A0A087WNR3_MOUSE Loading...

Gamma-glutamyltransferase 5

AlphaFold DB , UniProt , Accession A0A087WNR3, Species MOUSE (Mus musculus, Mouse), Gene Ggt5, Length 71 aa.

						>A0A087WNR3_MOUSE|A0A087WNR3|Ggt5
MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAAVAADSKICSDIGRKPADSSGLGCLPA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.1	Low	79.1	Confident	232 Å²	232	118.4 Å²	118.4	100%	1.143	63%	0.625	S	S	*	*				0	47.5	0	-54.8	-52.6	-177.8	0	0	112.5
2	A	61.1	Low	80.4	Confident	81 Å²	81	115.6 Å²	115.6	67%	0.669	62%	0.616	S	S	*	*	H	α-helix	trans	-88.4	-15.7	-176.5	0	0	0	0	0	114.1
3	W	61.9	Low	81.6	Confident	229 Å²	229	115.7 Å²	115.7	87%	0.867	62%	0.616	S	S	*	*	H	α-helix	trans	-72.6	-38.8	-179	-156.5	-87.3	0	0	0	112.5	H5 R6 A7	W3-H5 PolarHBondContact O-N 2.92Å; W3-R6 PolarHBondContact O-N 2.83Å; W3-A7 PolarHBondContact O-N 2.81Å
4	G	73.5	Confident	82.7	Confident	42 Å²	42	115.9 Å²	115.9	43%	0.433	62%	0.616	S	S	.	*	H	α-helix	trans	-62.9	-40	179.1	0	0	0	0	0	112.5	R6 A7 T8	G4-R6 PolarHBondContact O-N 3.22Å; G4-A7 PolarHBondContact O-N 3.28Å; G4-T8 WeakPolarHBondContact O-CB 3.45Å; G4-T8 PolarHBondContact O-N 3.41Å; G4-T8 PolarHBondContact O-OG1 3.36Å
5	H	81.6	Confident	83.7	Confident	137 Å²	137	111.1 Å²	111.1	63%	0.634	61%	0.605	S	S	*	*	H	α-helix	trans	-62.5	-44.3	179	-174	-91.9	0	0	0	112.1	W3 T8 V9	W3-H5 PolarHBondContact O-N 2.92Å; H5-T8 PolarHBondContact O-N 3.31Å; H5-V9 VanDerWaalsContact O-CG2 3.24Å; H5-V9 WeakPolarHBondContact O-CG2 3.27Å; H5-V9 PolarHBondContact O-N 2.67Å
6	R	83.9	Confident	84.5	Confident	195 Å²	195	110.4 Å²	110.4	74%	0.736	61%	0.605	S	S	*	*	H	α-helix	trans	-63.7	-43.6	175.7	-72.9	-175.1	174.4	-114.9	0.9	111.6	W3 G4 V9 C10	W3-R6 PolarHBondContact O-N 2.83Å; G4-R6 PolarHBondContact O-N 3.22Å; R6-V9 PolarHBondContact O-N 2.8Å; R6-C10 PolarHBondContact O-N 2.86Å; R6-C10 PolarHBondContact O-SG 2.84Å
7	A	86.5	Confident	85.2	Confident	43 Å²	43	105.8 Å²	105.8	36%	0.355	59%	0.589	S	S	.	*	H	α-helix	trans	-61.5	-45.2	177.4	0	0	0	0	0	112	W3 G4 V9 C10 L11	W3-A7 PolarHBondContact O-N 2.81Å; G4-A7 PolarHBondContact O-N 3.28Å; A7-V9 PolarHBondContact O-N 3.02Å; A7-C10 PolarHBondContact O-N 3.49Å; A7-L11 VanDerWaalsContact O-CG 3.32Å; A7-L11 WeakPolarHBondContact O-CG 3.49Å; A7-L11 PolarHBondContact O-N 3.39Å
8	T	89.3	Confident	85.9	Confident	85 Å²	85	106 Å²	106	52%	0.521	59%	0.588	S	S	.	*	H	α-helix	trans	-62.1	-44.9	177.1	-56.2	0	0	0	0	111.4	G4 H5 C10 L11 V12	G4-T8 WeakPolarHBondContact O-CB 3.45Å; G4-T8 PolarHBondContact O-N 3.41Å; G4-T8 PolarHBondContact O-OG1 3.36Å; H5-T8 PolarHBondContact O-N 3.31Å; T8-C10 VanDerWaalsContact C-N 3.34Å; T8-C10 PolarHBondContact O-N 3.31Å; T8-L11 PolarHBondContact O-N 3.14Å; T8-V12 HydrophobicContact CG2-CG2 4.44Å; T8-V12 VanDerWaalsContact O-CG2 3.28Å; T8-V12 WeakPolarHBondContact O-CG2 3.45Å; T8-V12 PolarHBondContact O-N 3.41Å
9	V	90.9	Very high	86.4	Confident	64 Å²	64	102.1 Å²	102.1	39%	0.388	57%	0.574	S	S	.	*	H	α-helix	trans	-61	-43.9	176.8	172.3	0	0	0	0	110.9	H5 R6 A7 L11 V12 L13	H5-V9 VanDerWaalsContact O-CG2 3.24Å; H5-V9 WeakPolarHBondContact O-CG2 3.27Å; H5-V9 PolarHBondContact O-N 2.67Å; R6-V9 PolarHBondContact O-N 2.8Å; A7-V9 PolarHBondContact O-N 3.02Å; V9-L11 PolarHBondContact O-N 3.44Å; V9-V12 PolarHBondContact O-N 3.45Å; V9-L13 HydrophobicContact CG1-CD1 3.88Å; V9-L13 HydrophobicContact CG1-CG 4.36Å; V9-L13 WeakPolarHBondContact O-CB 3.14Å; V9-L13 VanDerWaalsContact O-CG 3.26Å; V9-L13 WeakPolarHBondContact O-CG 3.41Å; V9-L13 PolarHBondContact O-N 2.84Å
10	C	93.3	Very high	86.8	Confident	73 Å²	73	102.9 Å²	102.9	49%	0.493	58%	0.576	S	S	.	*	H	α-helix	trans	-60.9	-44.8	175.9	-71.4	0	0	0	0	112.2	R6 A7 T8 V12 L13 L14	R6-C10 PolarHBondContact O-N 2.86Å; R6-C10 PolarHBondContact O-SG 2.84Å; A7-C10 PolarHBondContact O-N 3.49Å; T8-C10 VanDerWaalsContact C-N 3.34Å; T8-C10 PolarHBondContact O-N 3.31Å; C10-V12 PolarHBondContact O-N 3.29Å; C10-L13 PolarHBondContact O-N 3.46Å; C10-L14 WeakPolarHBondContact O-CB 3.23Å; C10-L14 WeakPolarHBondContact O-CG 3.34Å; C10-L14 PolarHBondContact O-N 2.93Å
11	L	95.1	Very high	87.2	Confident	121 Å²	121	102.3 Å²	102.3	63%	0.634	58%	0.575	S	S	*	*	H	α-helix	trans	-63.5	-41	178.5	-71	173.3	0	0	0	112.1	A7 T8 V9 L14 G15	A7-L11 VanDerWaalsContact O-CG 3.32Å; A7-L11 WeakPolarHBondContact O-CG 3.49Å; A7-L11 PolarHBondContact O-N 3.39Å; T8-L11 PolarHBondContact O-N 3.14Å; V9-L11 PolarHBondContact O-N 3.44Å; L11-L14 PolarHBondContact O-N 3.37Å; L11-G15 PolarHBondContact O-N 2.79Å
12	V	95.1	Very high	89.1	Confident	85 Å²	85	96 Å²	96	52%	0.515	55%	0.545	S	S	.	.	H	α-helix	trans	-63.4	-48	176.2	171.5	0	0	0	0	110.6	T8 V9 C10 L14 G15 V16	T8-V12 HydrophobicContact CG2-CG2 4.44Å; T8-V12 VanDerWaalsContact O-CG2 3.28Å; T8-V12 WeakPolarHBondContact O-CG2 3.45Å; T8-V12 PolarHBondContact O-N 3.41Å; V9-V12 PolarHBondContact O-N 3.45Å; C10-V12 PolarHBondContact O-N 3.29Å; V12-L14 VanDerWaalsContact C-N 3.31Å; V12-L14 PolarHBondContact O-N 2.74Å; V12-G15 PolarHBondContact O-N 3.5Å; V12-V16 HydrophobicContact CG1-CG2 4.33Å; V12-V16 VanDerWaalsContact O-CG2 3.3Å; V12-V16 WeakPolarHBondContact O-CG2 3.19Å; V12-V16 PolarHBondContact O-N 2.92Å
13	L	96.3	Very high	90.4	Very high	117 Å²	117	96.8 Å²	96.8	61%	0.613	54%	0.541	S	S	*	.	H	α-helix	trans	-61.5	-40.6	178.5	-70.4	172.5	0	0	0	111.9	V9 C10 G17	V9-L13 HydrophobicContact CG1-CD1 3.88Å; V9-L13 HydrophobicContact CG1-CG 4.36Å; V9-L13 WeakPolarHBondContact O-CB 3.14Å; V9-L13 VanDerWaalsContact O-CG 3.26Å; V9-L13 WeakPolarHBondContact O-CG 3.41Å; V9-L13 PolarHBondContact O-N 2.84Å; C10-L13 PolarHBondContact O-N 3.46Å; L13-G17 PolarHBondContact O-N 3.32Å
14	L	96.8	Very high	91.6	Very high	119 Å²	119	89.7 Å²	89.7	62%	0.623	52%	0.523	S	S	*	.	H	α-helix	trans	-62.9	-45.6	175.4	-75.2	167.9	0	0	0	111.6	C10 L11 V12 G17 L18	C10-L14 WeakPolarHBondContact O-CB 3.23Å; C10-L14 WeakPolarHBondContact O-CG 3.34Å; C10-L14 PolarHBondContact O-N 2.93Å; L11-L14 PolarHBondContact O-N 3.37Å; V12-L14 VanDerWaalsContact C-N 3.31Å; V12-L14 PolarHBondContact O-N 2.74Å; L14-G17 PolarHBondContact O-N 3.02Å; L14-L18 WeakPolarHBondContact O-CB 3.23Å; L14-L18 PolarHBondContact O-N 3.49Å
15	G	96.8	Very high	92.2	Very high	44 Å²	44	92.1 Å²	92.1	45%	0.454	53%	0.526	S	S	.	.	H	α-helix	trans	-63	-45.5	178	0	0	0	0	0	112.7	L11 V12 L18 G19	L11-G15 PolarHBondContact O-N 2.79Å; V12-G15 PolarHBondContact O-N 3.5Å; G15-L18 PolarHBondContact O-N 3.45Å; G15-G19 PolarHBondContact O-N 2.98Å
16	V	96.9	Very high	92.2	Very high	99 Å²	99	88 Å²	88	60%	0.6	52%	0.516	S	S	*	.	H	α-helix	trans	-63.4	-47.3	177.9	173.2	0	0	0	0	110.9	V12 G19 L20	V12-V16 HydrophobicContact CG1-CG2 4.33Å; V12-V16 VanDerWaalsContact O-CG2 3.3Å; V12-V16 WeakPolarHBondContact O-CG2 3.19Å; V12-V16 PolarHBondContact O-N 2.92Å; V16-G19 PolarHBondContact O-N 2.91Å; V16-L20 WeakPolarHBondContact O-CB 3.32Å; V16-L20 PolarHBondContact O-N 3.41Å
17	G	96.6	Very high	91.9	Very high	32 Å²	32	81.8 Å²	81.8	33%	0.33	51%	0.506	S	S	.	.	H	α-helix	trans	-61.2	-46.2	178.3	0	0	0	0	0	112.1	L13 L14 L20 V21	L13-G17 PolarHBondContact O-N 3.32Å; L14-G17 PolarHBondContact O-N 3.02Å; G17-L20 PolarHBondContact O-N 2.99Å; G17-V21 WeakPolarHBondContact O-CG2 3.47Å; G17-V21 PolarHBondContact O-N 3.29Å
18	L	97.1	Very high	91.5	Very high	110 Å²	110	84.4 Å²	84.4	58%	0.576	52%	0.517	S	S	*	.	H	α-helix	trans	-63.5	-44.3	178.7	-176.8	60.4	0	0	0	111.8	L14 G15 L20 V21 I22	L14-L18 WeakPolarHBondContact O-CB 3.23Å; L14-L18 PolarHBondContact O-N 3.49Å; G15-L18 PolarHBondContact O-N 3.45Å; L18-L20 VanDerWaalsContact C-N 3.34Å; L18-L20 PolarHBondContact O-N 3.48Å; L18-V21 PolarHBondContact O-N 3.49Å; L18-I22 HydrophobicContact CD1-CD1 4.23Å; L18-I22 HydrophobicContact CD1-CG1 4.47Å; L18-I22 HydrophobicContact CG-CD1 3.96Å; L18-I22 VanDerWaalsContact O-CG1 3.26Å; L18-I22 WeakPolarHBondContact O-CG1 3.25Å; L18-I22 PolarHBondContact O-N 3.33Å
19	G	95.6	Very high	90.8	Very high	32 Å²	32	86.7 Å²	86.7	33%	0.33	53%	0.525	S	S	.	.	H	α-helix	trans	-59.1	-44.6	175.9	0	0	0	0	0	112.2	G15 V16 V21 I22 V23	G15-G19 PolarHBondContact O-N 2.98Å; V16-G19 PolarHBondContact O-N 2.91Å; G19-V21 PolarHBondContact O-N 3.37Å; G19-I22 PolarHBondContact O-N 2.91Å; G19-V23 WeakPolarHBondContact O-CG2 3.22Å; G19-V23 PolarHBondContact O-N 2.93Å
20	L	95.8	Very high	89	Confident	117 Å²	117	87.9 Å²	87.9	61%	0.613	54%	0.537	S	S	*	.	H	α-helix	trans	-62.3	-44.5	178	-170.1	71.2	0	0	0	111.8	V16 G17 L18 I22 V23 V24	V16-L20 WeakPolarHBondContact O-CB 3.32Å; V16-L20 PolarHBondContact O-N 3.41Å; G17-L20 PolarHBondContact O-N 2.99Å; L18-L20 VanDerWaalsContact C-N 3.34Å; L18-L20 PolarHBondContact O-N 3.48Å; L20-I22 VanDerWaalsContact C-N 3.33Å; L20-I22 PolarHBondContact O-N 2.9Å; L20-V23 PolarHBondContact O-N 2.97Å; L20-V24 VanDerWaalsContact O-CG2 3.32Å; L20-V24 WeakPolarHBondContact O-CG2 2.89Å; L20-V24 PolarHBondContact O-N 3.3Å
21	V	95.2	Very high	87.1	Confident	91 Å²	91	88.6 Å²	88.6	55%	0.552	54%	0.54	S	S	*	.	H	α-helix	trans	-60.6	-43.7	177.1	171.5	0	0	0	0	110.9	G17 L18 G19 V24 L25	G17-V21 WeakPolarHBondContact O-CG2 3.47Å; G17-V21 PolarHBondContact O-N 3.29Å; L18-V21 PolarHBondContact O-N 3.49Å; G19-V21 PolarHBondContact O-N 3.37Å; V21-V24 PolarHBondContact O-N 3.41Å; V21-L25 WeakPolarHBondContact O-CB 3.21Å; V21-L25 PolarHBondContact O-N 2.91Å
22	I	92.9	Very high	85.1	Confident	100 Å²	100	91.5 Å²	91.5	51%	0.513	54%	0.543	S	S	.	.	H	α-helix	trans	-62.6	-44.5	178	-67.1	165	0	0	0	110.8	L18 G19 L20 L25 A26	L18-I22 HydrophobicContact CD1-CD1 4.23Å; L18-I22 HydrophobicContact CD1-CG1 4.47Å; L18-I22 HydrophobicContact CG-CD1 3.96Å; L18-I22 VanDerWaalsContact O-CG1 3.26Å; L18-I22 WeakPolarHBondContact O-CG1 3.25Å; L18-I22 PolarHBondContact O-N 3.33Å; G19-I22 PolarHBondContact O-N 2.91Å; L20-I22 VanDerWaalsContact C-N 3.33Å; L20-I22 PolarHBondContact O-N 2.9Å; I22-L25 PolarHBondContact O-N 3.06Å; I22-A26 WeakPolarHBondContact O-CB 3.26Å; I22-A26 PolarHBondContact O-N 2.95Å
23	V	87.1	Confident	82.8	Confident	97 Å²	97	97.2 Å²	97.2	59%	0.588	56%	0.564	S	S	*	*	H	α-helix	trans	-63.1	-45.4	178.4	170.8	0	0	0	0	111.3	G19 L20 A26 A27	G19-V23 WeakPolarHBondContact O-CG2 3.22Å; G19-V23 PolarHBondContact O-N 2.93Å; L20-V23 PolarHBondContact O-N 2.97Å; V23-A26 PolarHBondContact O-N 3.24Å; V23-A27 WeakPolarHBondContact O-CB 3.22Å; V23-A27 PolarHBondContact O-N 3.43Å
24	V	86.7	Confident	80.4	Confident	81 Å²	81	94.7 Å²	94.7	49%	0.491	56%	0.56	S	S	.	*	H	α-helix	trans	-62.9	-46.6	177.2	171.4	0	0	0	0	110.3	L20 V21 A26 A27 V28	L20-V24 VanDerWaalsContact O-CG2 3.32Å; L20-V24 WeakPolarHBondContact O-CG2 2.89Å; L20-V24 PolarHBondContact O-N 3.3Å; V21-V24 PolarHBondContact O-N 3.41Å; V24-A26 VanDerWaalsContact C-N 3.32Å; V24-A26 PolarHBondContact O-N 2.95Å; V24-A27 PolarHBondContact O-N 3.37Å; V24-A27 VanDerWaalsContact O-N 3.14Å; V24-V28 HydrophobicContact CG1-CG2 4.27Å; V24-V28 WeakPolarHBondContact O-CB 3.46Å; V24-V28 VanDerWaalsContact O-CG2 3.27Å; V24-V28 WeakPolarHBondContact O-CG2 3.26Å; V24-V28 PolarHBondContact O-N 3.26Å
25	L	86.6	Confident	77.8	Confident	93 Å²	93	94.6 Å²	94.6	49%	0.487	57%	0.569	S	S	.	*	H	α-helix	trans	-62.6	-41.9	178.8	-173.1	63	0	0	0	110.9	V21 I22 A27 V28 L29	V21-L25 WeakPolarHBondContact O-CB 3.21Å; V21-L25 PolarHBondContact O-N 2.91Å; I22-L25 PolarHBondContact O-N 3.06Å; L25-A27 PolarHBondContact O-N 3.26Å; L25-V28 PolarHBondContact O-N 3.37Å; L25-L29 HydrophobicContact CD1-CD1 3.75Å; L25-L29 HydrophobicContact CD1-CG 3.94Å; L25-L29 HydrophobicContact CD2-CD1 4.31Å; L25-L29 HydrophobicContact CG-CD1 3.67Å; L25-L29 HydrophobicContact CG-CG 4.2Å; L25-L29 WeakPolarHBondContact O-CB 3.3Å; L25-L29 VanDerWaalsContact O-CG 3.25Å; L25-L29 WeakPolarHBondContact O-CG 3.32Å; L25-L29 PolarHBondContact O-N 3.49Å
26	A	81.3	Confident	75.2	Confident	51 Å²	51	98 Å²	98	42%	0.421	59%	0.585	S	S	.	*	H	α-helix	trans	-63.2	-38.7	173.5	0	0	0	0	0	112	I22 V23 V24 S30	I22-A26 WeakPolarHBondContact O-CB 3.26Å; I22-A26 PolarHBondContact O-N 2.95Å; V23-A26 PolarHBondContact O-N 3.24Å; V24-A26 VanDerWaalsContact C-N 3.32Å; V24-A26 PolarHBondContact O-N 2.95Å; A26-S30 VanDerWaalsContact O-CA 3.23Å; A26-S30 WeakPolarHBondContact O-CA 3.24Å; A26-S30 WeakPolarHBondContact O-CB 3.35Å; A26-S30 PolarHBondContact O-N 2.92Å
27	A	78.6	Confident	72.5	Confident	64 Å²	64	96 Å²	96	53%	0.529	58%	0.584	S	S	.	*	H	α-helix	trans	-68.6	-36.2	175.7	0	0	0	0	0	112.6	V23 V24 L25 S30	V23-A27 WeakPolarHBondContact O-CB 3.22Å; V23-A27 PolarHBondContact O-N 3.43Å; V24-A27 PolarHBondContact O-N 3.37Å; V24-A27 VanDerWaalsContact O-N 3.14Å; L25-A27 PolarHBondContact O-N 3.26Å; A27-S30 CarbonylContact O-C 3.49Å
28	V	77.6	Confident	70	Confident	98 Å²	98	101.4 Å²	101.4	59%	0.594	61%	0.613	S	S	*	*	H	α-helix	trans	-76.8	-35	179.1	171.2	0	0	0	0	112.3	V24 L25 P31	V24-V28 HydrophobicContact CG1-CG2 4.27Å; V24-V28 WeakPolarHBondContact O-CB 3.46Å; V24-V28 VanDerWaalsContact O-CG2 3.27Å; V24-V28 WeakPolarHBondContact O-CG2 3.26Å; V24-V28 PolarHBondContact O-N 3.26Å; L25-V28 PolarHBondContact O-N 3.37Å; V28-P31 VanDerWaalsContact O-CD 3.23Å; V28-P31 WeakPolarHBondContact O-CD 3.21Å; V28-P31 WeakPolarHBondContact O-CG 3.38Å
29	L	74.4	Confident	67.7	Low	132 Å²	132	99.5 Å²	99.5	69%	0.691	62%	0.62	S	S	*	*	H	α-helix	trans	-90.2	-24.5	178.6	-67.2	179.1	0	0	0	113.3	L25 P31	L25-L29 HydrophobicContact CD1-CD1 3.75Å; L25-L29 HydrophobicContact CD1-CG 3.94Å; L25-L29 HydrophobicContact CD2-CD1 4.31Å; L25-L29 HydrophobicContact CG-CD1 3.67Å; L25-L29 HydrophobicContact CG-CG 4.2Å; L25-L29 WeakPolarHBondContact O-CB 3.3Å; L25-L29 VanDerWaalsContact O-CG 3.25Å; L25-L29 WeakPolarHBondContact O-CG 3.32Å; L25-L29 PolarHBondContact O-N 3.49Å; L29-P31 WeakPolarHBondContact O-CD 3.28Å
30	S	53.3	Low	65.2	Low	89 Å²	89	101.4 Å²	101.4	62%	0.622	63%	0.633	S	S	*	*			trans	-108.9	47.5	170.4	-148	0	0	0	0	110.8	A26 A27 R32	A26-S30 VanDerWaalsContact O-CA 3.23Å; A26-S30 WeakPolarHBondContact O-CA 3.24Å; A26-S30 WeakPolarHBondContact O-CB 3.35Å; A26-S30 PolarHBondContact O-N 2.92Å; A27-S30 CarbonylContact O-C 3.49Å; S30-R32 VanDerWaalsContact C-N 3.27Å; S30-R32 PolarHBondContact O-N 3.45Å
31	P	53.7	Low	62.7	Low	88 Å²	88	104.8 Å²	104.8	57%	0.571	64%	0.643	S	S	*	*			trans	-63	108.3	166.2	27.9	-22.5	0	0	0	102.9	V28 L29 Q33	V28-P31 VanDerWaalsContact O-CD 3.23Å; V28-P31 WeakPolarHBondContact O-CD 3.21Å; V28-P31 WeakPolarHBondContact O-CG 3.38Å; L29-P31 WeakPolarHBondContact O-CD 3.28Å; P31-Q33 PolarHBondContact O-N 3.29Å
32	R	53.8	Low	60.5	Low	183 Å²	183	107 Å²	107	69%	0.691	66%	0.656	S	S	*	*			trans	-36.3	136.7	177.6	-79.3	-170	166.5	-151.5	-2.1	107.8	S30 A34	S30-R32 VanDerWaalsContact C-N 3.27Å; S30-R32 PolarHBondContact O-N 3.45Å; R32-A34 HydrophobicContact CB-CB 4.09Å; R32-A34 PolarHBondContact O-N 3.5Å
33	Q	46	Very low	58.4	Low	204 Å²	204	113.8 Å²	113.8	95%	0.953	68%	0.676	S	S	*	*	S	Bend	trans	-57.6	22.3	163.3	-60.9	178.7	-7.8	0	0	113.1	P31 S35	P31-Q33 PolarHBondContact O-N 3.29Å; Q33-S35 PolarHBondContact O-N 3.45Å
34	A	46.3	Very low	56.2	Low	64 Å²	64	113.3 Å²	113.3	53%	0.529	68%	0.682	S	S	.	*			trans	-84	64.1	160	0	0	0	0	0	108.4	R32 C36	R32-A34 HydrophobicContact CB-CB 4.09Å; R32-A34 PolarHBondContact O-N 3.5Å; A34-C36 PolarHBondContact O-N 3Å
35	S	41.1	Very low	54.1	Low	118 Å²	118	114.9 Å²	114.9	83%	0.825	70%	0.703	S	S	*	*			trans	-68.5	66.1	153.5	177.5	0	0	0	0	107.8	Q33	Q33-S35 PolarHBondContact O-N 3.45Å
36	C	41.7	Very low	51.9	Low	116 Å²	116	114.4 Å²	114.4	78%	0.784	70%	0.704	S	S	*	*			trans	-75.3	121.5	159.9	-77.5	0	0	0	0	106.1	A34	A34-C36 PolarHBondContact O-N 3Å
37	G	41.3	Very low	50.3	Low	55 Å²	55	115.8 Å²	115.8	57%	0.567	72%	0.716	S	S	*	*			trans	-55.4	165.9	-171.3	0	0	0	0	0	114.7	G39	G37-G39 PolarHBondContact O-N 3.44Å
38	P	44.1	Very low	48.4	Very low	147 Å²	147	117.2 Å²	117.2	96%	0.955	73%	0.727	S	S	*	*	S	Bend	trans	-67.9	99.9	-171.3	27.9	-32.9	0	0	0	110.2
39	G	49.2	Very low	47	Very low	69 Å²	69	120.5 Å²	120.5	71%	0.711	74%	0.742	S	S	*	*			trans	164.2	77.1	-179.5	0	0	0	0	0	112	G37	G37-G39 PolarHBondContact O-N 3.44Å
40	A	43.5	Very low	45.3	Very low	73 Å²	73	117.3 Å²	117.3	60%	0.603	73%	0.73	S	S	*	*			trans	123.9	142.1	133.5	0	0	0	0	0	117.1
41	F	42.8	Very low	44.8	Very low	187 Å²	187	122.9 Å²	122.9	82%	0.82	74%	0.743	S	S	*	*			trans	84.7	83.2	159	-46.6	-60.5	0	0	0	116.7	R43	F41-R43 PolarHBondContact O-N 2.92Å
42	T	49.1	Very low	44.3	Very low	137 Å²	137	125.3 Å²	125.3	84%	0.84	75%	0.75	S	S	*	*	S	Bend	trans	-22.5	117.4	137.1	47.5	0	0	0	0	113.3
43	R	47.6	Very low	43.9	Very low	243 Å²	243	121.4 Å²	121.4	92%	0.917	75%	0.75	S	S	*	*	S	Bend	trans	74.2	88	160.3	-165.4	-175.9	-66.9	-106.9	-0.1	116.6	F41	F41-R43 PolarHBondContact O-N 2.92Å
44	A	41.6	Very low	43.7	Very low	88 Å²	88	116.8 Å²	116.8	73%	0.727	74%	0.74	S	S	*	*			trans	172.5	117.6	133.6	0	0	0	0	0	109.6
45	A	41.7	Very low	43.8	Very low	113 Å²	113	121 Å²	121	93%	0.934	75%	0.754	S	S	*	*			trans	-92.6	105.3	170.1	0	0	0	0	0	108.6
46	V	41.3	Very low	44.1	Very low	83 Å²	83	122.1 Å²	122.1	50%	0.503	75%	0.749	S	S	.	*			trans	-106	116.2	173.9	178.3	0	0	0	0	108.4	C68	V46-C68 WeakPolarHBondContact CG2-SG 3.47Å
47	A	46.8	Very low	44.4	Very low	81 Å²	81	120.4 Å²	120.4	67%	0.669	75%	0.751	S	S	*	*			trans	-85.4	107.8	168.1	0	0	0	0	0	108.5
48	A	38.9	Very low	44.6	Very low	93 Å²	93	129.1 Å²	129.1	77%	0.769	77%	0.766	S	S	*	*			trans	-109.5	103.1	165.8	0	0	0	0	0	108.5
49	D	48.6	Very low	44.5	Very low	167 Å²	167	130.7 Å²	130.7	89%	0.893	76%	0.758	S	S	*	*			trans	-91.6	102.5	162.8	-175.8	81.4	0	0	0	107
50	S	38.5	Very low	44.4	Very low	65 Å²	65	133.8 Å²	133.8	46%	0.455	77%	0.766	S	S	.	*			trans	-158.7	123.7	156.8	77.7	0	0	0	0	111.2	I52 C53	S50-I52 PolarHBondContact O-N 2.85Å; S50-C53 PolarHBondContact O-N 3.44Å
51	K	43.4	Very low	44.3	Very low	206 Å²	206	134.4 Å²	134.4	90%	0.896	77%	0.771	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.3	2	-179.6	-155.1	167.3	-175.8	158.1	0	114
52	I	43.5	Very low	44.4	Very low	139 Å²	139	133.2 Å²	133.2	71%	0.713	77%	0.773	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.7	-12.4	-177.7	-85.6	92.6	0	0	0	113	S50 S54	S50-I52 PolarHBondContact O-N 2.85Å; I52-S54 PolarHBondContact O-N 3.37Å
53	C	44	Very low	43.8	Very low	101 Å²	101	132.2 Å²	132.2	68%	0.682	77%	0.772	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	11.7	179.9	-76.2	0	0	0	0	115.1	S50	S50-C53 PolarHBondContact O-N 3.44Å
54	S	41.8	Very low	43.8	Very low	107 Å²	107	126.8 Å²	126.8	75%	0.748	77%	0.771	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.8	-14.3	179.1	-162.2	0	0	0	0	114.2	I52	I52-S54 PolarHBondContact O-N 3.37Å
55	D	49.2	Very low	43.5	Very low	152 Å²	152	126 Å²	126	81%	0.813	77%	0.771	S	S	*	*	S	Bend	trans	-115.4	0.1	-169.6	-107.1	-60	0	0	0	115.9
56	I	47.7	Very low	43.5	Very low	143 Å²	143	129.3 Å²	129.3	73%	0.733	77%	0.772	S	S	*	*	S	Bend	trans	-107.2	-1.1	179.5	-47	-177.8	0	0	0	112.3	R58	I56-R58 VanDerWaalsContact C-N 3.26Å; I56-R58 PolarHBondContact O-N 2.93Å
57	G	47.1	Very low	43.3	Very low	79 Å²	79	128.6 Å²	128.6	81%	0.814	78%	0.781	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.4	-0.4	177.2	0	0	0	0	0	115.4
58	R	47.1	Very low	42.7	Very low	238 Å²	238	129.3 Å²	129.3	90%	0.898	78%	0.781	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.7	31	-179.5	-155.6	-178.9	169.9	161.9	-1.8	113.4	I56	I56-R58 VanDerWaalsContact C-N 3.26Å; I56-R58 PolarHBondContact O-N 2.93Å
59	K	41.4	Very low	42.3	Very low	181 Å²	181	133.2 Å²	133.2	79%	0.787	79%	0.788	S	S	*	*	S	Bend	trans	-141.4	128.4	158.9	-74.3	-160.3	167.5	69.2	0	109.9
60	P	47.9	Very low	42	Very low	133 Å²	133	131.2 Å²	131.2	86%	0.864	78%	0.784	S	S	*	*			trans	-87.2	113.6	-177.1	33	-27.5	0	0	0	109.1
61	A	40.3	Very low	41.9	Very low	87 Å²	87	136.7 Å²	136.7	72%	0.719	83%	0.833	S	S	*	*			trans	-173	128.5	156.9	0	0	0	0	0	110
62	D	45.3	Very low	41.8	Very low	161 Å²	161	133.2 Å²	133.2	86%	0.861	83%	0.83	S	S	*	*			trans	23.7	111.6	145	-77.3	-47.7	0	0	0	118.2
63	S	35.8	Very low	41.7	Very low	117 Å²	117	132.9 Å²	132.9	82%	0.818	84%	0.836	S	S	*	*			trans	178	118.8	130.1	34	0	0	0	0	111.8
64	S	47.4	Very low	41.6	Very low	129 Å²	129	134.7 Å²	134.7	90%	0.902	84%	0.844	S	S	*	*			trans	-39.4	135.7	153.4	-45.3	0	0	0	0	112.1
65	G	34.9	Very low	41.6	Very low	70 Å²	70	136.3 Å²	136.3	72%	0.722	85%	0.85	S	S	*	*			trans	174.9	89	171.3	0	0	0	0	0	115.9
66	L	43	Very low	41.1	Very low	184 Å²	184	135.3 Å²	135.3	96%	0.963	85%	0.852	S	S	*	*			trans	52.2	107.6	130.9	-145.7	78.9	0	0	0	118.3
67	G	36.3	Very low	40.7	Very low	67 Å²	67	134.8 Å²	134.8	69%	0.691	86%	0.86	S	S	*	*			trans	171.7	59.4	164	0	0	0	0	0	115.9
68	C	35.3	Very low	40.2	Very low	97 Å²	97	138.8 Å²	138.8	66%	0.655	86%	0.863	S	S	*	*			trans	-145.5	86.6	167.2	-77.2	0	0	0	0	110.5	V46	V46-C68 WeakPolarHBondContact CG2-SG 3.47Å
69	L	30	Very low	39.7	Very low	174 Å²	174	131.2 Å²	131.2	91%	0.911	86%	0.861	S	S	*	*			trans	-132.1	123.4	158.7	-109.1	95.9	0	0	0	108
70	P	42.6	Very low	39.6	Very low	126 Å²	126	127 Å²	127	82%	0.818	87%	0.867	S	S	*	*			trans	-92.1	138.1	164	32.9	-25.7	0	0	0	110.6
71	A	35.8	Very low	38.8	Very low	179 Å²	179	126.5 Å²	126.5	100%	1.479	87%	0.867	S	S	*	*			trans	-85.1	0	160.9	0	0	0	0	0	110.2

Retrieved 71 of 71 residues in 42.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).