A0A087WNR5_MOUSE Loading...

SLIT-ROBO Rho GTPase activating protein 2

AlphaFold DB , UniProt , Accession A0A087WNR5, Species MOUSE (Mus musculus, Mouse), Gene Srgap2, Length 55 aa.

						>A0A087WNR5_MOUSE|A0A087WNR5|Srgap2
MKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRSTKDQQF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.9	Low	89.2	Confident	196 Å²	196	123.5 Å²	123.5	97%	0.966	61%	0.611	S	S	*	*				0	-60.7	0	-98.2	166.5	172.7	0	0	112.1	C3 L4 D5	M1-C3 VanDerWaalsContact C-N 3.3Å; M1-C3 PolarHBondContact O-N 3.36Å; M1-L4 WeakPolarHBondContact O-CB 3.45Å; M1-L4 PolarHBondContact O-N 2.69Å; M1-D5 VanDerWaalsContact C-OD2 3.27Å; M1-D5 PolarHBondContact O-N 3.25Å
2	K	76.8	Confident	90	Very high	184 Å²	184	120.8 Å²	120.8	80%	0.8	61%	0.606	S	S	*	*	H	α-helix	trans	-42.5	-41.3	-176.5	-64.6	-172.6	177.3	-175.9	0	117.7	Q6	K2-Q6 WeakPolarHBondContact O-CB 3.28Å; K2-Q6 PolarHBondContact O-N 3.18Å
3	C	87.5	Confident	90.6	Very high	86 Å²	86	119.5 Å²	119.5	58%	0.581	60%	0.596	S	S	*	*	H	α-helix	trans	-67.5	-37.1	178.5	-177	0	0	0	0	112.9	M1 Q7	M1-C3 VanDerWaalsContact C-N 3.3Å; M1-C3 PolarHBondContact O-N 3.36Å; C3-Q7 VanDerWaalsContact O-CG 3.23Å; C3-Q7 WeakPolarHBondContact O-CG 3.41Å; C3-Q7 PolarHBondContact O-N 3.01Å
4	L	86.6	Confident	91.2	Very high	130 Å²	130	118.3 Å²	118.3	68%	0.681	59%	0.592	S	S	*	*	H	α-helix	trans	-70.6	-38.7	177.7	-68.2	169.8	0	0	0	111.3	M1 Q7 C8	M1-L4 WeakPolarHBondContact O-CB 3.45Å; M1-L4 PolarHBondContact O-N 2.69Å; L4-Q7 PolarHBondContact O-N 3.4Å; L4-C8 PolarHBondContact O-N 2.97Å
5	D	91	Very high	91.7	Very high	84 Å²	84	117.3 Å²	117.3	45%	0.449	59%	0.589	S	S	.	*	H	α-helix	trans	-64.1	-45.9	176.8	-55	-41	0	0	0	110.5	M1 Q7 C8 E9	M1-D5 VanDerWaalsContact C-OD2 3.27Å; M1-D5 PolarHBondContact O-N 3.25Å; D5-Q7 VanDerWaalsContact C-N 3.33Å; D5-Q7 PolarHBondContact O-N 3.29Å; D5-C8 VanDerWaalsContact O-CB 3.3Å; D5-C8 WeakPolarHBondContact O-CB 3.46Å; D5-C8 PolarHBondContact O-N 3.47Å; D5-E9 WeakPolarHBondContact O-CG 3.46Å; D5-E9 PolarHBondContact O-N 2.93Å
6	Q	94.3	Very high	92.1	Very high	110 Å²	110	114.8 Å²	114.8	51%	0.514	57%	0.574	S	S	.	*	H	α-helix	trans	-60.2	-40.5	175.1	-173.1	179.8	13.9	0	0	112.6	K2 C8 E9 L10	K2-Q6 WeakPolarHBondContact O-CB 3.28Å; K2-Q6 PolarHBondContact O-N 3.18Å; Q6-C8 VanDerWaalsContact C-N 3.29Å; Q6-C8 PolarHBondContact O-N 3.3Å; Q6-E9 PolarHBondContact O-N 3.21Å; Q6-L10 HydrophobicContact CG-CD1 4.26Å; Q6-L10 VanDerWaalsContact O-CG 3.3Å; Q6-L10 WeakPolarHBondContact O-CG 3.4Å; Q6-L10 PolarHBondContact O-N 3.47Å
7	Q	92.5	Very high	92.5	Very high	91 Å²	91	112.9 Å²	112.9	43%	0.425	57%	0.567	S	S	.	*	H	α-helix	trans	-64.6	-34.9	175.3	-74.2	-68.1	-29.2	0	0	112.1	C3 L4 D5 R11	C3-Q7 VanDerWaalsContact O-CG 3.23Å; C3-Q7 WeakPolarHBondContact O-CG 3.41Å; C3-Q7 PolarHBondContact O-N 3.01Å; L4-Q7 PolarHBondContact O-N 3.4Å; D5-Q7 VanDerWaalsContact C-N 3.33Å; D5-Q7 PolarHBondContact O-N 3.29Å; Q7-R11 VanDerWaalsContact O-CG 3.3Å; Q7-R11 WeakPolarHBondContact O-CG 3.47Å; Q7-R11 PolarHBondContact O-N 2.97Å
8	C	95.1	Very high	92.8	Very high	79 Å²	79	110.9 Å²	110.9	53%	0.534	56%	0.558	S	S	.	*	H	α-helix	trans	-65.9	-48.8	174.8	-164.4	0	0	0	0	110.9	L4 D5 Q6 L10 R11 V12	L4-C8 PolarHBondContact O-N 2.97Å; D5-C8 VanDerWaalsContact O-CB 3.3Å; D5-C8 WeakPolarHBondContact O-CB 3.46Å; D5-C8 PolarHBondContact O-N 3.47Å; Q6-C8 VanDerWaalsContact C-N 3.29Å; Q6-C8 PolarHBondContact O-N 3.3Å; C8-L10 VanDerWaalsContact C-N 3.34Å; C8-L10 PolarHBondContact O-N 3.04Å; C8-R11 PolarHBondContact O-N 3.25Å; C8-R11 VanDerWaalsContact O-N 3.14Å; C8-V12 WeakPolarHBondContact O-CG2 3.16Å; C8-V12 PolarHBondContact O-N 2.76Å
9	E	96.8	Very high	93.1	Very high	135 Å²	135	110.5 Å²	110.5	63%	0.631	55%	0.554	S	S	*	*	H	α-helix	trans	-57.9	-43.9	177.8	-70.3	170.6	-178.2	0	0	112.1	D5 Q6 R11 V12 Q13	D5-E9 WeakPolarHBondContact O-CG 3.46Å; D5-E9 PolarHBondContact O-N 2.93Å; Q6-E9 PolarHBondContact O-N 3.21Å; E9-R11 VanDerWaalsContact C-N 3.33Å; E9-R11 PolarHBondContact O-N 3.23Å; E9-V12 PolarHBondContact O-N 2.99Å; E9-Q13 PolarHBondContact O-N 3.29Å
10	L	97.1	Very high	93.4	Very high	96 Å²	96	108.2 Å²	108.2	50%	0.503	54%	0.543	S	S	.	.	H	α-helix	trans	-63.2	-38.4	177.1	-71.8	167.7	0	0	0	112.5	Q6 C8 Q13 L14	Q6-L10 HydrophobicContact CG-CD1 4.26Å; Q6-L10 VanDerWaalsContact O-CG 3.3Å; Q6-L10 WeakPolarHBondContact O-CG 3.4Å; Q6-L10 PolarHBondContact O-N 3.47Å; C8-L10 VanDerWaalsContact C-N 3.34Å; C8-L10 PolarHBondContact O-N 3.04Å; L10-Q13 PolarHBondContact O-N 3.08Å; L10-L14 WeakPolarHBondContact O-CB 3.37Å; L10-L14 PolarHBondContact O-N 3.06Å
11	R	96.8	Very high	93.7	Very high	168 Å²	168	109.2 Å²	109.2	63%	0.634	54%	0.544	S	S	*	.	H	α-helix	trans	-67.7	-40.2	176.1	-73.6	172.9	-177.1	-177.7	0.5	111.7	Q7 C8 E9 L14 L15	Q7-R11 VanDerWaalsContact O-CG 3.3Å; Q7-R11 WeakPolarHBondContact O-CG 3.47Å; Q7-R11 PolarHBondContact O-N 2.97Å; C8-R11 PolarHBondContact O-N 3.25Å; C8-R11 VanDerWaalsContact O-N 3.14Å; E9-R11 VanDerWaalsContact C-N 3.33Å; E9-R11 PolarHBondContact O-N 3.23Å; R11-L14 PolarHBondContact O-N 3.11Å; R11-L15 VanDerWaalsContact O-CG 3.28Å; R11-L15 WeakPolarHBondContact O-CG 3.28Å; R11-L15 PolarHBondContact O-N 3.21Å
12	V	98.3	Very high	95.2	Very high	91 Å²	91	105.8 Å²	105.8	55%	0.552	52%	0.524	S	S	*	.	H	α-helix	trans	-61.8	-46.7	175	171.9	0	0	0	0	110.3	C8 E9 L14 L15 Q16	C8-V12 WeakPolarHBondContact O-CG2 3.16Å; C8-V12 PolarHBondContact O-N 2.76Å; E9-V12 PolarHBondContact O-N 2.99Å; V12-L14 PolarHBondContact O-N 3.04Å; V12-L15 PolarHBondContact O-N 3.08Å; V12-Q16 PolarHBondContact O-N 3.16Å
13	Q	98.3	Very high	96.2	Very high	104 Å²	104	103.2 Å²	103.2	49%	0.486	51%	0.509	S	S	.	.	H	α-helix	trans	-60.2	-46.5	177.3	-172.8	61.7	53.5	0	0	111.7	E9 L10 L15 Q16 D17	E9-Q13 PolarHBondContact O-N 3.29Å; L10-Q13 PolarHBondContact O-N 3.08Å; Q13-L15 VanDerWaalsContact C-N 3.3Å; Q13-L15 PolarHBondContact O-N 2.91Å; Q13-Q16 WeakPolarHBondContact O-CB 3.2Å; Q13-Q16 PolarHBondContact O-N 3.18Å; Q13-Q16 VanDerWaalsContact O-N 3.11Å; Q13-D17 PolarHBondContact NE2-OD1 3.32Å; Q13-D17 VanDerWaalsContact O-CG 3.25Å; Q13-D17 PolarHBondContact O-N 3.48Å
14	L	98.3	Very high	96.8	Very high	102 Å²	102	104.8 Å²	104.8	53%	0.534	51%	0.506	S	S	.	.	H	α-helix	trans	-58.6	-42.8	177.3	177.6	63.3	0	0	0	112	L10 R11 V12 Q16 D17 L18	L10-L14 WeakPolarHBondContact O-CB 3.37Å; L10-L14 PolarHBondContact O-N 3.06Å; R11-L14 PolarHBondContact O-N 3.11Å; V12-L14 PolarHBondContact O-N 3.04Å; L14-Q16 VanDerWaalsContact C-N 3.31Å; L14-D17 PolarHBondContact O-N 3.15Å; L14-L18 HydrophobicContact CD1-CD1 4.45Å; L14-L18 HydrophobicContact CD1-CG 4.47Å; L14-L18 HydrophobicContact CG-CD1 4.25Å; L14-L18 WeakPolarHBondContact O-CB 3.46Å; L14-L18 VanDerWaalsContact O-CG 3.29Å; L14-L18 WeakPolarHBondContact O-CG 3.45Å; L14-L18 PolarHBondContact O-N 3.18Å
15	L	98.6	Very high	97.3	Very high	103 Å²	103	102.9 Å²	102.9	54%	0.539	49%	0.493	S	S	.	.	H	α-helix	trans	-66.3	-35.4	177.5	-71.9	172.9	0	0	0	112	R11 V12 Q13 Q19	R11-L15 VanDerWaalsContact O-CG 3.28Å; R11-L15 WeakPolarHBondContact O-CG 3.28Å; R11-L15 PolarHBondContact O-N 3.21Å; V12-L15 PolarHBondContact O-N 3.08Å; Q13-L15 VanDerWaalsContact C-N 3.3Å; Q13-L15 PolarHBondContact O-N 2.91Å; L15-Q19 VanDerWaalsContact O-CG 3.28Å; L15-Q19 WeakPolarHBondContact O-CG 3.42Å; L15-Q19 PolarHBondContact O-N 2.82Å; L15-Q19 PolarHBondContact O-NE2 3.22Å
16	Q	98.6	Very high	97.7	Very high	77 Å²	77	101.4 Å²	101.4	36%	0.36	49%	0.492	S	S	.	.	H	α-helix	trans	-65.7	-47.9	174.4	-175.4	58.2	47.5	0	0	111	V12 Q13 L14 L18 Q19 D20	V12-Q16 PolarHBondContact O-N 3.16Å; Q13-Q16 WeakPolarHBondContact O-CB 3.2Å; Q13-Q16 PolarHBondContact O-N 3.18Å; Q13-Q16 VanDerWaalsContact O-N 3.11Å; L14-Q16 VanDerWaalsContact C-N 3.31Å; Q16-L18 VanDerWaalsContact C-N 3.29Å; Q16-L18 PolarHBondContact O-N 3.33Å; Q16-Q19 WeakPolarHBondContact O-CB 3.38Å; Q16-Q19 PolarHBondContact O-N 3.33Å; Q16-Q19 VanDerWaalsContact O-N 3.1Å; Q16-D20 VanDerWaalsContact NE2-CG 3.35Å; Q16-D20 PolarHBondContact NE2-OD1 2.87Å; Q16-D20 VanDerWaalsContact NE2-OD1 3.13Å; Q16-D20 PolarHBondContact NE2-OD2 2.96Å; Q16-D20 PolarHBondContact O-N 3.48Å
17	D	98.7	Very high	97.9	Very high	83 Å²	83	100.2 Å²	100.2	44%	0.444	49%	0.487	S	S	.	.	H	α-helix	trans	-60.5	-40.4	178.7	-64.2	-14.8	0	0	0	111.3	Q13 L14 D20 F21	Q13-D17 PolarHBondContact NE2-OD1 3.32Å; Q13-D17 VanDerWaalsContact O-CG 3.25Å; Q13-D17 PolarHBondContact O-N 3.48Å; L14-D17 PolarHBondContact O-N 3.15Å; D17-D20 PolarHBondContact O-N 3.23Å; D17-F21 VanDerWaalsContact O-CB 3.31Å; D17-F21 WeakPolarHBondContact O-CB 3.39Å; D17-F21 PolarHBondContact O-N 2.92Å
18	L	98.8	Very high	98.2	Very high	78 Å²	78	100.6 Å²	100.6	41%	0.408	49%	0.49	S	S	.	.	H	α-helix	trans	-63.8	-43.3	174.6	-75.1	171.5	0	0	0	111.9	L14 Q16 D20 F21 F22	L14-L18 HydrophobicContact CD1-CD1 4.45Å; L14-L18 HydrophobicContact CD1-CG 4.47Å; L14-L18 HydrophobicContact CG-CD1 4.25Å; L14-L18 WeakPolarHBondContact O-CB 3.46Å; L14-L18 VanDerWaalsContact O-CG 3.29Å; L14-L18 WeakPolarHBondContact O-CG 3.45Å; L14-L18 PolarHBondContact O-N 3.18Å; Q16-L18 VanDerWaalsContact C-N 3.29Å; Q16-L18 PolarHBondContact O-N 3.33Å; L18-D20 VanDerWaalsContact C-N 3.34Å; L18-F21 PolarHBondContact O-N 3.47Å; L18-F22 HydrophobicContact CD2-CE2 4.43Å; L18-F22 WeakPolarHBondContact O-CD2 3.47Å; L18-F22 PolarHBondContact O-N 3.28Å
19	Q	98.7	Very high	98.4	Very high	103 Å²	103	101.3 Å²	101.3	48%	0.481	49%	0.486	S	S	.	.	H	α-helix	trans	-61.5	-44.4	176.5	-76.6	173.9	55.2	0	0	111.7	L15 Q16 F22 R23	L15-Q19 VanDerWaalsContact O-CG 3.28Å; L15-Q19 WeakPolarHBondContact O-CG 3.42Å; L15-Q19 PolarHBondContact O-N 2.82Å; L15-Q19 PolarHBondContact O-NE2 3.22Å; Q16-Q19 WeakPolarHBondContact O-CB 3.38Å; Q16-Q19 PolarHBondContact O-N 3.33Å; Q16-Q19 VanDerWaalsContact O-N 3.1Å; Q19-F22 PolarHBondContact O-N 2.92Å; Q19-R23 WeakPolarHBondContact O-CB 3.38Å; Q19-R23 PolarHBondContact O-N 2.88Å
20	D	98.8	Very high	98.5	Very high	63 Å²	63	100.2 Å²	100.2	34%	0.337	48%	0.482	S	S	.	.	H	α-helix	trans	-67.6	-38.5	179.9	-67	-26.5	0	0	0	111.3	Q16 D17 L18 R23 K24	Q16-D20 VanDerWaalsContact NE2-CG 3.35Å; Q16-D20 PolarHBondContact NE2-OD1 2.87Å; Q16-D20 VanDerWaalsContact NE2-OD1 3.13Å; Q16-D20 PolarHBondContact NE2-OD2 2.96Å; Q16-D20 PolarHBondContact O-N 3.48Å; D17-D20 PolarHBondContact O-N 3.23Å; L18-D20 VanDerWaalsContact C-N 3.34Å; D20-R23 PolarHBondContact O-N 3.25Å; D20-R23 IonicContact OD1-CZ 2.68Å; D20-R23 IonicContact OD1-NH1 2.68Å; D20-R23 PolarHBondContact OD1-NH1 3.05Å; D20-K24 WeakPolarHBondContact O-CB 3.33Å; D20-K24 PolarHBondContact O-N 3.3Å
21	F	98.8	Very high	98.5	Very high	130 Å²	130	99.5 Å²	99.5	57%	0.57	48%	0.479	S	S	*	.	H	α-helix	trans	-58.8	-51.5	172.1	177.4	-95.7	0	0	0	111.9	D17 L18 R23 K24 K25	D17-F21 VanDerWaalsContact O-CB 3.31Å; D17-F21 WeakPolarHBondContact O-CB 3.39Å; D17-F21 PolarHBondContact O-N 2.92Å; L18-F21 PolarHBondContact O-N 3.47Å; F21-R23 VanDerWaalsContact C-N 3.35Å; F21-R23 PolarHBondContact O-N 3.39Å; F21-K24 PolarHBondContact O-N 3.39Å; F21-K25 WeakPolarHBondContact O-CB 3.47Å; F21-K25 PolarHBondContact O-N 3.42Å
22	F	98.8	Very high	98.6	Very high	124 Å²	124	98.3 Å²	98.3	54%	0.544	48%	0.475	S	S	.	.	H	α-helix	trans	-67.8	-35.2	-179.4	-77.4	-62.9	0	0	0	112.5	L18 Q19 K25 A26	L18-F22 HydrophobicContact CD2-CE2 4.43Å; L18-F22 WeakPolarHBondContact O-CD2 3.47Å; L18-F22 PolarHBondContact O-N 3.28Å; Q19-F22 PolarHBondContact O-N 2.92Å; F22-K25 PolarHBondContact O-N 2.99Å; F22-A26 WeakPolarHBondContact O-CB 3.43Å; F22-A26 PolarHBondContact O-N 2.61Å
23	R	98.8	Very high	98.6	Very high	130 Å²	130	97.4 Å²	97.4	49%	0.491	47%	0.473	S	S	.	.	H	α-helix	trans	-60.3	-48.6	172.9	-170.7	-179.7	-60.4	118.6	6.3	110.3	Q19 D20 F21 K25 A26 E27	Q19-R23 WeakPolarHBondContact O-CB 3.38Å; Q19-R23 PolarHBondContact O-N 2.88Å; D20-R23 PolarHBondContact O-N 3.25Å; D20-R23 IonicContact OD1-CZ 2.68Å; D20-R23 IonicContact OD1-NH1 2.68Å; D20-R23 PolarHBondContact OD1-NH1 3.05Å; F21-R23 VanDerWaalsContact C-N 3.35Å; F21-R23 PolarHBondContact O-N 3.39Å; R23-K25 VanDerWaalsContact C-N 3.33Å; R23-K25 PolarHBondContact O-N 2.89Å; R23-A26 PolarHBondContact O-N 3.33Å; R23-E27 PolarHBondContact O-N 3.35Å; R23-E27 VanDerWaalsContact O-N 3.09Å
24	K	98.8	Very high	98.7	Very high	119 Å²	119	98.7 Å²	98.7	52%	0.517	47%	0.474	S	S	.	.	H	α-helix	trans	-64.5	-40.1	179.4	-170.4	55.6	177.5	176.2	0	112.3	D20 F21 E27 I28	D20-K24 WeakPolarHBondContact O-CB 3.33Å; D20-K24 PolarHBondContact O-N 3.3Å; F21-K24 PolarHBondContact O-N 3.39Å; K24-E27 WeakPolarHBondContact CD-OE2 3.38Å; K24-E27 IonicContact NZ-OE2 2.88Å; K24-E27 PolarHBondContact NZ-OE2 3Å; K24-E27 PolarHBondContact O-N 3.18Å; K24-I28 HydrophobicContact CG-CD1 4.35Å; K24-I28 WeakPolarHBondContact O-CG1 3.48Å; K24-I28 PolarHBondContact O-N 2.89Å
25	K	98.4	Very high	98.7	Very high	90 Å²	90	98.3 Å²	98.3	39%	0.391	47%	0.472	S	S	.	.	H	α-helix	trans	-60.3	-45.8	174.5	-170.6	-177.6	-171.7	-60.9	0	111.3	F21 F22 R23 E27 I28 E29	F21-K25 WeakPolarHBondContact O-CB 3.47Å; F21-K25 PolarHBondContact O-N 3.42Å; F22-K25 PolarHBondContact O-N 2.99Å; R23-K25 VanDerWaalsContact C-N 3.33Å; R23-K25 PolarHBondContact O-N 2.89Å; K25-E27 VanDerWaalsContact C-N 3.34Å; K25-E27 PolarHBondContact O-N 3.43Å; K25-I28 PolarHBondContact O-N 3.4Å; K25-E29 HydrophobicContact CG-CG 4.31Å; K25-E29 IonicContact NZ-OE1 3.72Å; K25-E29 PolarHBondContact NZ-OE1 3.48Å; K25-E29 VanDerWaalsContact O-CG 3.3Å; K25-E29 WeakPolarHBondContact O-CG 3.35Å; K25-E29 PolarHBondContact O-N 3.09Å
26	A	98.8	Very high	98.7	Very high	53 Å²	53	97.2 Å²	97.2	44%	0.438	47%	0.466	S	S	.	.	H	α-helix	trans	-62.4	-39.8	-179.5	0	0	0	0	0	112.5	F22 R23 I28 E29 M30	F22-A26 WeakPolarHBondContact O-CB 3.43Å; F22-A26 PolarHBondContact O-N 2.61Å; R23-A26 PolarHBondContact O-N 3.33Å; A26-I28 PolarHBondContact O-N 3.43Å; A26-E29 PolarHBondContact O-N 3.22Å; A26-M30 VanDerWaalsContact O-CB 3.29Å; A26-M30 WeakPolarHBondContact O-CB 3.3Å; A26-M30 PolarHBondContact O-N 2.68Å
27	E	98.8	Very high	98.6	Very high	86 Å²	86	99.1 Å²	99.1	40%	0.402	48%	0.475	S	S	.	.	H	α-helix	trans	-56.8	-48.9	173.3	-71	171.6	-171.7	0	0	111.5	R23 K24 K25 M30 D31	R23-E27 PolarHBondContact O-N 3.35Å; R23-E27 VanDerWaalsContact O-N 3.09Å; K24-E27 WeakPolarHBondContact CD-OE2 3.38Å; K24-E27 IonicContact NZ-OE2 2.88Å; K24-E27 PolarHBondContact NZ-OE2 3Å; K24-E27 PolarHBondContact O-N 3.18Å; K25-E27 VanDerWaalsContact C-N 3.34Å; K25-E27 PolarHBondContact O-N 3.43Å; E27-M30 PolarHBondContact O-N 2.94Å; E27-D31 PolarHBondContact O-N 3.43Å
28	I	98.8	Very high	98.6	Very high	98 Å²	98	100.6 Å²	100.6	50%	0.503	48%	0.478	S	S	.	.	H	α-helix	trans	-62.8	-47.6	-179	-66.2	166.2	0	0	0	111	K24 K25 A26 M30 D31 Y32	K24-I28 HydrophobicContact CG-CD1 4.35Å; K24-I28 WeakPolarHBondContact O-CG1 3.48Å; K24-I28 PolarHBondContact O-N 2.89Å; K25-I28 PolarHBondContact O-N 3.4Å; A26-I28 PolarHBondContact O-N 3.43Å; I28-M30 VanDerWaalsContact C-N 3.28Å; I28-M30 PolarHBondContact O-N 3.29Å; I28-D31 PolarHBondContact O-N 3.45Å; I28-Y32 WeakPolarHBondContact O-CB 3.34Å; I28-Y32 PolarHBondContact O-N 2.88Å
29	E	98.8	Very high	98.4	Very high	94 Å²	94	101 Å²	101	44%	0.439	48%	0.48	S	S	.	.	H	α-helix	trans	-61.8	-38.1	178.9	-66.7	-70.1	176.6	0	0	111.5	K25 A26 Y32 S33	K25-E29 HydrophobicContact CG-CG 4.31Å; K25-E29 IonicContact NZ-OE1 3.72Å; K25-E29 PolarHBondContact NZ-OE1 3.48Å; K25-E29 VanDerWaalsContact O-CG 3.3Å; K25-E29 WeakPolarHBondContact O-CG 3.35Å; K25-E29 PolarHBondContact O-N 3.09Å; A26-E29 PolarHBondContact O-N 3.22Å; E29-Y32 PolarHBondContact O-N 2.68Å; E29-S33 VanDerWaalsContact O-CB 3.28Å; E29-S33 WeakPolarHBondContact O-CB 3.29Å; E29-S33 PolarHBondContact O-N 2.82Å
30	M	98.6	Very high	98.3	Very high	113 Å²	113	98 Å²	98	56%	0.557	47%	0.473	S	S	*	.	H	α-helix	trans	-70.1	-39.9	178.5	-169.3	-175.9	-61.8	0	0	112.4	A26 E27 I28 R34	A26-M30 VanDerWaalsContact O-CB 3.29Å; A26-M30 WeakPolarHBondContact O-CB 3.3Å; A26-M30 PolarHBondContact O-N 2.68Å; E27-M30 PolarHBondContact O-N 2.94Å; I28-M30 VanDerWaalsContact C-N 3.28Å; I28-M30 PolarHBondContact O-N 3.29Å; M30-R34 WeakPolarHBondContact O-CB 3.28Å; M30-R34 WeakPolarHBondContact O-CG 3.31Å; M30-R34 PolarHBondContact O-N 3.46Å; M30-R34 PolarHBondContact O-NE 2.98Å
31	D	98.7	Very high	98.2	Very high	81 Å²	81	100.4 Å²	100.4	43%	0.433	48%	0.482	S	S	.	.	H	α-helix	trans	-64	-43.9	173.4	-80.1	-18.5	0	0	0	111.3	E27 I28 R34 N35	E27-D31 PolarHBondContact O-N 3.43Å; I28-D31 PolarHBondContact O-N 3.45Å; D31-R34 PolarHBondContact O-N 2.96Å; D31-R34 IonicContact OD1-CZ 3.34Å; D31-R34 IonicContact OD1-NE 3.87Å; D31-R34 IonicContact OD1-NH2 2.61Å; D31-R34 PolarHBondContact OD1-NH2 2.89Å; D31-N35 VanDerWaalsContact O-CG 3.3Å; D31-N35 PolarHBondContact O-N 3.42Å; D31-N35 PolarHBondContact O-ND2 3.1Å
32	Y	98.6	Very high	98	Very high	142 Å²	142	103 Å²	103	56%	0.557	49%	0.488	S	S	*	.	H	α-helix	trans	-61.8	-48.4	177.5	-176.1	-114.6	0	0	0	111.8	I28 E29 R34 N35 L36	I28-Y32 WeakPolarHBondContact O-CB 3.34Å; I28-Y32 PolarHBondContact O-N 2.88Å; E29-Y32 PolarHBondContact O-N 2.68Å; Y32-R34 PolarHBondContact O-N 2.88Å; Y32-N35 PolarHBondContact O-N 2.93Å; Y32-N35 VanDerWaalsContact O-N 3.11Å; Y32-L36 HydrophobicContact CD1-CD1 3.98Å; Y32-L36 HydrophobicContact CE1-CD1 3.5Å; Y32-L36 VanDerWaalsContact CE1-CD1 3.5Å; Y32-L36 HydrophobicContact CE1-CG 4.18Å; Y32-L36 HydrophobicContact CE2-CD2 4.45Å; Y32-L36 HydrophobicContact CE2-CG 4.42Å; Y32-L36 PolarHBondContact O-N 3.05Å
33	S	98.6	Very high	97.7	Very high	72 Å²	72	103.4 Å²	103.4	50%	0.503	49%	0.49	S	S	.	.	H	α-helix	trans	-56.7	-46.4	175.9	179.6	0	0	0	0	112.2	E29 N35 L36 E37	E29-S33 VanDerWaalsContact O-CB 3.28Å; E29-S33 WeakPolarHBondContact O-CB 3.29Å; E29-S33 PolarHBondContact O-N 2.82Å; S33-N35 VanDerWaalsContact C-N 3.29Å; S33-N35 PolarHBondContact O-N 2.87Å; S33-L36 PolarHBondContact O-N 2.95Å; S33-E37 PolarHBondContact O-N 3.42Å
34	R	98.6	Very high	97.4	Very high	132 Å²	132	102.5 Å²	102.5	50%	0.498	49%	0.494	S	S	.	.	H	α-helix	trans	-61.2	-35.9	176.1	-78.8	-175.6	-76.7	169.7	-7	113.1	M30 D31 Y32 K38	M30-R34 WeakPolarHBondContact O-CB 3.28Å; M30-R34 WeakPolarHBondContact O-CG 3.31Å; M30-R34 PolarHBondContact O-N 3.46Å; M30-R34 PolarHBondContact O-NE 2.98Å; D31-R34 PolarHBondContact O-N 2.96Å; D31-R34 IonicContact OD1-CZ 3.34Å; D31-R34 IonicContact OD1-NE 3.87Å; D31-R34 IonicContact OD1-NH2 2.61Å; D31-R34 PolarHBondContact OD1-NH2 2.89Å; Y32-R34 PolarHBondContact O-N 2.88Å; R34-K38 WeakPolarHBondContact O-CG 3.11Å; R34-K38 PolarHBondContact O-N 3.4Å
35	N	98.3	Very high	96.9	Very high	94 Å²	94	99.3 Å²	99.3	50%	0.503	49%	0.49	S	S	.	.	H	α-helix	trans	-71.3	-36.5	177.4	-71.7	-25.7	0	0	0	112.1	D31 Y32 S33 L39	D31-N35 VanDerWaalsContact O-CG 3.3Å; D31-N35 PolarHBondContact O-N 3.42Å; D31-N35 PolarHBondContact O-ND2 3.1Å; Y32-N35 PolarHBondContact O-N 2.93Å; Y32-N35 VanDerWaalsContact O-N 3.11Å; S33-N35 VanDerWaalsContact C-N 3.29Å; S33-N35 PolarHBondContact O-N 2.87Å; N35-L39 WeakPolarHBondContact O-CB 3.38Å; N35-L39 PolarHBondContact O-N 3.38Å; N35-L39 VanDerWaalsContact O-N 3.08Å
36	L	98.4	Very high	96.1	Very high	80 Å²	80	102.1 Å²	102.1	42%	0.419	50%	0.502	S	S	.	.	H	α-helix	trans	-64.6	-42.3	173.2	-69.8	178.4	0	0	0	111.9	Y32 S33 L39 A40	Y32-L36 HydrophobicContact CD1-CD1 3.98Å; Y32-L36 HydrophobicContact CE1-CD1 3.5Å; Y32-L36 VanDerWaalsContact CE1-CD1 3.5Å; Y32-L36 HydrophobicContact CE1-CG 4.18Å; Y32-L36 HydrophobicContact CE2-CD2 4.45Å; Y32-L36 HydrophobicContact CE2-CG 4.42Å; Y32-L36 PolarHBondContact O-N 3.05Å; S33-L36 PolarHBondContact O-N 2.95Å; L36-L39 WeakPolarHBondContact O-CB 3.29Å; L36-L39 PolarHBondContact O-N 2.98Å; L36-L39 VanDerWaalsContact O-N 3.16Å; L36-A40 PolarHBondContact O-N 3.46Å
37	E	97.8	Very high	95.1	Very high	116 Å²	116	103 Å²	103	54%	0.542	50%	0.502	S	S	.	.	H	α-helix	trans	-59.8	-49.9	177.4	-168.6	62.6	-147.6	0	0	111.1	S33 L39 A40 E41	S33-E37 PolarHBondContact O-N 3.42Å; E37-L39 PolarHBondContact O-N 3.13Å; E37-A40 WeakPolarHBondContact O-CB 3.44Å; E37-A40 PolarHBondContact O-N 2.92Å; E37-A40 VanDerWaalsContact O-N 3.08Å; E37-E41 WeakPolarHBondContact O-CG 3.3Å; E37-E41 PolarHBondContact O-N 3.34Å
38	K	97.4	Very high	93.9	Very high	115 Å²	115	107.7 Å²	107.7	50%	0.5	52%	0.517	S	S	.	.	H	α-helix	trans	-57.7	-36.6	175.7	-71.4	173.5	-175.6	174	0	112.6	R34 R42	R34-K38 WeakPolarHBondContact O-CG 3.11Å; R34-K38 PolarHBondContact O-N 3.4Å; K38-R42 VanDerWaalsContact O-CG 3.28Å; K38-R42 WeakPolarHBondContact O-CG 3.41Å; K38-R42 PolarHBondContact O-N 2.97Å
39	L	96.6	Very high	92.4	Very high	85 Å²	85	106.4 Å²	106.4	45%	0.445	52%	0.516	S	S	.	.	H	α-helix	trans	-67.1	-46.3	176.9	-176.9	61.8	0	0	0	110.6	N35 L36 E37 R42 F43	N35-L39 WeakPolarHBondContact O-CB 3.38Å; N35-L39 PolarHBondContact O-N 3.38Å; N35-L39 VanDerWaalsContact O-N 3.08Å; L36-L39 WeakPolarHBondContact O-CB 3.29Å; L36-L39 PolarHBondContact O-N 2.98Å; L36-L39 VanDerWaalsContact O-N 3.16Å; E37-L39 PolarHBondContact O-N 3.13Å; L39-R42 PolarHBondContact O-N 3.26Å; L39-F43 HydrophobicContact CD1-CD2 4.06Å; L39-F43 HydrophobicContact CD1-CE2 3.52Å; L39-F43 HydrophobicContact CD1-CZ 4.44Å; L39-F43 HydrophobicContact CD2-CE2 4.36Å; L39-F43 HydrophobicContact CG-CD2 4.03Å; L39-F43 HydrophobicContact CG-CE2 3.73Å; L39-F43 WeakPolarHBondContact O-CD2 3.49Å; L39-F43 PolarHBondContact O-N 2.95Å
40	A	95.9	Very high	90.7	Very high	42 Å²	42	105 Å²	105	35%	0.347	51%	0.514	S	S	.	.	H	α-helix	trans	-60	-46.6	176.7	0	0	0	0	0	111.7	L36 E37 R42 F43 L44	L36-A40 PolarHBondContact O-N 3.46Å; E37-A40 WeakPolarHBondContact O-CB 3.44Å; E37-A40 PolarHBondContact O-N 2.92Å; E37-A40 VanDerWaalsContact O-N 3.08Å; A40-R42 VanDerWaalsContact C-N 3.3Å; A40-R42 PolarHBondContact O-N 3.42Å; A40-F43 PolarHBondContact O-N 3.35Å; A40-F43 VanDerWaalsContact O-N 3.15Å; A40-L44 WeakPolarHBondContact O-CG 3.46Å; A40-L44 PolarHBondContact O-N 2.93Å
41	E	95.9	Very high	89	Confident	112 Å²	112	105.9 Å²	105.9	52%	0.523	52%	0.515	S	S	.	.	H	α-helix	trans	-55.4	-43.6	175.9	-73.5	177.6	163.1	0	0	112.1	E37 F43 L44 A45	E37-E41 WeakPolarHBondContact O-CG 3.3Å; E37-E41 PolarHBondContact O-N 3.34Å; E41-F43 PolarHBondContact O-N 3.25Å; E41-L44 PolarHBondContact O-N 3.39Å; E41-A45 VanDerWaalsContact O-CB 3.28Å; E41-A45 WeakPolarHBondContact O-CB 3.41Å; E41-A45 PolarHBondContact O-N 3Å
42	R	94.3	Very high	87.2	Confident	185 Å²	185	107.8 Å²	107.8	70%	0.698	53%	0.525	S	S	*	.	H	α-helix	trans	-62.1	-43.2	177.3	-74.8	171.3	178.8	-167.7	-0.4	112.4	K38 L39 A40 K46	K38-R42 VanDerWaalsContact O-CG 3.28Å; K38-R42 WeakPolarHBondContact O-CG 3.41Å; K38-R42 PolarHBondContact O-N 2.97Å; L39-R42 PolarHBondContact O-N 3.26Å; A40-R42 VanDerWaalsContact C-N 3.3Å; A40-R42 PolarHBondContact O-N 3.42Å; R42-K46 WeakPolarHBondContact O-CB 3.28Å; R42-K46 PolarHBondContact O-N 3.11Å
43	F	93.3	Very high	85.5	Confident	132 Å²	132	109 Å²	109	58%	0.579	54%	0.536	S	S	*	.	H	α-helix	trans	-66	-41.3	177.1	-79.9	-69.2	0	0	0	111.8	L39 A40 E41 K46 T47	L39-F43 HydrophobicContact CD1-CD2 4.06Å; L39-F43 HydrophobicContact CD1-CE2 3.52Å; L39-F43 HydrophobicContact CD1-CZ 4.44Å; L39-F43 HydrophobicContact CD2-CE2 4.36Å; L39-F43 HydrophobicContact CG-CD2 4.03Å; L39-F43 HydrophobicContact CG-CE2 3.73Å; L39-F43 WeakPolarHBondContact O-CD2 3.49Å; L39-F43 PolarHBondContact O-N 2.95Å; A40-F43 PolarHBondContact O-N 3.35Å; A40-F43 VanDerWaalsContact O-N 3.15Å; E41-F43 PolarHBondContact O-N 3.25Å; F43-K46 PolarHBondContact O-N 3.39Å; F43-T47 WeakPolarHBondContact O-CB 3.3Å; F43-T47 PolarHBondContact O-N 3.06Å; F43-T47 PolarHBondContact O-OG1 3.07Å
44	L	91.7	Very high	83.5	Confident	111 Å²	111	113.3 Å²	113.3	58%	0.581	55%	0.548	S	S	*	.	H	α-helix	trans	-66.2	-43.1	177.2	-70.4	173.2	0	0	0	111.9	A40 E41 T47 R48	A40-L44 WeakPolarHBondContact O-CG 3.46Å; A40-L44 PolarHBondContact O-N 2.93Å; E41-L44 PolarHBondContact O-N 3.39Å; L44-T47 PolarHBondContact O-N 3.39Å; L44-R48 WeakPolarHBondContact O-CG 3.3Å; L44-R48 PolarHBondContact O-N 3.03Å
45	A	88.9	Confident	81.2	Confident	53 Å²	53	118.3 Å²	118.3	44%	0.438	57%	0.574	S	S	.	*	H	α-helix	trans	-60.2	-47	175.8	0	0	0	0	0	111.1	E41 T47 R48 S49	E41-A45 VanDerWaalsContact O-CB 3.28Å; E41-A45 WeakPolarHBondContact O-CB 3.41Å; E41-A45 PolarHBondContact O-N 3Å; A45-T47 VanDerWaalsContact C-N 3.33Å; A45-T47 PolarHBondContact O-N 2.98Å; A45-R48 PolarHBondContact O-N 3Å; A45-S49 PolarHBondContact O-N 3.47Å; A45-S49 PolarHBondContact O-OG 3.43Å
46	K	81.9	Confident	80.4	Confident	148 Å²	148	119.6 Å²	119.6	64%	0.643	58%	0.577	S	S	*	*	H	α-helix	trans	-60.5	-41.8	176.5	-171	176.3	-178.2	-178.7	0	112.1	R42 F43 S49 T50	R42-K46 WeakPolarHBondContact O-CB 3.28Å; R42-K46 PolarHBondContact O-N 3.11Å; F43-K46 PolarHBondContact O-N 3.39Å; K46-S49 PolarHBondContact O-N 3.05Å; K46-T50 WeakPolarHBondContact O-CB 3.23Å; K46-T50 PolarHBondContact O-N 3.14Å; K46-T50 PolarHBondContact O-OG1 2.86Å
47	T	78.4	Confident	79.4	Confident	72 Å²	72	121.6 Å²	121.6	44%	0.442	59%	0.586	S	S	.	*	H	α-helix	trans	-63.4	-40.7	177.6	-55.2	0	0	0	0	111.6	F43 L44 A45 K51	F43-T47 WeakPolarHBondContact O-CB 3.3Å; F43-T47 PolarHBondContact O-N 3.06Å; F43-T47 PolarHBondContact O-OG1 3.07Å; L44-T47 PolarHBondContact O-N 3.39Å; A45-T47 VanDerWaalsContact C-N 3.33Å; A45-T47 PolarHBondContact O-N 2.98Å; T47-K51 WeakPolarHBondContact O-CG 3.46Å; T47-K51 PolarHBondContact O-N 3.45Å
48	R	72.9	Confident	78.4	Confident	185 Å²	185	121.9 Å²	121.9	70%	0.698	59%	0.588	S	S	*	*	H	α-helix	trans	-65.8	-49.9	175.3	-73	177.2	-178.7	-105.1	3.4	111.8	L44 A45 T50 K51 D52	L44-R48 WeakPolarHBondContact O-CG 3.3Å; L44-R48 PolarHBondContact O-N 3.03Å; A45-R48 PolarHBondContact O-N 3Å; R48-T50 PolarHBondContact O-N 3.18Å; R48-K51 PolarHBondContact O-N 3.38Å; R48-D52 PolarHBondContact O-N 3.34Å
49	S	66.7	Low	77.3	Confident	71 Å²	71	122.4 Å²	122.4	50%	0.497	59%	0.593	S	S	.	*	H	α-helix	trans	-60.6	-31.8	178.2	-63.7	0	0	0	0	113.5	A45 K46 Q53	A45-S49 PolarHBondContact O-N 3.47Å; A45-S49 PolarHBondContact O-OG 3.43Å; K46-S49 PolarHBondContact O-N 3.05Å; S49-Q53 WeakPolarHBondContact O-CG 3.28Å; S49-Q53 PolarHBondContact O-N 2.97Å
50	T	63.6	Low	76.1	Confident	65 Å²	65	124.7 Å²	124.7	40%	0.399	60%	0.603	S	S	.	*	H	α-helix	trans	-72.5	-34.3	177	-49.5	0	0	0	0	111.6	K46 R48	K46-T50 WeakPolarHBondContact O-CB 3.23Å; K46-T50 PolarHBondContact O-N 3.14Å; K46-T50 PolarHBondContact O-OG1 2.86Å; R48-T50 PolarHBondContact O-N 3.18Å
51	K	62.1	Low	74.7	Confident	130 Å²	130	130.2 Å²	130.2	57%	0.565	62%	0.62	S	S	*	*	H	α-helix	trans	-69.6	-42.1	175.3	-73.5	-176.3	178.6	-172.4	0	111.6	T47 R48 Q53 Q54 F55	T47-K51 WeakPolarHBondContact O-CG 3.46Å; T47-K51 PolarHBondContact O-N 3.45Å; R48-K51 PolarHBondContact O-N 3.38Å; K51-Q53 VanDerWaalsContact C-N 3.27Å; K51-Q53 PolarHBondContact O-N 2.97Å; K51-Q54 PolarHBondContact O-N 3.3Å; K51-F55 WeakPolarHBondContact O-CD2 3.47Å
52	D	61.3	Low	73.2	Confident	121 Å²	121	131.5 Å²	131.5	65%	0.647	63%	0.627	S	S	*	*	H	α-helix	trans	-67.4	-26	178.7	-66.5	-23.5	0	0	0	113	R48 Q54	R48-D52 PolarHBondContact O-N 3.34Å; D52-Q54 VanDerWaalsContact C-N 3.33Å
53	Q	62.3	Low	71.6	Confident	168 Å²	168	127.4 Å²	127.4	79%	0.785	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.6	-13.1	174.8	-79.4	-176.9	-13.1	0	0	114.4	S49 K51	S49-Q53 WeakPolarHBondContact O-CG 3.28Å; S49-Q53 PolarHBondContact O-N 2.97Å; K51-Q53 VanDerWaalsContact C-N 3.27Å; K51-Q53 PolarHBondContact O-N 2.97Å
54	Q	56.3	Low	69.8	Low	162 Å²	162	127 Å²	127	76%	0.757	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.4	-2.4	179.9	-73.6	-175	-4.2	0	0	113.6	K51 D52	K51-Q54 PolarHBondContact O-N 3.3Å; D52-Q54 VanDerWaalsContact C-N 3.33Å
55	F	51.4	Low	67.8	Low	238 Å²	238	128.5 Å²	128.5	100%	1.044	63%	0.629	S	S	*	*			trans	-106	0	175.4	-70.4	-74.2	0	0	0	111.9	K51	K51-F55 WeakPolarHBondContact O-CD2 3.47Å

Retrieved 55 of 55 residues in 50.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).