A0A087WNT7_MOUSE Loading...

Lymphocyte antigen 6 family member A

AlphaFold DB , UniProt , Accession A0A087WNT7, Species MOUSE (Mus musculus, Mouse), Gene Ly6a, Length 35 aa.

						>A0A087WNT7_MOUSE|A0A087WNT7|Ly6a
MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.5	Very low	65.5	Low	221 Å²	221	111.7 Å²	111.7	100%	1.089	62%	0.619	S	S	*	*				0	102.7	0	-162.2	160.4	79.7	0	0	106.6	T3	M1-T3 VanDerWaalsContact C-N 3.3Å; M1-T3 PolarHBondContact O-N 2.68Å
2	D	57.8	Low	67.2	Low	122 Å²	122	110.6 Å²	110.6	65%	0.652	61%	0.61	S	S	*	*			trans	-62.2	74.7	-168.4	-66.8	-102.5	0	0	0	114.1	S4 H5 T6	D2-S4 PolarHBondContact O-N 3.41Å; D2-H5 HydrophobicContact CB-CB 3.72Å; D2-H5 PolarHBondContact O-N 2.92Å; D2-T6 PolarHBondContact O-N 2.77Å
3	T	58	Low	68.7	Low	108 Å²	108	110.5 Å²	110.5	66%	0.663	61%	0.607	S	S	*	*	H	α-helix	trans	-58.1	-29	172.7	55.9	0	0	0	0	111.8	M1 T7	M1-T3 VanDerWaalsContact C-N 3.3Å; M1-T3 PolarHBondContact O-N 2.68Å; T3-T7 PolarHBondContact O-N 2.69Å; T3-T7 VanDerWaalsContact O-N 3.09Å; T3-T7 PolarHBondContact O-OG1 2.71Å
4	S	59.6	Low	69.9	Low	91 Å²	91	110.1 Å²	110.1	64%	0.636	60%	0.602	S	S	*	*	H	α-helix	trans	-65.6	-37.9	174.2	-170.7	0	0	0	0	112.9	D2 K8	D2-S4 PolarHBondContact O-N 3.41Å; S4-K8 VanDerWaalsContact O-CB 3.32Å; S4-K8 WeakPolarHBondContact O-CB 3.36Å; S4-K8 PolarHBondContact O-N 3.04Å
5	H	59.7	Low	70.9	Confident	136 Å²	136	109.2 Å²	109.2	63%	0.63	60%	0.596	S	S	*	*	H	α-helix	trans	-73.2	-37.8	-178.7	-156.8	-102.8	0	0	0	111.5	D2 S9	D2-H5 HydrophobicContact CB-CB 3.72Å; D2-H5 PolarHBondContact O-N 2.92Å; H5-S9 WeakPolarHBondContact O-CB 3.23Å; H5-S9 PolarHBondContact O-N 2.78Å
6	T	61	Low	71.8	Confident	93 Å²	93	108 Å²	108	57%	0.571	59%	0.593	S	S	*	*	H	α-helix	trans	-65.5	-45	173.7	-52.6	0	0	0	0	111.5	D2 K8 S9 C10	D2-T6 PolarHBondContact O-N 2.77Å; T6-K8 PolarHBondContact O-N 2.69Å; T6-S9 PolarHBondContact O-N 3.03Å; T6-C10 PolarHBondContact O-N 2.85Å; T6-C10 PolarHBondContact O-SG 3.15Å; T6-C10 VanDerWaalsContact O-SG 3.36Å
7	T	67.3	Low	72.6	Confident	85 Å²	85	104.9 Å²	104.9	52%	0.521	59%	0.585	S	S	.	*	H	α-helix	trans	-63.3	-42.3	177.7	-58	0	0	0	0	111.8	T3 S9 C10 L11	T3-T7 PolarHBondContact O-N 2.69Å; T3-T7 VanDerWaalsContact O-N 3.09Å; T3-T7 PolarHBondContact O-OG1 2.71Å; T7-S9 VanDerWaalsContact C-N 3.34Å; T7-S9 PolarHBondContact O-N 3.22Å; T7-C10 PolarHBondContact O-N 3.33Å; T7-L11 HydrophobicContact CG2-CD1 4.38Å; T7-L11 WeakPolarHBondContact O-CG 3.38Å; T7-L11 PolarHBondContact O-N 2.78Å
8	K	70.4	Confident	73.1	Confident	139 Å²	139	104.3 Å²	104.3	60%	0.604	58%	0.58	S	S	*	*	H	α-helix	trans	-62.6	-41.2	176.5	-176.1	174.3	167.4	176.2	0	111.8	S4 T6 L11 L12	S4-K8 VanDerWaalsContact O-CB 3.32Å; S4-K8 WeakPolarHBondContact O-CB 3.36Å; S4-K8 PolarHBondContact O-N 3.04Å; T6-K8 PolarHBondContact O-N 2.69Å; K8-L11 PolarHBondContact O-N 3.45Å; K8-L12 VanDerWaalsContact O-CG 3.31Å; K8-L12 WeakPolarHBondContact O-CG 3.48Å; K8-L12 PolarHBondContact O-N 2.87Å; K8-L12 VanDerWaalsContact O-N 3.16Å
9	S	77.5	Confident	73.4	Confident	59 Å²	59	103.5 Å²	103.5	41%	0.413	57%	0.574	S	S	.	*	H	α-helix	trans	-63.9	-44.5	175.9	-167.8	0	0	0	0	112.1	H5 T6 T7 L11 L12 I13	H5-S9 WeakPolarHBondContact O-CB 3.23Å; H5-S9 PolarHBondContact O-N 2.78Å; T6-S9 PolarHBondContact O-N 3.03Å; T7-S9 VanDerWaalsContact C-N 3.34Å; T7-S9 PolarHBondContact O-N 3.22Å; S9-L11 PolarHBondContact O-N 2.79Å; S9-L12 PolarHBondContact O-N 3.07Å; S9-I13 WeakPolarHBondContact O-CG1 3.3Å; S9-I13 PolarHBondContact O-N 3.42Å
10	C	80.4	Confident	73.6	Confident	74 Å²	74	102.1 Å²	102.1	50%	0.5	57%	0.571	S	S	.	*	H	α-helix	trans	-61.9	-40.7	177.4	-70.5	0	0	0	0	112.9	T6 T7 L12 I13 L14	T6-C10 PolarHBondContact O-N 2.85Å; T6-C10 PolarHBondContact O-SG 3.15Å; T6-C10 VanDerWaalsContact O-SG 3.36Å; T7-C10 PolarHBondContact O-N 3.33Å; C10-L12 VanDerWaalsContact C-N 3.33Å; C10-L12 PolarHBondContact O-N 3.47Å; C10-I13 PolarHBondContact O-N 2.89Å; C10-L14 WeakPolarHBondContact O-CB 3.17Å; C10-L14 PolarHBondContact O-N 2.85Å
11	L	85.5	Confident	73.6	Confident	101 Å²	101	99.4 Å²	99.4	53%	0.529	56%	0.561	S	S	.	*	H	α-helix	trans	-63.2	-40	176	-70.3	172.6	0	0	0	111.8	T7 K8 S9 L14 L15	T7-L11 HydrophobicContact CG2-CD1 4.38Å; T7-L11 WeakPolarHBondContact O-CG 3.38Å; T7-L11 PolarHBondContact O-N 2.78Å; K8-L11 PolarHBondContact O-N 3.45Å; S9-L11 PolarHBondContact O-N 2.79Å; L11-L14 PolarHBondContact O-N 3.37Å; L11-L15 WeakPolarHBondContact O-CB 3.38Å; L11-L15 VanDerWaalsContact O-CG 3.23Å; L11-L15 WeakPolarHBondContact O-CG 3.45Å; L11-L15 PolarHBondContact O-N 2.95Å
12	L	85.3	Confident	74.7	Confident	98 Å²	98	95 Å²	95	51%	0.513	54%	0.538	S	S	.	.	H	α-helix	trans	-64.5	-42.7	176.3	-68.5	170.2	0	0	0	111.7	K8 S9 C10 L15 V16	K8-L12 VanDerWaalsContact O-CG 3.31Å; K8-L12 WeakPolarHBondContact O-CG 3.48Å; K8-L12 PolarHBondContact O-N 2.87Å; K8-L12 VanDerWaalsContact O-N 3.16Å; S9-L12 PolarHBondContact O-N 3.07Å; C10-L12 VanDerWaalsContact C-N 3.33Å; C10-L12 PolarHBondContact O-N 3.47Å; L12-L15 PolarHBondContact O-N 3.37Å; L12-V16 WeakPolarHBondContact O-CG2 3.29Å; L12-V16 PolarHBondContact O-N 3.39Å
13	I	86.7	Confident	75.1	Confident	110 Å²	110	97.8 Å²	97.8	56%	0.564	54%	0.54	S	S	*	.	H	α-helix	trans	-63.2	-43.7	176.6	-65.2	164.3	0	0	0	110.6	S9 C10 V16 A17	S9-I13 WeakPolarHBondContact O-CG1 3.3Å; S9-I13 PolarHBondContact O-N 3.42Å; C10-I13 PolarHBondContact O-N 2.89Å; I13-V16 PolarHBondContact O-N 3.49Å; I13-A17 WeakPolarHBondContact O-CB 2.92Å; I13-A17 PolarHBondContact O-N 2.88Å
14	L	85.8	Confident	75.2	Confident	104 Å²	104	95.7 Å²	95.7	55%	0.545	53%	0.533	S	S	.	.	H	α-helix	trans	-62.8	-43.7	177.6	-173.2	68.7	0	0	0	111.7	C10 L11 A17 L18	C10-L14 WeakPolarHBondContact O-CB 3.17Å; C10-L14 PolarHBondContact O-N 2.85Å; L11-L14 PolarHBondContact O-N 3.37Å; L14-A17 PolarHBondContact O-N 3.32Å; L14-L18 HydrophobicContact CG-CD1 4.31Å; L14-L18 WeakPolarHBondContact O-CG 3.21Å; L14-L18 PolarHBondContact O-N 3.45Å
15	L	85.2	Confident	75	Confident	97 Å²	97	99.1 Å²	99.1	51%	0.508	54%	0.539	S	S	.	.	H	α-helix	trans	-61.7	-46.1	176.3	-75	169.3	0	0	0	111.5	L11 L12 A17 L18 L19	L11-L15 WeakPolarHBondContact O-CB 3.38Å; L11-L15 VanDerWaalsContact O-CG 3.23Å; L11-L15 WeakPolarHBondContact O-CG 3.45Å; L11-L15 PolarHBondContact O-N 2.95Å; L12-L15 PolarHBondContact O-N 3.37Å; L15-A17 VanDerWaalsContact C-N 3.33Å; L15-A17 PolarHBondContact O-N 3.31Å; L15-L18 PolarHBondContact O-N 3.43Å; L15-L19 WeakPolarHBondContact O-CB 3.32Å; L15-L19 VanDerWaalsContact O-CD1 3.29Å; L15-L19 WeakPolarHBondContact O-CD1 3.43Å; L15-L19 PolarHBondContact O-N 2.93Å
16	V	85.6	Confident	74.9	Confident	90 Å²	90	95.6 Å²	95.6	55%	0.545	54%	0.539	S	S	.	.	H	α-helix	trans	-60.5	-43.5	176.2	168.7	0	0	0	0	110.9	L12 I13 L18 L19 C20	L12-V16 WeakPolarHBondContact O-CG2 3.29Å; L12-V16 PolarHBondContact O-N 3.39Å; I13-V16 PolarHBondContact O-N 3.49Å; V16-L18 PolarHBondContact O-N 2.91Å; V16-L19 PolarHBondContact O-N 2.96Å; V16-C20 VanDerWaalsContact O-CB 3.3Å; V16-C20 WeakPolarHBondContact O-CB 3.36Å; V16-C20 PolarHBondContact O-N 3.16Å; V16-C20 PolarHBondContact O-SG 3.04Å
17	A	84.9	Confident	74.7	Confident	56 Å²	56	97 Å²	97	46%	0.463	54%	0.542	S	S	.	.	H	α-helix	trans	-63	-41.7	178.1	0	0	0	0	0	112.5	I13 L14 L15 C20 A21	I13-A17 WeakPolarHBondContact O-CB 2.92Å; I13-A17 PolarHBondContact O-N 2.88Å; L14-A17 PolarHBondContact O-N 3.32Å; L15-A17 VanDerWaalsContact C-N 3.33Å; L15-A17 PolarHBondContact O-N 3.31Å; A17-C20 PolarHBondContact O-N 3.49Å; A17-A21 WeakPolarHBondContact O-CB 3.45Å; A17-A21 PolarHBondContact O-N 3.34Å
18	L	81.7	Confident	74.2	Confident	93 Å²	93	100.9 Å²	100.9	49%	0.487	56%	0.555	S	S	.	*	H	α-helix	trans	-65.2	-48.7	175.7	-72.2	170.3	0	0	0	111.5	L14 L15 V16 C20 A21 E22	L14-L18 HydrophobicContact CG-CD1 4.31Å; L14-L18 WeakPolarHBondContact O-CG 3.21Å; L14-L18 PolarHBondContact O-N 3.45Å; L15-L18 PolarHBondContact O-N 3.43Å; V16-L18 PolarHBondContact O-N 2.91Å; L18-C20 VanDerWaalsContact C-N 3.28Å; L18-C20 PolarHBondContact O-N 3.42Å; L18-A21 PolarHBondContact O-N 2.98Å; L18-E22 WeakPolarHBondContact O-CG 3.31Å; L18-E22 PolarHBondContact O-N 3.47Å
19	L	79.1	Confident	73.7	Confident	90 Å²	90	99.6 Å²	99.6	47%	0.471	56%	0.562	S	S	.	*	H	α-helix	trans	-57.7	-41.5	174.7	-94.2	124.2	0	0	0	111.7	L15 V16 R23	L15-L19 WeakPolarHBondContact O-CB 3.32Å; L15-L19 VanDerWaalsContact O-CD1 3.29Å; L15-L19 WeakPolarHBondContact O-CD1 3.43Å; L15-L19 PolarHBondContact O-N 2.93Å; V16-L19 PolarHBondContact O-N 2.96Å; L19-R23 WeakPolarHBondContact O-CB 3.39Å; L19-R23 WeakPolarHBondContact O-CG 3.43Å; L19-R23 PolarHBondContact O-N 3.2Å
20	C	76.7	Confident	72.9	Confident	75 Å²	75	107.4 Å²	107.4	51%	0.507	58%	0.584	S	S	.	*	H	α-helix	trans	-66.4	-38	175.4	-74.4	0	0	0	0	112.3	V16 A17 L18 R23 A24	V16-C20 VanDerWaalsContact O-CB 3.3Å; V16-C20 WeakPolarHBondContact O-CB 3.36Å; V16-C20 PolarHBondContact O-N 3.16Å; V16-C20 PolarHBondContact O-SG 3.04Å; A17-C20 PolarHBondContact O-N 3.49Å; L18-C20 VanDerWaalsContact C-N 3.28Å; L18-C20 PolarHBondContact O-N 3.42Å; C20-R23 CarbonylContact O-C 3.55Å; C20-R23 PolarHBondContact O-N 3.47Å; C20-A24 WeakPolarHBondContact O-CB 3.36Å; C20-A24 PolarHBondContact O-N 2.94Å
21	A	74.1	Confident	71.9	Confident	46 Å²	46	110.5 Å²	110.5	38%	0.38	59%	0.591	S	S	.	*	H	α-helix	trans	-68.5	-43.5	176.9	0	0	0	0	0	111.8	A17 L18 R23 A24 Q25	A17-A21 WeakPolarHBondContact O-CB 3.45Å; A17-A21 PolarHBondContact O-N 3.34Å; L18-A21 PolarHBondContact O-N 2.98Å; A21-R23 VanDerWaalsContact C-N 3.34Å; A21-A24 CarbonylContact O-C 3.57Å; A21-A24 PolarHBondContact O-N 3.4Å; A21-A24 VanDerWaalsContact O-N 3.15Å; A21-Q25 WeakPolarHBondContact O-CB 3.23Å; A21-Q25 WeakPolarHBondContact O-CG 3.4Å; A21-Q25 PolarHBondContact O-N 3.01Å
22	E	67.2	Low	70.9	Confident	129 Å²	129	112 Å²	112	60%	0.603	61%	0.608	S	S	*	*	H	α-helix	trans	-62.3	-42.7	173	-68.9	179.1	100.7	0	0	111	L18 A24 Q25 G26	L18-E22 WeakPolarHBondContact O-CG 3.31Å; L18-E22 PolarHBondContact O-N 3.47Å; E22-A24 VanDerWaalsContact C-N 3.3Å; E22-A24 PolarHBondContact O-N 3.35Å; E22-Q25 PolarHBondContact O-N 2.92Å; E22-G26 PolarHBondContact O-N 3.28Å
23	R	64.4	Low	69.7	Low	180 Å²	180	116.3 Å²	116.3	68%	0.679	62%	0.619	S	S	*	*	H	α-helix	trans	-65.4	-31.3	173.4	-67.9	-98.8	-168.4	172.5	1.4	112.1	L19 C20 A21 G26 L27	L19-R23 WeakPolarHBondContact O-CB 3.39Å; L19-R23 WeakPolarHBondContact O-CG 3.43Å; L19-R23 PolarHBondContact O-N 3.2Å; C20-R23 CarbonylContact O-C 3.55Å; C20-R23 PolarHBondContact O-N 3.47Å; A21-R23 VanDerWaalsContact C-N 3.34Å; R23-G26 CarbonylContact O-C 3.59Å; R23-L27 WeakPolarHBondContact O-CA 3.36Å; R23-L27 VanDerWaalsContact O-CB 3.23Å; R23-L27 WeakPolarHBondContact O-CB 3.45Å; R23-L27 WeakPolarHBondContact O-CD1 3.32Å; R23-L27 PolarHBondContact O-N 3.01Å
24	A	59.9	Low	68.5	Low	63 Å²	63	114.2 Å²	114.2	52%	0.521	63%	0.625	S	S	.	*	H	α-helix	trans	-81.4	-26.9	177.2	0	0	0	0	0	112.8	C20 A21 E22	C20-A24 WeakPolarHBondContact O-CB 3.36Å; C20-A24 PolarHBondContact O-N 2.94Å; A21-A24 CarbonylContact O-C 3.57Å; A21-A24 PolarHBondContact O-N 3.4Å; A21-A24 VanDerWaalsContact O-N 3.15Å; E22-A24 VanDerWaalsContact C-N 3.3Å; E22-A24 PolarHBondContact O-N 3.35Å
25	Q	56.5	Low	66.7	Low	164 Å²	164	119.5 Å²	119.5	77%	0.766	66%	0.661	S	S	*	*	H	α-helix	trans	-76.6	-29.7	169.6	-74.3	174.7	-25.6	0	0	111.4	A21 E22	A21-Q25 WeakPolarHBondContact O-CB 3.23Å; A21-Q25 WeakPolarHBondContact O-CG 3.4Å; A21-Q25 PolarHBondContact O-N 3.01Å; E22-Q25 PolarHBondContact O-N 2.92Å
26	G	58.4	Low	65.7	Low	61 Å²	61	120.7 Å²	120.7	63%	0.629	67%	0.669	S	S	*	*	H	α-helix	trans	-90.8	-19.6	173.5	0	0	0	0	0	115.1	E22 R23 E28	E22-G26 PolarHBondContact O-N 3.28Å; R23-G26 CarbonylContact O-C 3.59Å; G26-E28 PolarHBondContact O-N 3.19Å
27	L	55.5	Low	64.7	Low	122 Å²	122	122.3 Å²	122.3	64%	0.639	68%	0.675	S	S	*	*	S	Bend	trans	-74.9	82.4	155	-105.1	72.1	0	0	0	104.3	R23 C29	R23-L27 WeakPolarHBondContact O-CA 3.36Å; R23-L27 VanDerWaalsContact O-CB 3.23Å; R23-L27 WeakPolarHBondContact O-CB 3.45Å; R23-L27 WeakPolarHBondContact O-CD1 3.32Å; R23-L27 PolarHBondContact O-N 3.01Å; L27-C29 PolarHBondContact O-N 3.03Å
28	E	57.7	Low	63.6	Low	167 Å²	167	125.9 Å²	125.9	78%	0.78	69%	0.687	S	S	*	*			trans	-46.7	107	149.1	-58.1	-155.6	108.3	0	0	104.7	G26 Y30	G26-E28 PolarHBondContact O-N 3.19Å; E28-Y30 PolarHBondContact O-N 3.3Å
29	C	58.7	Low	62.5	Low	112 Å²	112	127.9 Å²	127.9	76%	0.757	70%	0.699	S	S	*	*			trans	-50.4	104	167.2	-80.5	0	0	0	0	102.8	L27 Q31	L27-C29 PolarHBondContact O-N 3.03Å; C29-Q31 VanDerWaalsContact C-N 3.25Å; C29-Q31 WeakPolarHBondContact O-CA 3.36Å; C29-Q31 PolarHBondContact O-N 2.99Å
30	Y	60.8	Low	61.5	Low	223 Å²	223	130.3 Å²	130.3	88%	0.875	71%	0.713	S	S	*	*			trans	-43.1	106.6	171.7	-102.1	-95	0	0	0	103.4	E28 C32	E28-Y30 PolarHBondContact O-N 3.3Å; Y30-C32 PolarHBondContact O-N 3.09Å
31	Q	60.5	Low	60.4	Low	140 Å²	140	133.9 Å²	133.9	65%	0.654	73%	0.727	S	S	*	*			trans	-56.2	113.3	-169.2	-80.7	173.7	-87.4	0	0	103.8	C29 Y33	C29-Q31 VanDerWaalsContact C-N 3.25Å; C29-Q31 WeakPolarHBondContact O-CA 3.36Å; C29-Q31 PolarHBondContact O-N 2.99Å; Q31-Y33 HydrophobicContact CB-CD2 3.52Å; Q31-Y33 HydrophobicContact CB-CE2 3.6Å; Q31-Y33 VanDerWaalsContact CD-CE2 3.43Å; Q31-Y33 HydrophobicContact CG-CE2 4.11Å; Q31-Y33 VanDerWaalsContact NE2-CZ 3.34Å; Q31-Y33 PolarHBondContact NE2-OH 3.36Å; Q31-Y33 PolarHBondContact O-N 3.47Å
32	C	64.3	Low	59.5	Low	132 Å²	132	140.2 Å²	140.2	89%	0.892	75%	0.752	S	S	*	*			trans	-68.2	75.7	169.2	-74.9	0	0	0	0	105.5	Y30 G34	Y30-C32 PolarHBondContact O-N 3.09Å; C32-G34 PolarHBondContact O-N 2.83Å
33	Y	60.7	Low	58.9	Low	188 Å²	188	141.1 Å²	141.1	74%	0.737	76%	0.763	S	S	*	*			trans	-70.1	70.2	152.2	-75.8	-74.6	0	0	0	105.7	Q31 V35	Q31-Y33 HydrophobicContact CB-CD2 3.52Å; Q31-Y33 HydrophobicContact CB-CE2 3.6Å; Q31-Y33 VanDerWaalsContact CD-CE2 3.43Å; Q31-Y33 HydrophobicContact CG-CE2 4.11Å; Q31-Y33 VanDerWaalsContact NE2-CZ 3.34Å; Q31-Y33 PolarHBondContact NE2-OH 3.36Å; Q31-Y33 PolarHBondContact O-N 3.47Å; Y33-V35 PolarHBondContact O-N 2.93Å
34	G	60.6	Low	58.4	Low	66 Å²	66	137.8 Å²	137.8	68%	0.68	77%	0.77	S	S	*	*			trans	-69.5	118.1	161.7	0	0	0	0	0	107.2	C32	C32-G34 PolarHBondContact O-N 2.83Å
35	V	47.1	Very low	58.3	Low	216 Å²	216	144.6 Å²	144.6	100%	1.309	79%	0.793	S	S	*	*			trans	-21.9	0	165.2	172.8	0	0	0	0	114.7	Y33	Y33-V35 PolarHBondContact O-N 2.93Å

Retrieved 35 of 35 residues in 50.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).