A0A087WNU3_MOUSE Loading...

Ly6/neurotoxin 1

AlphaFold DB , UniProt , Accession A0A087WNU3, Species MOUSE (Mus musculus, Mouse), Gene Lynx1, Length 34 aa.

						>A0A087WNU3_MOUSE|A0A087WNU3|Lynx1
MTHLLTVFLVALMGLPVAQALECHVCAYNGDNCF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61	Low	78	Confident	217 Å²	217	116.8 Å²	116.8	100%	1.069	63%	0.63	S	S	*	*				0	-49.3	0	-56.8	-133.4	-170.9	111.5	H3 L4 L5	M1-H3 PolarHBondContact O-N 2.99Å; M1-L4 PolarHBondContact O-N 3.25Å; M1-L5 PolarHBondContact O-N 3.42Å
2	T	70.4	Confident	78	Confident	107 Å²	107	113.3 Å²	113.3	66%	0.656	61%	0.611	S	S	*	*	H	α-helix	trans	-54.9	-43.3	177.6	29.5	0	0	115.3	L4 L5 T6	T2-L4 VanDerWaalsContact C-N 3.31Å; T2-L4 PolarHBondContact O-N 3.32Å; T2-L5 WeakPolarHBondContact O-CB 3.17Å; T2-L5 PolarHBondContact O-N 3Å; T2-T6 PolarHBondContact O-N 3.49Å; T2-T6 PolarHBondContact O-OG1 2.97Å
3	H	75.4	Confident	78.1	Confident	155 Å²	155	116.5 Å²	116.5	72%	0.718	62%	0.622	S	S	*	*	H	α-helix	trans	-60	-38.4	178.8	-77.5	-83.9	0	114	M1 L5 T6 V7	M1-H3 PolarHBondContact O-N 2.99Å; H3-L5 VanDerWaalsContact C-N 3.32Å; H3-T6 PolarHBondContact O-N 3.05Å; H3-V7 WeakPolarHBondContact O-CG2 3.28Å; H3-V7 PolarHBondContact O-N 3.4Å
4	L	84.7	Confident	77.9	Confident	140 Å²	140	110.8 Å²	110.8	73%	0.733	60%	0.604	S	S	*	*	H	α-helix	trans	-70.5	-35.7	-178	-153	142	0	110.5	M1 T2 V7 F8	M1-L4 PolarHBondContact O-N 3.25Å; T2-L4 VanDerWaalsContact C-N 3.31Å; T2-L4 PolarHBondContact O-N 3.32Å; L4-V7 PolarHBondContact O-N 3.23Å; L4-F8 WeakPolarHBondContact O-CB 3.33Å; L4-F8 PolarHBondContact O-N 3.32Å
5	L	78.4	Confident	77.2	Confident	113 Å²	113	108.3 Å²	108.3	59%	0.592	59%	0.59	S	S	*	*	H	α-helix	trans	-65	-42.9	172.7	-159.2	112.5	0	111.5	M1 T2 H3 V7 F8 L9	M1-L5 PolarHBondContact O-N 3.42Å; T2-L5 WeakPolarHBondContact O-CB 3.17Å; T2-L5 PolarHBondContact O-N 3Å; H3-L5 VanDerWaalsContact C-N 3.32Å; L5-V7 PolarHBondContact O-N 3.31Å; L5-F8 PolarHBondContact O-N 3.02Å; L5-L9 HydrophobicContact CD2-CD1 3.95Å; L5-L9 VanDerWaalsContact O-CG 3.28Å; L5-L9 WeakPolarHBondContact O-CG 3.37Å; L5-L9 PolarHBondContact O-N 3.24Å
6	T	82.1	Confident	76.7	Confident	81 Å²	81	106.2 Å²	106.2	50%	0.497	58%	0.583	S	S	.	*	H	α-helix	trans	-62	-44.2	176.9	-44.7	0	0	111.7	T2 H3 F8 L9 V10	T2-T6 PolarHBondContact O-N 3.49Å; T2-T6 PolarHBondContact O-OG1 2.97Å; H3-T6 PolarHBondContact O-N 3.05Å; T6-F8 VanDerWaalsContact C-N 3.35Å; T6-L9 PolarHBondContact O-N 2.96Å; T6-V10 WeakPolarHBondContact O-CG2 3.21Å; T6-V10 PolarHBondContact O-N 3.33Å
7	V	82.2	Confident	76.2	Confident	103 Å²	103	106 Å²	106	62%	0.624	59%	0.586	S	S	*	*	H	α-helix	trans	-64	-41.9	177.1	173.8	0	0	111.1	H3 L4 L5 L9 V10 A11	H3-V7 WeakPolarHBondContact O-CG2 3.28Å; H3-V7 PolarHBondContact O-N 3.4Å; L4-V7 PolarHBondContact O-N 3.23Å; L5-V7 PolarHBondContact O-N 3.31Å; V7-L9 PolarHBondContact O-N 2.83Å; V7-V10 PolarHBondContact O-N 2.9Å; V7-A11 WeakPolarHBondContact O-CB 3.17Å; V7-A11 PolarHBondContact O-N 2.94Å
8	F	78.7	Confident	75.9	Confident	129 Å²	129	103.2 Å²	103.2	57%	0.566	58%	0.579	S	S	*	*	H	α-helix	trans	-63	-42.1	177.8	-173.8	-108.9	0	112.2	L4 L5 T6 A11 L12	L4-F8 WeakPolarHBondContact O-CB 3.33Å; L4-F8 PolarHBondContact O-N 3.32Å; L5-F8 PolarHBondContact O-N 3.02Å; T6-F8 VanDerWaalsContact C-N 3.35Å; F8-A11 PolarHBondContact O-N 3.32Å; F8-L12 HydrophobicContact CD1-CD1 3.55Å; F8-L12 HydrophobicContact CD1-CG 4.36Å; F8-L12 HydrophobicContact CE1-CD1 3.31Å; F8-L12 HydrophobicContact CE1-CG 4.12Å; F8-L12 HydrophobicContact CG-CD1 4.35Å; F8-L12 HydrophobicContact CZ-CD1 3.91Å; F8-L12 HydrophobicContact CZ-CD2 4.44Å; F8-L12 HydrophobicContact CZ-CG 4.27Å; F8-L12 WeakPolarHBondContact O-CB 3.45Å; F8-L12 VanDerWaalsContact O-CG 3.32Å; F8-L12 WeakPolarHBondContact O-CG 3.37Å; F8-L12 PolarHBondContact O-N 3.5Å
9	L	81.9	Confident	75.5	Confident	91 Å²	91	103.6 Å²	103.6	48%	0.476	58%	0.576	S	S	.	*	H	α-helix	trans	-63.7	-45.1	175.1	-70.3	170.3	0	111.4	L5 T6 V7 A11 L12 M13	L5-L9 HydrophobicContact CD2-CD1 3.95Å; L5-L9 VanDerWaalsContact O-CG 3.28Å; L5-L9 WeakPolarHBondContact O-CG 3.37Å; L5-L9 PolarHBondContact O-N 3.24Å; T6-L9 PolarHBondContact O-N 2.96Å; V7-L9 PolarHBondContact O-N 2.83Å; L9-A11 VanDerWaalsContact C-N 3.31Å; L9-A11 PolarHBondContact O-N 3.03Å; L9-L12 PolarHBondContact O-N 3.12Å; L9-M13 WeakPolarHBondContact O-CG 3.4Å; L9-M13 PolarHBondContact O-N 3.31Å
10	V	82.8	Confident	75.1	Confident	103 Å²	103	101.6 Å²	101.6	62%	0.624	57%	0.572	S	S	*	*	H	α-helix	trans	-61.2	-42	176.5	171.3	0	0	111.3	T6 V7 M13 G14	T6-V10 WeakPolarHBondContact O-CG2 3.21Å; T6-V10 PolarHBondContact O-N 3.33Å; V7-V10 PolarHBondContact O-N 2.9Å; V10-M13 PolarHBondContact O-N 3.39Å; V10-G14 PolarHBondContact O-N 3.31Å; V10-G14 VanDerWaalsContact O-N 3.12Å
11	A	80	Confident	74.7	Confident	46 Å²	46	102 Å²	102	38%	0.38	57%	0.573	S	S	.	*	H	α-helix	trans	-61	-47.9	175.2	0	0	0	111.3	V7 F8 L9 M13 G14 L15	V7-A11 WeakPolarHBondContact O-CB 3.17Å; V7-A11 PolarHBondContact O-N 2.94Å; F8-A11 PolarHBondContact O-N 3.32Å; L9-A11 VanDerWaalsContact C-N 3.31Å; L9-A11 PolarHBondContact O-N 3.03Å; A11-M13 VanDerWaalsContact C-N 3.28Å; A11-M13 PolarHBondContact O-N 3.37Å; A11-G14 CarbonylContact O-C 3.54Å; A11-G14 PolarHBondContact O-N 3.49Å; A11-L15 HydrophobicContact CB-CD1 4.46Å; A11-L15 WeakPolarHBondContact O-CD1 3.32Å; A11-L15 PolarHBondContact O-N 3.31Å
12	L	78.1	Confident	75.2	Confident	75 Å²	75	98.3 Å²	98.3	39%	0.393	55%	0.553	S	S	.	*	H	α-helix	trans	-58.7	-36.6	177	-77.9	167.1	0	113.3	F8 L9 G14 P16	F8-L12 HydrophobicContact CD1-CD1 3.55Å; F8-L12 HydrophobicContact CD1-CG 4.36Å; F8-L12 HydrophobicContact CE1-CD1 3.31Å; F8-L12 HydrophobicContact CE1-CG 4.12Å; F8-L12 HydrophobicContact CG-CD1 4.35Å; F8-L12 HydrophobicContact CZ-CD1 3.91Å; F8-L12 HydrophobicContact CZ-CD2 4.44Å; F8-L12 HydrophobicContact CZ-CG 4.27Å; F8-L12 WeakPolarHBondContact O-CB 3.45Å; F8-L12 VanDerWaalsContact O-CG 3.32Å; F8-L12 WeakPolarHBondContact O-CG 3.37Å; F8-L12 PolarHBondContact O-N 3.5Å; L9-L12 PolarHBondContact O-N 3.12Å; L12-G14 VanDerWaalsContact C-N 3.32Å; L12-P16 WeakPolarHBondContact O-CD 3.35Å
13	M	80.1	Confident	75.2	Confident	155 Å²	155	95.9 Å²	95.9	76%	0.764	54%	0.54	S	S	*	.	H	α-helix	trans	-73.3	-25.6	177.2	-59.7	-67.2	-87.6	112.2	L9 V10 A11	L9-M13 WeakPolarHBondContact O-CG 3.4Å; L9-M13 PolarHBondContact O-N 3.31Å; V10-M13 PolarHBondContact O-N 3.39Å; A11-M13 VanDerWaalsContact C-N 3.28Å; A11-M13 PolarHBondContact O-N 3.37Å
14	G	74.4	Confident	75.3	Confident	36 Å²	36	94.8 Å²	94.8	37%	0.371	54%	0.535	S	S	.	.	H	α-helix	trans	-89.4	-22.1	175.5	0	0	0	114.9	V10 A11 L12 V17 A18	V10-G14 PolarHBondContact O-N 3.31Å; V10-G14 VanDerWaalsContact O-N 3.12Å; A11-G14 CarbonylContact O-C 3.54Å; A11-G14 PolarHBondContact O-N 3.49Å; L12-G14 VanDerWaalsContact C-N 3.32Å; G14-V17 PolarHBondContact O-N 3Å; G14-A18 PolarHBondContact O-N 3.28Å
15	L	67.8	Low	75	Confident	74 Å²	74	92 Å²	92	39%	0.387	52%	0.523	S	S	.	.	H	α-helix	trans	-50.5	-49.9	176	-108.8	79.9	0	114.3	A11 V17 A18 Q19	A11-L15 HydrophobicContact CB-CD1 4.46Å; A11-L15 WeakPolarHBondContact O-CD1 3.32Å; A11-L15 PolarHBondContact O-N 3.31Å; L15-V17 VanDerWaalsContact C-N 3.26Å; L15-V17 PolarHBondContact O-N 3.41Å; L15-A18 PolarHBondContact O-N 2.97Å; L15-Q19 WeakPolarHBondContact O-CB 3.03Å; L15-Q19 PolarHBondContact O-N 3.05Å
16	P	68.8	Low	75	Confident	74 Å²	74	88.1 Å²	88.1	48%	0.481	51%	0.505	S	S	.	.	H	α-helix	trans	-66.1	-30.9	-176.7	24.3	-33.9	0	112.2	L12 A20	L12-P16 WeakPolarHBondContact O-CD 3.35Å; P16-A20 WeakPolarHBondContact O-CB 3.41Å; P16-A20 PolarHBondContact O-N 2.89Å
17	V	68.8	Low	74.7	Confident	103 Å²	103	87.6 Å²	87.6	62%	0.624	51%	0.51	S	S	*	.	H	α-helix	trans	-71.7	-43.4	176.1	174.2	0	0	110.6	G14 L15 A20 L21	G14-V17 PolarHBondContact O-N 3Å; L15-V17 VanDerWaalsContact C-N 3.26Å; L15-V17 PolarHBondContact O-N 3.41Å; V17-A20 PolarHBondContact O-N 3.44Å; V17-L21 WeakPolarHBondContact O-CB 3.4Å; V17-L21 PolarHBondContact O-N 3.43Å
18	A	70.6	Confident	74.4	Confident	56 Å²	56	92.2 Å²	92.2	46%	0.463	52%	0.517	S	S	.	.	H	α-helix	trans	-64.3	-43.4	177	0	0	0	111.8	G14 L15 L21 E22	G14-A18 PolarHBondContact O-N 3.28Å; L15-A18 PolarHBondContact O-N 2.97Å; A18-L21 PolarHBondContact O-N 2.9Å; A18-E22 WeakPolarHBondContact O-CB 3.48Å; A18-E22 VanDerWaalsContact O-CG 3.28Å; A18-E22 WeakPolarHBondContact O-CG 3.3Å; A18-E22 PolarHBondContact O-N 3.24Å
19	Q	69.3	Low	74.5	Confident	111 Å²	111	91.8 Å²	91.8	52%	0.519	52%	0.521	S	S	.	.	H	α-helix	trans	-66.4	-41.2	176.9	-80.5	156.3	-4.5	112.3	L15 L21 E22 C23	L15-Q19 WeakPolarHBondContact O-CB 3.03Å; L15-Q19 PolarHBondContact O-N 3.05Å; Q19-L21 VanDerWaalsContact C-N 3.3Å; Q19-L21 PolarHBondContact O-N 3.21Å; Q19-E22 PolarHBondContact O-N 3.46Å; Q19-C23 WeakPolarHBondContact O-CB 3.09Å; Q19-C23 PolarHBondContact O-N 2.9Å; Q19-C23 PolarHBondContact O-SG 3.31Å
20	A	67.3	Low	74.2	Confident	62 Å²	62	90.5 Å²	90.5	51%	0.512	53%	0.529	S	S	.	.	H	α-helix	trans	-63.8	-36.8	174.8	0	0	0	112.3	P16 V17 H24	P16-A20 WeakPolarHBondContact O-CB 3.41Å; P16-A20 PolarHBondContact O-N 2.89Å; V17-A20 PolarHBondContact O-N 3.44Å; A20-H24 VanDerWaalsContact O-CB 3.3Å; A20-H24 WeakPolarHBondContact O-CB 3.44Å; A20-H24 PolarHBondContact O-N 2.95Å
21	L	65.1	Low	74.1	Confident	112 Å²	112	89.8 Å²	89.8	59%	0.586	52%	0.522	S	S	*	.	H	α-helix	trans	-70.5	-43.6	177.8	-162.5	73.4	0	111.6	V17 A18 Q19 H24 V25	V17-L21 WeakPolarHBondContact O-CB 3.4Å; V17-L21 PolarHBondContact O-N 3.43Å; A18-L21 PolarHBondContact O-N 2.9Å; Q19-L21 VanDerWaalsContact C-N 3.3Å; Q19-L21 PolarHBondContact O-N 3.21Å; L21-H24 PolarHBondContact O-N 3.31Å; L21-V25 WeakPolarHBondContact O-CG2 3.45Å; L21-V25 PolarHBondContact O-N 2.94Å
22	E	71.7	Confident	73.2	Confident	138 Å²	138	95.3 Å²	95.3	65%	0.645	55%	0.545	S	S	*	.	H	α-helix	trans	-57.8	-51.9	173.2	-75	-78.3	93.9	109.9	A18 Q19 H24 V25 C26	A18-E22 WeakPolarHBondContact O-CB 3.48Å; A18-E22 VanDerWaalsContact O-CG 3.28Å; A18-E22 WeakPolarHBondContact O-CG 3.3Å; A18-E22 PolarHBondContact O-N 3.24Å; Q19-E22 PolarHBondContact O-N 3.46Å; E22-H24 VanDerWaalsContact C-N 3.3Å; E22-H24 PolarHBondContact O-N 3.26Å; E22-V25 PolarHBondContact O-N 2.9Å; E22-C26 WeakPolarHBondContact O-CB 3.29Å; E22-C26 PolarHBondContact O-N 3.23Å
23	C	72.1	Confident	72.9	Confident	57 Å²	57	94 Å²	94	39%	0.385	54%	0.542	S	S	.	.	H	α-helix	trans	-61.6	-35	177.7	-66.4	0	0	113	Q19 A27	Q19-C23 WeakPolarHBondContact O-CB 3.09Å; Q19-C23 PolarHBondContact O-N 2.9Å; Q19-C23 PolarHBondContact O-SG 3.31Å; C23-A27 WeakPolarHBondContact O-CB 2.91Å; C23-A27 PolarHBondContact O-N 2.95Å
24	H	75.9	Confident	72.1	Confident	131 Å²	131	99.7 Å²	99.7	61%	0.606	56%	0.563	S	S	*	*	H	α-helix	trans	-67.5	-48.2	176.8	-176.4	83.2	0	112	A20 L21 E22 Y28	A20-H24 VanDerWaalsContact O-CB 3.3Å; A20-H24 WeakPolarHBondContact O-CB 3.44Å; A20-H24 PolarHBondContact O-N 2.95Å; L21-H24 PolarHBondContact O-N 3.31Å; E22-H24 VanDerWaalsContact C-N 3.3Å; E22-H24 PolarHBondContact O-N 3.26Å; H24-Y28 VanDerWaalsContact O-CB 3.29Å; H24-Y28 WeakPolarHBondContact O-CB 3.28Å; H24-Y28 PolarHBondContact O-N 3.11Å
25	V	79.2	Confident	72	Confident	81 Å²	81	102.9 Å²	102.9	49%	0.491	57%	0.572	S	S	.	*	H	α-helix	trans	-65.1	-44.8	178.7	171.8	0	0	110.5	L21 E22 Y28 N29	L21-V25 WeakPolarHBondContact O-CG2 3.45Å; L21-V25 PolarHBondContact O-N 2.94Å; E22-V25 PolarHBondContact O-N 2.9Å; V25-Y28 WeakPolarHBondContact O-CB 3.35Å; V25-Y28 PolarHBondContact O-N 3.5Å; V25-N29 WeakPolarHBondContact O-CB 3.36Å; V25-N29 PolarHBondContact O-N 2.85Å
26	C	78.7	Confident	72.2	Confident	32 Å²	32	104.4 Å²	104.4	22%	0.216	58%	0.582	C	S	.	*	H	α-helix	trans	-68.8	-38.6	-176.9	175	0	0	110.9	E22 N29 G30 D31 C33	E22-C26 WeakPolarHBondContact O-CB 3.29Å; E22-C26 PolarHBondContact O-N 3.23Å; C26-N29 PolarHBondContact O-N 2.89Å; C26-G30 PolarHBondContact O-N 2.03Å; C26-G30 VanDerWaalsContact O-N 3.11Å; C26-D31 PolarHBondContact O-N 2.87Å; C26-C33 VanDerWaalsContact CA-SG 3.52Å; C26-C33 HydrophobicContact CB-CB 4.03Å; C26-C33 WeakPolarHBondContact CB-SG 2.77Å; C26-C33 WeakPolarHBondContact SG-CB 3.1Å; C26-C33 CovalentContact SG-SG 2.03Å; C26-C33 PolarHBondContact SG-SG 2.76Å
27	A	75.8	Confident	72.4	Confident	71 Å²	71	106.1 Å²	106.1	59%	0.587	59%	0.588	S	S	*	*	H	α-helix	trans	-67.7	-36.9	169.8	0	0	0	113.2	C23 N29 G30	C23-A27 WeakPolarHBondContact O-CB 2.91Å; C23-A27 PolarHBondContact O-N 2.95Å; A27-N29 VanDerWaalsContact C-N 3.3Å; A27-N29 PolarHBondContact O-N 3.28Å; A27-G30 PolarHBondContact O-N 2.92Å
28	Y	75.1	Confident	72.6	Confident	200 Å²	200	106.3 Å²	106.3	78%	0.784	59%	0.586	S	S	*	*	H	α-helix	trans	-65.6	-35	174.9	-174.8	-92.5	0	112	H24 V25 G30	H24-Y28 VanDerWaalsContact O-CB 3.29Å; H24-Y28 WeakPolarHBondContact O-CB 3.28Å; H24-Y28 PolarHBondContact O-N 3.11Å; V25-Y28 WeakPolarHBondContact O-CB 3.35Å; V25-Y28 PolarHBondContact O-N 3.5Å; Y28-G30 VanDerWaalsContact C-N 3.28Å
29	N	80.9	Confident	72.7	Confident	120 Å²	120	109.4 Å²	109.4	64%	0.642	59%	0.593	S	S	*	*	H	α-helix	trans	-81.5	-9.1	178.4	-151.5	51.9	0	113	V25 C26 A27 D31	V25-N29 WeakPolarHBondContact O-CB 3.36Å; V25-N29 PolarHBondContact O-N 2.85Å; C26-N29 PolarHBondContact O-N 2.89Å; A27-N29 VanDerWaalsContact C-N 3.3Å; A27-N29 PolarHBondContact O-N 3.28Å; N29-D31 VanDerWaalsContact C-N 3.35Å; N29-D31 PolarHBondContact ND2-OD2 3.25Å
30	G	76.4	Confident	72.9	Confident	63 Å²	63	109.3 Å²	109.3	65%	0.649	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	77.5	19.2	-179	0	0	0	114	C26 A27 Y28	C26-G30 PolarHBondContact O-N 2.03Å; C26-G30 VanDerWaalsContact O-N 3.11Å; A27-G30 PolarHBondContact O-N 2.92Å; Y28-G30 VanDerWaalsContact C-N 3.28Å
31	D	80.1	Confident	73.3	Confident	89 Å²	89	112.7 Å²	112.7	48%	0.476	60%	0.604	S	S	.	*			trans	-84.7	151.6	176.3	-75.6	-72.1	0	111.4	C26 N29 C33	C26-D31 PolarHBondContact O-N 2.87Å; N29-D31 VanDerWaalsContact C-N 3.35Å; N29-D31 PolarHBondContact ND2-OD2 3.25Å; D31-C33 PolarHBondContact O-N 3.35Å; D31-C33 PolarHBondContact O-SG 3.21Å
32	N	61.6	Low	74	Confident	161 Å²	161	112.8 Å²	112.8	86%	0.861	61%	0.606	S	S	*	*			trans	-80.9	99.9	178.5	-49	-32.5	0	109.2
33	C	70.7	Confident	74.2	Confident	49 Å²	49	110.7 Å²	110.7	33%	0.331	60%	0.603	S	S	.	*			trans	-90.2	132.3	179.7	-33.5	0	0	109.8	C26 D31	C26-C33 VanDerWaalsContact CA-SG 3.52Å; C26-C33 HydrophobicContact CB-CB 4.03Å; C26-C33 WeakPolarHBondContact CB-SG 2.77Å; C26-C33 WeakPolarHBondContact SG-CB 3.1Å; C26-C33 CovalentContact SG-SG 2.03Å; C26-C33 PolarHBondContact SG-SG 2.76Å; D31-C33 PolarHBondContact O-N 3.35Å; D31-C33 PolarHBondContact O-SG 3.21Å
34	F	63.6	Low	74.4	Confident	274 Å²	274	115.5 Å²	115.5	100%	1.202	62%	0.622	S	S	*	*			trans	-98.9	0	-177.4	-123.1	-82.1	0	112

Retrieved 34 of 34 residues in 37.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).