	50%	0.5	57%	0.568	S	S	.	*	H	α-helix	trans	-71.1	-33.7	173.9	-141.3	-96.5	0	0	110.8	V30 E32 T36 S37 Q38	V30-F34 HydrophobicContact CG1-CD2 3.82Å; V30-F34 WeakPolarHBondContact O-CB 3.25Å; E32-F34 VanDerWaalsContact C-N 3.31Å; E32-F34 PolarHBondContact O-N 3.37Å; F34-T36 PolarHBondContact O-N 3.28Å; F34-S37 CarbonylContact O-C 3.51Å; F34-S37 PolarHBondContact O-N 3.15Å; F34-Q38 WeakPolarHBondContact O-CA 3.42Å; F34-Q38 WeakPolarHBondContact O-CB 3.15Å; F34-Q38 PolarHBondContact O-N 3.08Å
35	S	55.3	Low	60.5	Low	65 Å²	65	105.7 Å²	105.7	46%	0.455	57%	0.566	S	S	.	*	H	α-helix	trans	-66.6	-37.6	-179.6	-59.5	0	0	0	112.8	C31 E32 D33	C31-S35 PolarHBondContact O-N 3.22Å; C31-S35 PolarHBondContact O-OG 3.26Å; E32-S35 PolarHBondContact O-N 3.31Å; D33-S35 VanDerWaalsContact C-N 3.33Å
36	T	57.2	Low	62	Low	96 Å²	96	107.3 Å²	107.3	59%	0.589	57%	0.568	S	S	*	*	H	α-helix	trans	-76.2	-36.4	175.6	58.8	0	0	0	111.5	D33 F34 Q38	D33-T36 PolarHBondContact O-OG1 3.42Å; D33-T36 VanDerWaalsContact O-OG1 3.09Å; F34-T36 PolarHBondContact O-N 3.28Å; T36-Q38 VanDerWaalsContact C-N 3.32Å
37	S	56.8	Low	63.5	Low	61 Å²	61	108 Å²	108	43%	0.427	57%	0.572	S	S	.	*	H	α-helix	trans	-76.2	-18.7	176.4	-53	0	0	0	113.3	D33 F34 N39 V40 L41	D33-S37 VanDerWaalsContact O-CB 3.22Å; D33-S37 WeakPolarHBondContact O-CB 3.3Å; D33-S37 PolarHBondContact O-N 3.06Å; D33-S37 VanDerWaalsContact O-N 3.16Å; D33-S37 PolarHBondContact O-OG 3.44Å; F34-S37 CarbonylContact O-C 3.51Å; F34-S37 PolarHBondContact O-N 3.15Å; S37-N39 VanDerWaalsContact C-N 3.32Å; S37-N39 PolarHBondContact O-N 3.44Å; S37-V40 PolarHBondContact O-N 3.1Å; S37-L41 WeakPolarHBondContact O-CB 3.36Å; S37-L41 PolarHBondContact O-N 3.41Å
38	Q	62	Low	64.9	Low	101 Å²	101	107.2 Å²	107.2	47%	0.472	57%	0.57	S	S	.	*	H	α-helix	trans	-63.5	-38.1	-177.2	-175	173.1	-7.6	0	111.2	F34 T36 L41 E42	F34-Q38 WeakPolarHBondContact O-CA 3.42Å; F34-Q38 WeakPolarHBondContact O-CB 3.15Å; F34-Q38 PolarHBondContact O-N 3.08Å; T36-Q38 VanDerWaalsContact C-N 3.32Å; Q38-L41 PolarHBondContact O-N 3.02Å; Q38-E42 WeakPolarHBondContact O-CA 3.19Å; Q38-E42 WeakPolarHBondContact O-CB 3.37Å; Q38-E42 PolarHBondContact O-N 3.13Å
39	N	63.4	Low	66.3	Low	102 Å²	102	107 Å²	107	55%	0.545	57%	0.569	S	S	.	*	H	α-helix	trans	-64.4	-42.3	176.2	-80.7	-91.2	0	0	111.5	S37 E42 D43	S37-N39 VanDerWaalsContact C-N 3.32Å; S37-N39 PolarHBondContact O-N 3.44Å; N39-E42 PolarHBondContact O-N 3.07Å; N39-D43 WeakPolarHBondContact O-CB 3.37Å; N39-D43 VanDerWaalsContact O-CG 3.32Å; N39-D43 PolarHBondContact O-N 3.03Å
40	V	69.7	Low	67.7	Low	107 Å²	107	102 Å²	102	65%	0.648	55%	0.551	S	S	*	*	H	α-helix	trans	-70.3	-40.2	179.4	-176.2	0	0	0	111.2	S37 S44	S37-V40 PolarHBondContact O-N 3.1Å; V40-S44 WeakPolarHBondContact O-CB 3.5Å; V40-S44 PolarHBondContact O-N 2.74Å
41	L	72.1	Confident	68.9	Low	91 Å²	91	106.1 Å²	106.1	48%	0.476	57%	0.571	S	S	.	*	H	α-helix	trans	-66.1	-43.6	175.9	-164.3	84.7	0	0	110.8	S37 Q38 S44 L45	S37-L41 WeakPolarHBondContact O-CB 3.36Å; S37-L41 PolarHBondContact O-N 3.41Å; Q38-L41 PolarHBondContact O-N 3.02Å; L41-S44 PolarHBondContact O-N 3.04Å; L41-L45 HydrophobicContact CD2-CD1 4.15Å; L41-L45 HydrophobicContact CG-CD1 3.96Å; L41-L45 HydrophobicContact CG-CG 4.49Å; L41-L45 VanDerWaalsContact O-CB 3.25Å; L41-L45 WeakPolarHBondContact O-CB 3.08Å; L41-L45 WeakPolarHBondContact O-CD1 3.2Å; L41-L45 WeakPolarHBondContact O-CG 3.41Å; L41-L45 PolarHBondContact O-N 3.37Å
42	E	74.7	Confident	69.8	Low	104 Å²	104	111.4 Å²	111.4	49%	0.486	59%	0.585	S	S	.	*	H	α-helix	trans	-62.9	-47.5	177.9	-176.2	176.7	171.5	0	111.2	Q38 N39 S44 L45 K46	Q38-E42 WeakPolarHBondContact O-CA 3.19Å; Q38-E42 WeakPolarHBondContact O-CB 3.37Å; Q38-E42 PolarHBondContact O-N 3.13Å; N39-E42 PolarHBondContact O-N 3.07Å; E42-S44 PolarHBondContact O-N 3.41Å; E42-L45 PolarHBondContact O-N 2.82Å; E42-K46 WeakPolarHBondContact O-CB 3.37Å; E42-K46 PolarHBondContact O-N 3.48Å
43	D	77.6	Confident	70.4	Confident	104 Å²	104	114.8 Å²	114.8	56%	0.556	61%	0.609	S	S	*	*	H	α-helix	trans	-63.9	-40.3	176.9	-75.7	-26.5	0	0	112	N39 N47	N39-D43 WeakPolarHBondContact O-CB 3.37Å; N39-D43 VanDerWaalsContact O-CG 3.32Å; N39-D43 PolarHBondContact O-N 3.03Å; D43-N47 VanDerWaalsContact O-CB 3.3Å; D43-N47 WeakPolarHBondContact O-CB 3.22Å; D43-N47 PolarHBondContact O-N 3.22Å
44	S	79.1	Confident	71.3	Confident	65 Å²	65	114.7 Å²	114.7	46%	0.455	61%	0.608	S	S	.	*	H	α-helix	trans	-66.8	-45.2	177.7	-167	0	0	0	111.9	V40 L41 E42 N47 M48	V40-S44 WeakPolarHBondContact O-CB 3.5Å; V40-S44 PolarHBondContact O-N 2.74Å; L41-S44 PolarHBondContact O-N 3.04Å; E42-S44 PolarHBondContact O-N 3.41Å; S44-N47 PolarHBondContact O-N 3.34Å; S44-M48 WeakPolarHBondContact O-CG 3.36Å; S44-M48 PolarHBondContact O-N 2.88Å
45	L	79.3	Confident	72.3	Confident	87 Å²	87	114.7 Å²	114.7	46%	0.455	61%	0.613	S	S	.	*	H	α-helix	trans	-62.8	-44.6	175.4	-76	168.4	0	0	111.2	L41 E42 N47 M48 L49	L41-L45 HydrophobicContact CD2-CD1 4.15Å; L41-L45 HydrophobicContact CG-CD1 3.96Å; L41-L45 HydrophobicContact CG-CG 4.49Å; L41-L45 VanDerWaalsContact O-CB 3.25Å; L41-L45 WeakPolarHBondContact O-CB 3.08Å; L41-L45 WeakPolarHBondContact O-CD1 3.2Å; L41-L45 WeakPolarHBondContact O-CG 3.41Å; L41-L45 PolarHBondContact O-N 3.37Å; E42-L45 PolarHBondContact O-N 2.82Å; L45-N47 VanDerWaalsContact C-N 3.27Å; L45-N47 PolarHBondContact O-N 2.72Å; L45-M48 PolarHBondContact O-N 3.49Å; L45-M48 VanDerWaalsContact O-N 3.14Å; L45-L49 WeakPolarHBondContact O-CB 3.44Å; L45-L49 WeakPolarHBondContact O-CG 3.33Å; L45-L49 PolarHBondContact O-N 2.89Å
46	K	81.9	Confident	73.2	Confident	141 Å²	141	117.5 Å²	117.5	61%	0.613	62%	0.622	S	S	*	*	H	α-helix	trans	-63.4	-34.4	177.6	-169.5	175.5	-176.5	178.5	111.8	E42 S50	E42-K46 WeakPolarHBondContact O-CB 3.37Å; E42-K46 PolarHBondContact O-N 3.48Å; K46-S50 WeakPolarHBondContact O-CA 3.43Å; K46-S50 WeakPolarHBondContact O-CB 3.27Å; K46-S50 PolarHBondContact O-N 2.99Å; K46-S50 PolarHBondContact O-OG 3Å
47	N	82.8	Confident	74.2	Confident	119 Å²	119	118.8 Å²	118.8	64%	0.636	62%	0.624	S	S	*	*	H	α-helix	trans	-71.3	-33.7	173.1	178.9	75.6	0	0	113.3	D43 S44 L45 S50	D43-N47 VanDerWaalsContact O-CB 3.3Å; D43-N47 WeakPolarHBondContact O-CB 3.22Å; D43-N47 PolarHBondContact O-N 3.22Å; S44-N47 PolarHBondContact O-N 3.34Å; L45-N47 VanDerWaalsContact C-N 3.27Å; L45-N47 PolarHBondContact O-N 2.72Å; N47-S50 PolarHBondContact O-OG 3.37Å; N47-S50 VanDerWaalsContact O-OG 3.06Å
48	M	85.7	Confident	75.2	Confident	148 Å²	148	122.4 Å²	122.4	73%	0.729	64%	0.636	S	S	*	*	H	α-helix	trans	-75.2	-31.2	174.8	-70.2	-176.8	73.2	0	112.9	S44 L45	S44-M48 WeakPolarHBondContact O-CG 3.36Å; S44-M48 PolarHBondContact O-N 2.88Å; L45-M48 PolarHBondContact O-N 3.49Å; L45-M48 VanDerWaalsContact O-N 3.14Å
49	L	82.8	Confident	76.1	Confident	135 Å²	135	123.8 Å²	123.8	71%	0.707	65%	0.647	S	S	*	*	H	α-helix	trans	-95.9	-8.9	179.8	-64.1	175.3	0	0	113.3	L45 D51	L45-L49 WeakPolarHBondContact O-CB 3.44Å; L45-L49 WeakPolarHBondContact O-CG 3.33Å; L45-L49 PolarHBondContact O-N 2.89Å; L49-D51 PolarHBondContact O-N 3.36Å
50	S	79.9	Confident	77	Confident	60 Å²	60	125.4 Å²	125.4	42%	0.42	66%	0.655	S	S	.	*	S	Bend	trans	-71.9	103.5	169.4	65	0	0	0	106.8	K46 N47 K52	K46-S50 WeakPolarHBondContact O-CA 3.43Å; K46-S50 WeakPolarHBondContact O-CB 3.27Å; K46-S50 PolarHBondContact O-N 2.99Å; K46-S50 PolarHBondContact O-OG 3Å; N47-S50 PolarHBondContact O-OG 3.37Å; N47-S50 VanDerWaalsContact O-OG 3.06Å; S50-K52 PolarHBondContact O-N 3.06Å
51	D	76.4	Confident	77.6	Confident	161 Å²	161	126.8 Å²	126.8	86%	0.861	66%	0.655	S	S	*	*			trans	-53.1	105.2	167	-65.8	-48.5	0	0	107.5	L49	L49-D51 PolarHBondContact O-N 3.36Å
52	K	70	Confident	78.1	Confident	192 Å²	192	129.8 Å²	129.8	84%	0.835	67%	0.67	S	S	*	*			trans	-82.7	115.8	160.6	-112.8	-178.9	171.2	174.5	104.6	S50	S50-K52 PolarHBondContact O-N 3.06Å
53	D	66.4	Low	78.4	Confident	241 Å²	241	132.1 Å²	132.1	100%	1.289	69%	0.687	S	S	*	*			trans	-24.9	0	-178.4	-60.8	-74.6	0	0	115.9

Retrieved 53 of 53 residues in 90 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).