A0A087WNX3_MOUSE Loading...

aspartyl aminopeptidase

AlphaFold DB , UniProt , Accession A0A087WNX3, Species MOUSE (Mus musculus, Mouse), Gene Dnpep, Length 85 aa.

						>A0A087WNX3_MOUSE|A0A087WNX3|Dnpep
MAMNGRARKEAIQATARELLKFVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDIVPENKYFLTRNSSSIIAFAVGGQYVPGNG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49	Very low	80.9	Confident	251 Å²	251	133 Å²	133	100%	1.236	70%	0.703	S	S	*	*				0	94.8	0	-85.1	172.3	156.8	0	0	109.5
2	A	54.8	Low	82.3	Confident	99 Å²	99	129.8 Å²	129.8	82%	0.818	68%	0.684	S	S	*	*			trans	-156.4	27.3	173.8	0	0	0	0	0	113.3
3	M	57.3	Low	83.6	Confident	173 Å²	173	126.5 Å²	126.5	85%	0.852	66%	0.663	S	S	*	*			trans	-87.8	-5.5	-176.2	-68.2	-143.6	-70.8	0	0	114.9
4	N	75.4	Confident	84.6	Confident	145 Å²	145	121.4 Å²	121.4	78%	0.775	65%	0.648	S	S	*	*	H	α-helix	trans	-83.2	-27.3	-166.6	-143.7	28.3	0	0	0	114.5	R8	N4-R8 WeakPolarHBondContact O-CB 3.49Å
5	G	82.4	Confident	85.5	Confident	58 Å²	58	120.1 Å²	120.1	60%	0.598	65%	0.646	S	S	*	*	H	α-helix	trans	-77.8	-39.5	-175.7	0	0	0	0	0	114.1	K9	G5-K9 PolarHBondContact O-N 2.89Å
6	R	91	Very high	86.3	Confident	191 Å²	191	115.3 Å²	115.3	72%	0.721	63%	0.628	S	S	*	*	H	α-helix	trans	-70	-48.2	-178.9	-179.1	176	174.3	170.7	0.4	111.9	R8 K9 E10	R6-R8 VanDerWaalsContact C-N 3.31Å; R6-R8 PolarHBondContact O-N 3.47Å; R6-K9 WeakPolarHBondContact O-CB 3.35Å; R6-K9 PolarHBondContact O-N 3.37Å; R6-K9 VanDerWaalsContact O-N 3.13Å; R6-E10 WeakPolarHBondContact CG-OE1 3.49Å; R6-E10 IonicContact CZ-OE1 3.75Å; R6-E10 IonicContact NE-OE1 2.89Å; R6-E10 PolarHBondContact NE-OE1 3.13Å; R6-E10 IonicContact NH2-OE1 3.72Å; R6-E10 WeakPolarHBondContact O-CG 3.31Å; R6-E10 PolarHBondContact O-N 2.98Å
7	A	93.5	Very high	87.1	Confident	52 Å²	52	117.6 Å²	117.6	43%	0.43	63%	0.626	S	S	.	*	H	α-helix	trans	-58.9	-41.8	178.6	0	0	0	0	0	112.1	K9 E10 A11	A7-K9 PolarHBondContact O-N 3.23Å; A7-E10 PolarHBondContact O-N 2.97Å; A7-A11 PolarHBondContact O-N 3.31Å
8	R	95.6	Very high	87.7	Confident	187 Å²	187	115.4 Å²	115.4	71%	0.706	61%	0.611	S	S	*	*	H	α-helix	trans	-60.8	-44.5	175.2	-178.8	176.2	178.6	-179.3	0.3	112.2	N4 R6 E10 A11 I12	N4-R8 WeakPolarHBondContact O-CB 3.49Å; R6-R8 VanDerWaalsContact C-N 3.31Å; R6-R8 PolarHBondContact O-N 3.47Å; R8-E10 VanDerWaalsContact C-N 3.34Å; R8-A11 PolarHBondContact O-N 3.46Å; R8-I12 HydrophobicContact CG-CD1 4.01Å; R8-I12 VanDerWaalsContact O-CG1 3.31Å; R8-I12 WeakPolarHBondContact O-CG1 3.48Å; R8-I12 PolarHBondContact O-N 3.39Å
9	K	96.3	Very high	88.3	Confident	146 Å²	146	115.1 Å²	115.1	64%	0.635	61%	0.609	S	S	*	*	H	α-helix	trans	-62.2	-43.3	177.6	-176	179.1	178.9	-179.7	0	111.1	G5 R6 A7 I12 Q13	G5-K9 PolarHBondContact O-N 2.89Å; R6-K9 WeakPolarHBondContact O-CB 3.35Å; R6-K9 PolarHBondContact O-N 3.37Å; R6-K9 VanDerWaalsContact O-N 3.13Å; A7-K9 PolarHBondContact O-N 3.23Å; K9-I12 PolarHBondContact O-N 2.99Å; K9-Q13 WeakPolarHBondContact O-CB 3.27Å; K9-Q13 VanDerWaalsContact O-CG 3.27Å; K9-Q13 WeakPolarHBondContact O-CG 3.48Å; K9-Q13 PolarHBondContact O-N 3.38Å
10	E	97.5	Very high	88.8	Confident	104 Å²	104	114.6 Å²	114.6	49%	0.486	61%	0.606	S	S	.	*	H	α-helix	trans	-61.8	-44.3	177.5	-72.2	168.1	-177.3	0	0	111.5	R6 A7 R8 I12 Q13 A14	R6-E10 WeakPolarHBondContact CG-OE1 3.49Å; R6-E10 IonicContact CZ-OE1 3.75Å; R6-E10 IonicContact NE-OE1 2.89Å; R6-E10 PolarHBondContact NE-OE1 3.13Å; R6-E10 IonicContact NH2-OE1 3.72Å; R6-E10 WeakPolarHBondContact O-CG 3.31Å; R6-E10 PolarHBondContact O-N 2.98Å; A7-E10 PolarHBondContact O-N 2.97Å; R8-E10 VanDerWaalsContact C-N 3.34Å; E10-I12 PolarHBondContact O-N 3.06Å; E10-Q13 PolarHBondContact O-N 2.87Å; E10-A14 WeakPolarHBondContact O-CB 3.47Å; E10-A14 PolarHBondContact O-N 3.27Å
11	A	97.1	Very high	89.2	Confident	57 Å²	57	113.8 Å²	113.8	47%	0.471	60%	0.598	S	S	.	*	H	α-helix	trans	-61.7	-41.7	176	0	0	0	0	0	113.2	A7 R8 A14 T15	A7-A11 PolarHBondContact O-N 3.31Å; R8-A11 PolarHBondContact O-N 3.46Å; A11-A14 PolarHBondContact O-N 2.94Å; A11-T15 PolarHBondContact O-N 2.86Å; A11-T15 PolarHBondContact O-OG1 3.48Å
12	I	97.9	Very high	91.6	Very high	94 Å²	94	104.2 Å²	104.2	48%	0.482	55%	0.549	S	S	.	.	H	α-helix	trans	-62.8	-46.2	175.7	-69	165.2	0	0	0	110.3	R8 K9 E10 A14 T15 A16	R8-I12 HydrophobicContact CG-CD1 4.01Å; R8-I12 VanDerWaalsContact O-CG1 3.31Å; R8-I12 WeakPolarHBondContact O-CG1 3.48Å; R8-I12 PolarHBondContact O-N 3.39Å; K9-I12 PolarHBondContact O-N 2.99Å; E10-I12 PolarHBondContact O-N 3.06Å; I12-A14 PolarHBondContact O-N 3.33Å; I12-T15 PolarHBondContact O-N 3.49Å; I12-A16 WeakPolarHBondContact O-CB 3.43Å; I12-A16 PolarHBondContact O-N 3.43Å
13	Q	98.4	Very high	93.7	Very high	88 Å²	88	103.4 Å²	103.4	41%	0.411	53%	0.534	S	S	.	.	H	α-helix	trans	-65.6	-38.1	179.7	-71.5	-66.3	-37.9	0	0	112.2	K9 E10 A16 R17	K9-Q13 WeakPolarHBondContact O-CB 3.27Å; K9-Q13 VanDerWaalsContact O-CG 3.27Å; K9-Q13 WeakPolarHBondContact O-CG 3.48Å; K9-Q13 PolarHBondContact O-N 3.38Å; E10-Q13 PolarHBondContact O-N 2.87Å; Q13-A16 PolarHBondContact O-N 3.29Å; Q13-R17 WeakPolarHBondContact O-CB 3.23Å; Q13-R17 VanDerWaalsContact O-CG 3.23Å; Q13-R17 WeakPolarHBondContact O-CG 3.48Å; Q13-R17 PolarHBondContact O-N 2.97Å
14	A	98.2	Very high	95.6	Very high	55 Å²	55	101.4 Å²	101.4	46%	0.455	53%	0.526	S	S	.	.	H	α-helix	trans	-61.7	-47.4	174.2	0	0	0	0	0	111.2	E10 A11 I12 A16 R17 E18	E10-A14 WeakPolarHBondContact O-CB 3.47Å; E10-A14 PolarHBondContact O-N 3.27Å; A11-A14 PolarHBondContact O-N 2.94Å; I12-A14 PolarHBondContact O-N 3.33Å; A14-A16 PolarHBondContact O-N 3.02Å; A14-R17 PolarHBondContact O-N 3Å; A14-E18 PolarHBondContact O-N 3.29Å
15	T	98.3	Very high	96.7	Very high	101 Å²	101	101.4 Å²	101.4	62%	0.62	52%	0.516	S	S	*	.	H	α-helix	trans	-60	-46.1	177.5	-53.6	0	0	0	0	111.6	A11 I12 R17 E18 L19	A11-T15 PolarHBondContact O-N 2.86Å; A11-T15 PolarHBondContact O-OG1 3.48Å; I12-T15 PolarHBondContact O-N 3.49Å; T15-R17 PolarHBondContact O-N 3.32Å; T15-E18 PolarHBondContact O-N 3.49Å; T15-L19 PolarHBondContact O-N 3.46Å
16	A	98.6	Very high	97.4	Very high	43 Å²	43	99.4 Å²	99.4	36%	0.355	49%	0.493	S	S	.	.	H	α-helix	trans	-62.4	-42.5	178.1	0	0	0	0	0	112.3	I12 Q13 A14 E18 L19 L20	I12-A16 WeakPolarHBondContact O-CB 3.43Å; I12-A16 PolarHBondContact O-N 3.43Å; Q13-A16 PolarHBondContact O-N 3.29Å; A14-A16 PolarHBondContact O-N 3.02Å; A16-E18 VanDerWaalsContact C-N 3.35Å; A16-E18 PolarHBondContact O-N 3Å; A16-L19 PolarHBondContact O-N 3.47Å; A16-L20 WeakPolarHBondContact O-CG 3.34Å; A16-L20 PolarHBondContact O-N 2.99Å
17	R	98.7	Very high	97.7	Very high	156 Å²	156	95.2 Å²	95.2	59%	0.589	49%	0.49	S	S	*	.	H	α-helix	trans	-64.1	-39	176.7	-71.7	171.1	-161.3	-97.8	-0.4	112.1	Q13 A14 T15 L20 K21	Q13-R17 WeakPolarHBondContact O-CB 3.23Å; Q13-R17 VanDerWaalsContact O-CG 3.23Å; Q13-R17 WeakPolarHBondContact O-CG 3.48Å; Q13-R17 PolarHBondContact O-N 2.97Å; A14-R17 PolarHBondContact O-N 3Å; T15-R17 PolarHBondContact O-N 3.32Å; R17-L20 PolarHBondContact O-N 3.08Å; R17-K21 WeakPolarHBondContact O-CG 3.42Å; R17-K21 PolarHBondContact O-N 3.47Å
18	E	98.4	Very high	97.9	Very high	78 Å²	78	94.3 Å²	94.3	36%	0.364	48%	0.481	S	S	.	.	H	α-helix	trans	-66.3	-39.4	175.7	-77.5	-54.2	126.4	0	0	112.5	A14 T15 A16 K21 F22 R39	A14-E18 PolarHBondContact O-N 3.29Å; T15-E18 PolarHBondContact O-N 3.49Å; A16-E18 VanDerWaalsContact C-N 3.35Å; A16-E18 PolarHBondContact O-N 3Å; E18-K21 PolarHBondContact O-N 2.7Å; E18-K21 WeakPolarHBondContact OE1-CD 3.48Å; E18-K21 WeakPolarHBondContact OE1-CE 3.44Å; E18-K21 IonicContact OE1-NZ 2.7Å; E18-K21 PolarHBondContact OE1-NZ 3.4Å; E18-F22 PolarHBondContact O-N 2.96Å; E18-R39 IonicContact OE2-NH1 3.99Å
19	L	98.5	Very high	98.1	Very high	108 Å²	108	89.2 Å²	89.2	57%	0.565	47%	0.472	S	S	*	.	H	α-helix	trans	-60.7	-45.9	171.9	176.6	62.6	0	0	0	111.5	T15 A16 K21 F22 V23	T15-L19 PolarHBondContact O-N 3.46Å; A16-L19 PolarHBondContact O-N 3.47Å; L19-K21 VanDerWaalsContact C-N 3.31Å; L19-K21 PolarHBondContact O-N 3.41Å; L19-F22 WeakPolarHBondContact O-CB 3.4Å; L19-F22 PolarHBondContact O-N 2.81Å; L19-F22 VanDerWaalsContact O-N 3.13Å; L19-V23 HydrophobicContact CD1-CG2 4.14Å; L19-V23 HydrophobicContact CG-CG2 4.45Å; L19-V23 WeakPolarHBondContact O-CG2 3.2Å; L19-V23 PolarHBondContact O-N 2.96Å
20	L	98.6	Very high	98.1	Very high	106 Å²	106	87.7 Å²	87.7	56%	0.555	47%	0.465	S	S	*	.	H	α-helix	trans	-60.4	-41.1	177.7	-69.5	174	0	0	0	111.9	A16 R17 V23 N24	A16-L20 WeakPolarHBondContact O-CG 3.34Å; A16-L20 PolarHBondContact O-N 2.99Å; R17-L20 PolarHBondContact O-N 3.08Å; L20-V23 PolarHBondContact O-N 3.36Å; L20-N24 VanDerWaalsContact O-CB 3.31Å; L20-N24 WeakPolarHBondContact O-CB 3.4Å; L20-N24 PolarHBondContact O-N 3.13Å; L20-N24 PolarHBondContact O-ND2 2.98Å
21	K	98.6	Very high	98.2	Very high	98 Å²	98	87.3 Å²	87.3	43%	0.426	46%	0.463	S	S	.	.	H	α-helix	trans	-61.1	-43.6	173.6	-71	174.8	-171	171.4	0	111.7	R17 E18 L19 R25	R17-K21 WeakPolarHBondContact O-CG 3.42Å; R17-K21 PolarHBondContact O-N 3.47Å; E18-K21 PolarHBondContact O-N 2.7Å; E18-K21 WeakPolarHBondContact OE1-CD 3.48Å; E18-K21 WeakPolarHBondContact OE1-CE 3.44Å; E18-K21 IonicContact OE1-NZ 2.7Å; E18-K21 PolarHBondContact OE1-NZ 3.4Å; L19-K21 VanDerWaalsContact C-N 3.31Å; L19-K21 PolarHBondContact O-N 3.41Å; K21-R25 WeakPolarHBondContact O-CB 3.43Å; K21-R25 VanDerWaalsContact O-CG 3.29Å; K21-R25 WeakPolarHBondContact O-CG 3.42Å; K21-R25 PolarHBondContact O-N 2.85Å; K21-R25 VanDerWaalsContact O-N 3.13Å
22	F	98.6	Very high	98.3	Very high	50 Å²	50	87 Å²	87	22%	0.219	46%	0.456	C	S	.	.	H	α-helix	trans	-60.4	-49.5	177.5	-179.6	-92.4	0	0	0	111.5	E18 L19 R25 S26 V32 E35	E18-F22 PolarHBondContact O-N 2.96Å; L19-F22 WeakPolarHBondContact O-CB 3.4Å; L19-F22 PolarHBondContact O-N 2.81Å; L19-F22 VanDerWaalsContact O-N 3.13Å; F22-R25 PolarHBondContact O-N 2.99Å; F22-S26 VanDerWaalsContact O-CB 3.28Å; F22-S26 WeakPolarHBondContact O-CB 3.4Å; F22-S26 PolarHBondContact O-N 3.33Å; F22-S26 PolarHBondContact O-OG 3.01Å; F22-V32 HydrophobicContact CE1-CG1 4.39Å; F22-V32 HydrophobicContact CZ-CG1 3.98Å; F22-E35 HydrophobicContact CD2-CB 4.42Å; F22-E35 HydrophobicContact CD2-CG 3.43Å; F22-E35 VanDerWaalsContact CD2-CG 3.43Å; F22-E35 HydrophobicContact CE2-CB 4.16Å; F22-E35 HydrophobicContact CE2-CG 3.61Å; F22-E35 HydrophobicContact CG-CG 4.41Å
23	V	98.5	Very high	98.3	Very high	82 Å²	82	83 Å²	83	50%	0.497	44%	0.435	S	S	.	.	H	α-helix	trans	-61.8	-47.5	179.1	171.9	0	0	0	0	111.2	L19 L20 R25 S26	L19-V23 HydrophobicContact CD1-CG2 4.14Å; L19-V23 HydrophobicContact CG-CG2 4.45Å; L19-V23 WeakPolarHBondContact O-CG2 3.2Å; L19-V23 PolarHBondContact O-N 2.96Å; L20-V23 PolarHBondContact O-N 3.36Å; V23-R25 PolarHBondContact O-N 2.87Å; V23-S26 PolarHBondContact O-N 2.91Å
24	N	98.3	Very high	98.3	Very high	130 Å²	130	81.4 Å²	81.4	70%	0.695	44%	0.438	S	S	*	.	H	α-helix	trans	-63	-29.1	-179.1	-72.4	-16.5	0	0	0	113.2	L20 S26	L20-N24 VanDerWaalsContact O-CB 3.31Å; L20-N24 WeakPolarHBondContact O-CB 3.4Å; L20-N24 PolarHBondContact O-N 3.13Å; L20-N24 PolarHBondContact O-ND2 2.98Å; N24-S26 VanDerWaalsContact C-N 3.31Å
25	R	97.9	Very high	98.3	Very high	146 Å²	146	79.8 Å²	79.8	55%	0.551	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.2	-7.9	175.4	-71.2	176.3	-179.4	175.9	-2.9	113.7	K21 F22 V23 P27 E35	K21-R25 WeakPolarHBondContact O-CB 3.43Å; K21-R25 VanDerWaalsContact O-CG 3.29Å; K21-R25 WeakPolarHBondContact O-CG 3.42Å; K21-R25 PolarHBondContact O-N 2.85Å; K21-R25 VanDerWaalsContact O-N 3.13Å; F22-R25 PolarHBondContact O-N 2.99Å; V23-R25 PolarHBondContact O-N 2.87Å; R25-P27 VanDerWaalsContact O-CD 3.24Å; R25-P27 WeakPolarHBondContact O-CD 3.44Å; R25-E35 VanDerWaalsContact CD-OE2 3.31Å; R25-E35 WeakPolarHBondContact CD-OE2 3.09Å; R25-E35 IonicContact NH1-OE1 2.83Å; R25-E35 PolarHBondContact NH1-OE1 2.89Å; R25-E35 IonicContact NH1-OE2 3.23Å
26	S	97.3	Very high	98.3	Very high	16 Å²	16	76.4 Å²	76.4	11%	0.112	40%	0.401	C	S	.	.			trans	-122	59.6	-167.3	-54.2	0	0	0	0	113.4	F22 V23 N24 S28	F22-S26 VanDerWaalsContact O-CB 3.28Å; F22-S26 WeakPolarHBondContact O-CB 3.4Å; F22-S26 PolarHBondContact O-N 3.33Å; F22-S26 PolarHBondContact O-OG 3.01Å; V23-S26 PolarHBondContact O-N 2.91Å; N24-S26 VanDerWaalsContact C-N 3.31Å; S26-S28 PolarHBondContact O-N 2.95Å
27	P	97.5	Very high	98.3	Very high	102 Å²	102	79.7 Å²	79.7	66%	0.662	40%	0.404	S	S	*	.	S	Bend	trans	-71	-9.4	-175.7	30.3	-38.1	0	0	0	114.5	R25 H31	R25-P27 VanDerWaalsContact O-CD 3.24Å; R25-P27 WeakPolarHBondContact O-CD 3.44Å; P27-H31 HydrophobicContact CG-CB 4.28Å
28	S	98.1	Very high	98.3	Very high	34 Å²	34	74.6 Å²	74.6	24%	0.238	39%	0.392	C	S	.	.	S	Bend	trans	-147.5	164.7	174.3	80.4	0	0	0	0	111	S26 F30 H31 V32	S26-S28 PolarHBondContact O-N 2.95Å; S28-F30 PolarHBondContact O-N 3.03Å; S28-F30 VanDerWaalsContact O-N 3.15Å; S28-H31 WeakPolarHBondContact O-CA 3.44Å; S28-H31 WeakPolarHBondContact O-CB 3.37Å; S28-H31 PolarHBondContact O-N 3.24Å; S28-H31 PolarHBondContact OG-ND1 3.34Å; S28-V32 WeakPolarHBondContact O-CG2 3.4Å; S28-V32 PolarHBondContact O-N 3.11Å
29	P	98.1	Very high	98.3	Very high	80 Å²	80	74.9 Å²	74.9	52%	0.519	39%	0.39	S	S	.	.	H	α-helix	trans	-54.5	-34.1	177.8	-27.8	36.1	0	0	0	114	V32 V33	P29-V32 WeakPolarHBondContact O-CB 3.31Å; P29-V32 PolarHBondContact O-N 3.48Å; P29-V33 PolarHBondContact O-N 3.39Å
30	F	98.2	Very high	98.3	Very high	113 Å²	113	71 Å²	71	50%	0.496	37%	0.37	S	S	.	.	H	α-helix	trans	-65	-40.7	175.4	-56.3	-78.4	0	0	0	112.2	S28 V33 A34 S68	S28-F30 PolarHBondContact O-N 3.03Å; S28-F30 VanDerWaalsContact O-N 3.15Å; F30-V33 PolarHBondContact O-N 3.06Å; F30-A34 WeakPolarHBondContact O-CB 3.23Å; F30-A34 PolarHBondContact O-N 3.3Å; F30-S68 WeakPolarHBondContact CA-O 3.47Å; F30-S68 WeakPolarHBondContact CD1-O 3.47Å
31	H	98.4	Very high	98.3	Very high	97 Å²	97	70 Å²	70	45%	0.449	36%	0.364	S	S	.	.	H	α-helix	trans	-70.9	-35.3	175.9	-63.9	92.5	0	0	0	112	P27 S28 V33 A34 E35	P27-H31 HydrophobicContact CG-CB 4.28Å; S28-H31 WeakPolarHBondContact O-CA 3.44Å; S28-H31 WeakPolarHBondContact O-CB 3.37Å; S28-H31 PolarHBondContact O-N 3.24Å; S28-H31 PolarHBondContact OG-ND1 3.34Å; H31-V33 VanDerWaalsContact C-N 3.34Å; H31-V33 PolarHBondContact O-N 3.5Å; H31-A34 PolarHBondContact O-N 3.4Å; H31-E35 WeakPolarHBondContact O-CB 3.4Å; H31-E35 PolarHBondContact O-N 3.05Å
32	V	98.5	Very high	98.3	Very high	51 Å²	51	72.7 Å²	72.7	31%	0.309	38%	0.378	S	S	.	.	H	α-helix	trans	-56.4	-50.8	171.5	176.2	0	0	0	0	109.9	F22 S28 P29 A34 E35 C36	F22-V32 HydrophobicContact CE1-CG1 4.39Å; F22-V32 HydrophobicContact CZ-CG1 3.98Å; S28-V32 WeakPolarHBondContact O-CG2 3.4Å; S28-V32 PolarHBondContact O-N 3.11Å; P29-V32 WeakPolarHBondContact O-CB 3.31Å; P29-V32 PolarHBondContact O-N 3.48Å; V32-A34 VanDerWaalsContact C-N 3.34Å; V32-A34 PolarHBondContact O-N 2.96Å; V32-E35 PolarHBondContact O-N 2.87Å; V32-C36 WeakPolarHBondContact O-CB 3.38Å; V32-C36 PolarHBondContact O-N 3.31Å; V32-C36 PolarHBondContact O-SG 2.89Å; V32-C36 VanDerWaalsContact O-SG 3.33Å
33	V	98.6	Very high	98.3	Very high	8 Å²	8	72.7 Å²	72.7	5%	0.048	39%	0.388	C	S	.	.	H	α-helix	trans	-63.2	-40.1	178.9	168.4	0	0	0	0	111.6	P29 F30 H31 C36 R37 T65 S68 I71	P29-V33 PolarHBondContact O-N 3.39Å; F30-V33 PolarHBondContact O-N 3.06Å; H31-V33 VanDerWaalsContact C-N 3.34Å; H31-V33 PolarHBondContact O-N 3.5Å; V33-C36 PolarHBondContact O-N 2.94Å; V33-R37 VanDerWaalsContact O-CB 3.3Å; V33-R37 WeakPolarHBondContact O-CB 3.31Å; V33-R37 PolarHBondContact O-N 3.44Å; V33-T65 HydrophobicContact CG1-CG2 3.56Å; V33-S68 WeakPolarHBondContact CB-O 3.5Å; V33-I71 HydrophobicContact CG1-CB 4.22Å; V33-I71 HydrophobicContact CG1-CD1 4.5Å; V33-I71 HydrophobicContact CG2-CB 4.23Å; V33-I71 HydrophobicContact CG2-CG2 4.24Å
34	A	98.4	Very high	98.3	Very high	56 Å²	56	71.4 Å²	71.4	46%	0.463	39%	0.391	S	S	.	.	H	α-helix	trans	-63.4	-42.9	176.6	0	0	0	0	0	112.7	F30 H31 V32 R37 S38	F30-A34 WeakPolarHBondContact O-CB 3.23Å; F30-A34 PolarHBondContact O-N 3.3Å; H31-A34 PolarHBondContact O-N 3.4Å; V32-A34 VanDerWaalsContact C-N 3.34Å; V32-A34 PolarHBondContact O-N 2.96Å; A34-R37 PolarHBondContact O-N 3.25Å; A34-S38 PolarHBondContact O-N 2.82Å
35	E	98.6	Very high	98.4	Very high	21 Å²	21	67 Å²	67	10%	0.098	37%	0.365	C	S	.	.	H	α-helix	trans	-66.4	-42.3	175.7	179	67.6	-173.8	0	0	111.1	F22 R25 H31 V32 S38 R39	F22-E35 HydrophobicContact CD2-CB 4.42Å; F22-E35 HydrophobicContact CD2-CG 3.43Å; F22-E35 VanDerWaalsContact CD2-CG 3.43Å; F22-E35 HydrophobicContact CE2-CB 4.16Å; F22-E35 HydrophobicContact CE2-CG 3.61Å; F22-E35 HydrophobicContact CG-CG 4.41Å; R25-E35 VanDerWaalsContact CD-OE2 3.31Å; R25-E35 WeakPolarHBondContact CD-OE2 3.09Å; R25-E35 IonicContact NH1-OE1 2.83Å; R25-E35 PolarHBondContact NH1-OE1 2.89Å; R25-E35 IonicContact NH1-OE2 3.23Å; H31-E35 WeakPolarHBondContact O-CB 3.4Å; H31-E35 PolarHBondContact O-N 3.05Å; V32-E35 PolarHBondContact O-N 2.87Å; E35-S38 PolarHBondContact O-N 2.81Å; E35-R39 WeakPolarHBondContact O-CG 3.29Å; E35-R39 PolarHBondContact O-N 3.44Å; E35-R39 IonicContact OE1-CZ 3.25Å; E35-R39 VanDerWaalsContact OE1-CZ 3.25Å; E35-R39 IonicContact OE1-NE 2.81Å; E35-R39 PolarHBondContact OE1-NE 3.13Å; E35-R39 IonicContact OE1-NH2 2.82Å; E35-R39 PolarHBondContact OE1-NH2 2.96Å
36	C	98.6	Very high	98.4	Very high	30 Å²	30	66.1 Å²	66.1	20%	0.203	36%	0.362	C	S	.	.	H	α-helix	trans	-59.9	-47.2	173.5	-73	0	0	0	0	111.7	V32 V33 S38 R39 L40 I71	V32-C36 WeakPolarHBondContact O-CB 3.38Å; V32-C36 PolarHBondContact O-N 3.31Å; V32-C36 PolarHBondContact O-SG 2.89Å; V32-C36 VanDerWaalsContact O-SG 3.33Å; V33-C36 PolarHBondContact O-N 2.94Å; C36-S38 PolarHBondContact O-N 3.23Å; C36-R39 PolarHBondContact O-N 3.24Å; C36-L40 WeakPolarHBondContact O-CB 3.28Å; C36-L40 WeakPolarHBondContact O-CD1 3.49Å; C36-L40 VanDerWaalsContact O-CG 3.23Å; C36-L40 WeakPolarHBondContact O-CG 3.3Å; C36-L40 PolarHBondContact O-N 3.45Å; C36-I71 HydrophobicContact CB-CD1 3.86Å; C36-I71 HydrophobicContact CB-CG2 4.25Å
37	R	98.6	Very high	98.4	Very high	111 Å²	111	68.4 Å²	68.4	42%	0.419	37%	0.371	S	S	.	.	H	α-helix	trans	-55.4	-48.6	175.8	173.6	171.7	-172.7	-140.1	5	111.3	V33 A34 R39 L40 L41 E47 F63 I71	V33-R37 VanDerWaalsContact O-CB 3.3Å; V33-R37 WeakPolarHBondContact O-CB 3.31Å; V33-R37 PolarHBondContact O-N 3.44Å; A34-R37 PolarHBondContact O-N 3.25Å; R37-R39 PolarHBondContact O-N 3.32Å; R37-L40 PolarHBondContact O-N 2.71Å; R37-L41 HydrophobicContact CG-CD1 3.94Å; R37-L41 WeakPolarHBondContact O-CB 3.12Å; R37-L41 VanDerWaalsContact O-CG 3.3Å; R37-L41 WeakPolarHBondContact O-CG 3.4Å; R37-L41 PolarHBondContact O-N 2.93Å; R37-E47 IonicContact CZ-OE1 3.72Å; R37-E47 IonicContact CZ-OE2 3.58Å; R37-E47 IonicContact NE-OE1 2.68Å; R37-E47 PolarHBondContact NE-OE1 3.05Å; R37-E47 IonicContact NE-OE2 3.19Å; R37-E47 PolarHBondContact NE-OE2 3.35Å; R37-E47 IonicContact NH2-OE1 3.15Å; R37-E47 IonicContact NH2-OE2 3.52Å; R37-E47 PolarHBondContact NH2-OE2 2.89Å; R37-F63 HydrophobicContact CB-CE2 4.12Å; R37-F63 HydrophobicContact CB-CZ 4.44Å; R37-F63 HydrophobicContact CG-CE2 3.7Å; R37-F63 HydrophobicContact CG-CZ 3.7Å; R37-I71 HydrophobicContact CB-CD1 4.45Å
38	S	98.5	Very high	98.4	Very high	49 Å²	49	64.4 Å²	64.4	34%	0.343	34%	0.344	S	S	.	.	H	α-helix	trans	-58.6	-45.7	178.1	-178.5	0	0	0	0	112.4	A34 E35 C36 L41 Q42	A34-S38 PolarHBondContact O-N 2.82Å; E35-S38 PolarHBondContact O-N 2.81Å; C36-S38 PolarHBondContact O-N 3.23Å; S38-L41 PolarHBondContact O-N 3.17Å; S38-Q42 VanDerWaalsContact O-CG 3.31Å; S38-Q42 WeakPolarHBondContact O-CG 3.28Å; S38-Q42 PolarHBondContact O-N 2.98Å; S38-Q42 PolarHBondContact O-NE2 3.46Å; S38-Q42 PolarHBondContact OG-NE2 3.43Å
39	R	98.6	Very high	98.4	Very high	84 Å²	84	68.6 Å²	68.6	32%	0.317	36%	0.358	S	S	.	.	H	α-helix	trans	-66.2	-39.8	178.2	-69.8	175.4	-178.2	-116.2	-0.8	112.6	E18 E35 C36 R37 Q42 A43	E18-R39 IonicContact OE2-NH1 3.99Å; E35-R39 WeakPolarHBondContact O-CG 3.29Å; E35-R39 PolarHBondContact O-N 3.44Å; E35-R39 IonicContact OE1-CZ 3.25Å; E35-R39 VanDerWaalsContact OE1-CZ 3.25Å; E35-R39 IonicContact OE1-NE 2.81Å; E35-R39 PolarHBondContact OE1-NE 3.13Å; E35-R39 IonicContact OE1-NH2 2.82Å; E35-R39 PolarHBondContact OE1-NH2 2.96Å; C36-R39 PolarHBondContact O-N 3.24Å; R37-R39 PolarHBondContact O-N 3.32Å; R39-Q42 PolarHBondContact O-N 2.88Å; R39-A43 WeakPolarHBondContact O-CB 3.45Å; R39-A43 PolarHBondContact O-N 3.37Å
40	L	98.8	Very high	98.1	Very high	28 Å²	28	69.3 Å²	69.3	15%	0.147	36%	0.355	C	S	.	.	H	α-helix	trans	-65.6	-44.1	177.8	-73.1	164.5	0	0	0	111.5	C36 R37 Q42 A43 G44 F45 F63 I71 A73	C36-L40 WeakPolarHBondContact O-CB 3.28Å; C36-L40 WeakPolarHBondContact O-CD1 3.49Å; C36-L40 VanDerWaalsContact O-CG 3.23Å; C36-L40 WeakPolarHBondContact O-CG 3.3Å; C36-L40 PolarHBondContact O-N 3.45Å; R37-L40 PolarHBondContact O-N 2.71Å; L40-Q42 VanDerWaalsContact C-N 3.35Å; L40-Q42 PolarHBondContact O-N 3.3Å; L40-A43 CarbonylContact O-C 3.52Å; L40-A43 PolarHBondContact O-N 3.33Å; L40-A43 VanDerWaalsContact O-N 3.11Å; L40-G44 PolarHBondContact O-N 2.99Å; L40-F45 HydrophobicContact CB-CB 4.07Å; L40-F45 HydrophobicContact CB-CD2 4.39Å; L40-F45 HydrophobicContact CB-CG 4.2Å; L40-F45 HydrophobicContact CD2-CD1 3.83Å; L40-F45 HydrophobicContact CD2-CD2 3.79Å; L40-F45 HydrophobicContact CD2-CE1 3.92Å; L40-F45 HydrophobicContact CD2-CE2 3.84Å; L40-F45 HydrophobicContact CD2-CG 3.8Å; L40-F45 HydrophobicContact CD2-CZ 3.92Å; L40-F45 WeakPolarHBondContact O-CB 3.31Å; L40-F45 WeakPolarHBondContact O-CD2 3.25Å; L40-F45 PolarHBondContact O-N 3.4Å; L40-F63 HydrophobicContact CB-CD1 4.02Å; L40-F63 HydrophobicContact CB-CE1 4.28Å; L40-F63 HydrophobicContact CB-CG 4.4Å; L40-F63 HydrophobicContact CD1-CB 3.89Å; L40-F63 HydrophobicContact CD1-CD1 4.35Å; L40-F63 HydrophobicContact CD1-CD2 4.24Å; L40-F63 HydrophobicContact CD1-CG 3.9Å; L40-I71 HydrophobicContact CD1-CD1 3.56Å; L40-I71 HydrophobicContact CD1-CG1 4.32Å; L40-A73 HydrophobicContact CD1-CB 3.78Å; L40-A73 HydrophobicContact CD2-CB 3.71Å; L40-A73 HydrophobicContact CG-CB 4.42Å
41	L	98.6	Very high	97.9	Very high	84 Å²	84	70.3 Å²	70.3	44%	0.44	37%	0.37	S	S	.	.	H	α-helix	trans	-59.5	-45.1	174.2	-71.1	168.5	0	0	0	111.3	R37 S38 A43 G44 F63	R37-L41 HydrophobicContact CG-CD1 3.94Å; R37-L41 WeakPolarHBondContact O-CB 3.12Å; R37-L41 VanDerWaalsContact O-CG 3.3Å; R37-L41 WeakPolarHBondContact O-CG 3.4Å; R37-L41 PolarHBondContact O-N 2.93Å; S38-L41 PolarHBondContact O-N 3.17Å; L41-A43 VanDerWaalsContact C-N 3.25Å; L41-A43 PolarHBondContact O-N 3.36Å; L41-G44 PolarHBondContact O-N 2.84Å; L41-F63 HydrophobicContact CD2-CE1 3.85Å; L41-F63 HydrophobicContact CD2-CZ 4.08Å; L41-F63 HydrophobicContact CG-CE1 4.05Å; L41-F63 HydrophobicContact CG-CZ 4.07Å
42	Q	98.5	Very high	97.7	Very high	154 Å²	154	70.4 Å²	70.4	72%	0.72	37%	0.371	S	S	*	.	H	α-helix	trans	-62.5	-31.2	175.1	-71.9	170.3	53.4	0	0	112.9	S38 R39 L40 G44	S38-Q42 VanDerWaalsContact O-CG 3.31Å; S38-Q42 WeakPolarHBondContact O-CG 3.28Å; S38-Q42 PolarHBondContact O-N 2.98Å; S38-Q42 PolarHBondContact O-NE2 3.46Å; S38-Q42 PolarHBondContact OG-NE2 3.43Å; R39-Q42 PolarHBondContact O-N 2.88Å; L40-Q42 VanDerWaalsContact C-N 3.35Å; L40-Q42 PolarHBondContact O-N 3.3Å; Q42-G44 PolarHBondContact O-N 3.43Å
43	A	98.4	Very high	97.5	Very high	50 Å²	50	71.9 Å²	71.9	41%	0.413	40%	0.397	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82	5.9	175.4	0	0	0	0	0	113.8	R39 L40 L41 F45 K61	R39-A43 WeakPolarHBondContact O-CB 3.45Å; R39-A43 PolarHBondContact O-N 3.37Å; L40-A43 CarbonylContact O-C 3.52Å; L40-A43 PolarHBondContact O-N 3.33Å; L40-A43 VanDerWaalsContact O-N 3.11Å; L41-A43 VanDerWaalsContact C-N 3.25Å; L41-A43 PolarHBondContact O-N 3.36Å; A43-F45 HydrophobicContact CB-CD2 3.97Å; A43-F45 HydrophobicContact CB-CE2 4.11Å; A43-K61 PolarHBondContact O-NZ 3.19Å
44	G	98.4	Very high	97.4	Very high	55 Å²	55	77 Å²	77	57%	0.567	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.3	25.3	177.5	0	0	0	0	0	114.4	L40 L41 Q42	L40-G44 PolarHBondContact O-N 2.99Å; L41-G44 PolarHBondContact O-N 2.84Å; Q42-G44 PolarHBondContact O-N 3.43Å
45	F	98.7	Very high	97.2	Very high	37 Å²	37	80 Å²	80	16%	0.162	42%	0.423	C	S	.	.	P	Polyproline II helix	trans	-79.4	143.7	168.9	-72.8	-116.3	0	0	0	110.5	L40 A43 K61 Y62 F63 A73	L40-F45 HydrophobicContact CB-CB 4.07Å; L40-F45 HydrophobicContact CB-CD2 4.39Å; L40-F45 HydrophobicContact CB-CG 4.2Å; L40-F45 HydrophobicContact CD2-CD1 3.83Å; L40-F45 HydrophobicContact CD2-CD2 3.79Å; L40-F45 HydrophobicContact CD2-CE1 3.92Å; L40-F45 HydrophobicContact CD2-CE2 3.84Å; L40-F45 HydrophobicContact CD2-CG 3.8Å; L40-F45 HydrophobicContact CD2-CZ 3.92Å; L40-F45 WeakPolarHBondContact O-CB 3.31Å; L40-F45 WeakPolarHBondContact O-CD2 3.25Å; L40-F45 PolarHBondContact O-N 3.4Å; A43-F45 HydrophobicContact CB-CD2 3.97Å; A43-F45 HydrophobicContact CB-CE2 4.11Å; F45-K61 WeakPolarHBondContact CA-O 3.46Å; F45-K61 HydrophobicContact CB-CB 4.34Å; F45-K61 HydrophobicContact CD1-CB 3.59Å; F45-K61 HydrophobicContact CD2-CB 4Å; F45-K61 HydrophobicContact CD2-CD 4.14Å; F45-K61 HydrophobicContact CE1-CB 3.75Å; F45-K61 HydrophobicContact CE1-CD 4.44Å; F45-K61 HydrophobicContact CE1-CG 4.25Å; F45-K61 HydrophobicContact CE2-CB 4.16Å; F45-K61 HydrophobicContact CE2-CD 3.7Å; F45-K61 HydrophobicContact CE2-CG 4.36Å; F45-K61 HydrophobicContact CG-CB 3.71Å; F45-K61 HydrophobicContact CZ-CB 4.03Å; F45-K61 HydrophobicContact CZ-CD 3.85Å; F45-K61 HydrophobicContact CZ-CG 4.14Å; F45-Y62 WeakPolarHBondContact CD1-O 3.3Å; F45-F63 HydrophobicContact CB-CD1 3.8Å; F45-F63 HydrophobicContact CB-CE1 4.39Å; F45-A73 HydrophobicContact CD1-CB 4.43Å; F45-A73 HydrophobicContact CE1-CB 4.19Å
46	R	98.3	Very high	97.1	Very high	128 Å²	128	81.5 Å²	81.5	48%	0.483	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	132.1	173.2	-173.9	171.3	76	-170.4	3.3	110.8	D55 K61 Y62 F63	R46-D55 PolarHBondContact NH2-O 3.35Å; R46-K61 PolarHBondContact N-O 2.83Å; R46-Y62 HydrophobicContact CB-CD1 4.04Å; R46-Y62 HydrophobicContact CB-CE1 4.37Å; R46-Y62 VanDerWaalsContact NH2-CE1 3.28Å; R46-Y62 CarbonylContact O-C 3.49Å; R46-Y62 VanDerWaalsContact O-CA 3.25Å; R46-Y62 WeakPolarHBondContact O-CA 3.48Å; R46-F63 PolarHBondContact O-N 2.92Å
47	E	98.1	Very high	96.9	Very high	65 Å²	65	83 Å²	83	30%	0.304	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.6	134	173.5	-167.7	164.7	-170.2	0	0	110.8	R37 F63	R37-E47 IonicContact CZ-OE1 3.72Å; R37-E47 IonicContact CZ-OE2 3.58Å; R37-E47 IonicContact NE-OE1 2.68Å; R37-E47 PolarHBondContact NE-OE1 3.05Å; R37-E47 IonicContact NE-OE2 3.19Å; R37-E47 PolarHBondContact NE-OE2 3.35Å; R37-E47 IonicContact NH2-OE1 3.15Å; R37-E47 IonicContact NH2-OE2 3.52Å; R37-E47 PolarHBondContact NH2-OE2 2.89Å; E47-F63 CarbonylContact C-O 3.59Å; E47-F63 WeakPolarHBondContact CA-O 3.48Å; E47-F63 HydrophobicContact CB-CD1 4.43Å; E47-F63 HydrophobicContact CB-CE1 3.68Å; E47-F63 HydrophobicContact CB-CE2 4.02Å; E47-F63 HydrophobicContact CB-CZ 3.43Å; E47-F63 VanDerWaalsContact CB-CZ 3.43Å; E47-F63 HydrophobicContact CG-CD2 4.36Å; E47-F63 HydrophobicContact CG-CE1 4.25Å; E47-F63 HydrophobicContact CG-CE2 3.64Å; E47-F63 HydrophobicContact CG-CZ 3.57Å
48	L	98.3	Very high	96.8	Very high	17 Å²	17	79.9 Å²	79.9	9%	0.089	43%	0.434	C	S	.	.			trans	-106.4	144.4	173.2	-59.3	177.1	0	0	0	109.6	W54 I56 Y62 F63 L64 F74	L48-W54 HydrophobicContact CD1-CD2 4Å; L48-W54 HydrophobicContact CD1-CE3 4.32Å; L48-W54 HydrophobicContact CD1-CG 4.12Å; L48-I56 HydrophobicContact CD1-CD1 3.65Å; L48-Y62 HydrophobicContact CD1-CD1 4.24Å; L48-Y62 HydrophobicContact CD1-CG 4.07Å; L48-Y62 HydrophobicContact CD2-CD1 3.9Å; L48-Y62 HydrophobicContact CG-CD1 4.16Å; L48-Y62 HydrophobicContact CG-CG 4.4Å; L48-F63 PolarHBondContact N-O 2.81Å; L48-L64 HydrophobicContact CB-CB 4.42Å; L48-F74 HydrophobicContact CD1-CE1 4.37Å; L48-F74 HydrophobicContact CD1-CZ 3.96Å
49	K	96.1	Very high	96.8	Very high	122 Å²	122	85.2 Å²	85.2	53%	0.53	45%	0.453	S	S	.	.			trans	-94.9	130.4	171.5	-57.4	-162.7	-155	142.4	0	110.4	T51 E52 W54	K49-T51 PolarHBondContact O-N 3.33Å; K49-T51 VanDerWaalsContact O-N 3.08Å; K49-E52 HydrophobicContact CB-CB 4.28Å; K49-E52 HydrophobicContact CB-CG 4Å; K49-E52 HydrophobicContact CD-CG 4.49Å; K49-E52 VanDerWaalsContact CD-OE1 3.3Å; K49-E52 WeakPolarHBondContact CD-OE1 3.46Å; K49-E52 WeakPolarHBondContact CE-OE1 3.44Å; K49-E52 IonicContact NZ-OE1 2.74Å; K49-E52 PolarHBondContact NZ-OE1 3.43Å; K49-E52 PolarHBondContact O-N 3.49Å; K49-E52 VanDerWaalsContact O-N 3.12Å; K49-W54 PolarHBondContact O-NE1 3.02Å
50	E	93	Very high	96.7	Very high	96 Å²	96	84.5 Å²	84.5	45%	0.449	46%	0.456	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.7	-23.4	-179.7	-167.3	173.5	-170.8	0	0	113.5	R66	E50-R66 VanDerWaalsContact OE1-CD 3.32Å; E50-R66 WeakPolarHBondContact OE1-CD 3.47Å; E50-R66 IonicContact OE1-CZ 3.88Å; E50-R66 IonicContact OE1-NH1 2.96Å; E50-R66 PolarHBondContact OE1-NH1 2.99Å; E50-R66 WeakPolarHBondContact OE2-CD 3.43Å
51	T	94.3	Very high	96.7	Very high	133 Å²	133	87 Å²	87	82%	0.816	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.7	-3.6	-177.5	57.8	0	0	0	0	114.5	K49	K49-T51 PolarHBondContact O-N 3.33Å; K49-T51 VanDerWaalsContact O-N 3.08Å
52	E	94.7	Very high	96.7	Very high	99 Å²	99	83.1 Å²	83.1	46%	0.463	45%	0.445	S	S	.	.	S	Bend	trans	-107.3	152.6	-177.2	-68.2	175.2	179.6	0	0	110.3	K49 W54	K49-E52 HydrophobicContact CB-CB 4.28Å; K49-E52 HydrophobicContact CB-CG 4Å; K49-E52 HydrophobicContact CD-CG 4.49Å; K49-E52 VanDerWaalsContact CD-OE1 3.3Å; K49-E52 WeakPolarHBondContact CD-OE1 3.46Å; K49-E52 WeakPolarHBondContact CE-OE1 3.44Å; K49-E52 IonicContact NZ-OE1 2.74Å; K49-E52 PolarHBondContact NZ-OE1 3.43Å; K49-E52 PolarHBondContact O-N 3.49Å; K49-E52 VanDerWaalsContact O-N 3.12Å; E52-W54 PolarHBondContact O-NE1 3.46Å
53	G	94.5	Very high	96.7	Very high	83 Å²	83	75.8 Å²	75.8	86%	0.856	41%	0.411	S	S	*	.			trans	-64.7	136.7	168.9	0	0	0	0	0	110.3
54	W	95.9	Very high	96.7	Very high	115 Å²	115	74.1 Å²	74.1	44%	0.436	40%	0.395	S	S	.	.			trans	-103.2	130.3	-179.1	-56.4	-17.6	0	0	0	111.2	L48 K49 E52 I56 L64	L48-W54 HydrophobicContact CD1-CD2 4Å; L48-W54 HydrophobicContact CD1-CE3 4.32Å; L48-W54 HydrophobicContact CD1-CG 4.12Å; K49-W54 PolarHBondContact O-NE1 3.02Å; E52-W54 PolarHBondContact O-NE1 3.46Å; W54-I56 HydrophobicContact CB-CD1 3.9Å; W54-I56 HydrophobicContact CB-CG1 4.05Å; W54-L64 HydrophobicContact CH2-CD1 3.64Å; W54-L64 HydrophobicContact CZ2-CD1 3.73Å
55	D	93.9	Very high	96.7	Very high	118 Å²	118	73.2 Å²	73.2	63%	0.631	38%	0.378	S	S	*	.			trans	-102.4	106.4	163.9	-177	24.5	0	0	0	109	R46	R46-D55 PolarHBondContact NH2-O 3.35Å
56	I	95.6	Very high	96.6	Very high	54 Å²	54	78.8 Å²	78.8	28%	0.277	40%	0.398	S	S	.	.			trans	-103.8	103.4	-173.3	-57.3	-58.1	0	0	0	109.2	L48 W54 Y62 F74 V76	L48-I56 HydrophobicContact CD1-CD1 3.65Å; W54-I56 HydrophobicContact CB-CD1 3.9Å; W54-I56 HydrophobicContact CB-CG1 4.05Å; I56-Y62 HydrophobicContact CD1-CD2 4.03Å; I56-Y62 HydrophobicContact CD1-CE2 4.14Å; I56-Y62 HydrophobicContact CD1-CG 4.25Å; I56-Y62 HydrophobicContact CG2-CD2 4.3Å; I56-Y62 HydrophobicContact CG2-CE2 3.94Å; I56-F74 HydrophobicContact CD1-CE2 4.16Å; I56-F74 HydrophobicContact CD1-CZ 3.95Å; I56-F74 HydrophobicContact CG2-CE2 4.07Å; I56-V76 HydrophobicContact CG2-CG2 3.55Å
57	V	95.5	Very high	96.5	Very high	60 Å²	60	78.7 Å²	78.7	36%	0.364	41%	0.407	S	S	.	.			trans	-97.4	142	-177	-173	0	0	0	0	111.3	N60 Y62	V57-N60 WeakPolarHBondContact O-CB 3.24Å; V57-Y62 PolarHBondContact N-OH 2.94Å
58	P	96.5	Very high	96.3	Very high	47 Å²	47	78.9 Å²	78.9	31%	0.305	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-52.1	158	167.3	-27.5	36.4	0	0	0	113.7	N60	P58-N60 PolarHBondContact O-N 3.28Å; P58-N60 PolarHBondContact O-ND2 3.18Å
59	E	97.3	Very high	96.2	Very high	160 Å²	160	79.9 Å²	79.9	75%	0.748	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.1	6.7	-178.5	-53	-168.4	152.4	0	0	115.3	V76 G78	E59-V76 WeakPolarHBondContact CA-O 3.46Å; E59-V76 PolarHBondContact N-O 2.68Å; E59-G78 VanDerWaalsContact CG-CA 3.47Å
60	N	97.9	Very high	96.3	Very high	69 Å²	69	77.4 Å²	77.4	37%	0.369	42%	0.422	S	S	.	.			trans	-108	165.1	177.8	-73.2	-93.4	0	0	0	111.8	V57 P58 Y62 V76	V57-N60 WeakPolarHBondContact O-CB 3.24Å; P58-N60 PolarHBondContact O-N 3.28Å; P58-N60 PolarHBondContact O-ND2 3.18Å; N60-Y62 HydrophobicContact CB-CE1 4.24Å; N60-Y62 HydrophobicContact CB-CE2 3.66Å; N60-Y62 VanDerWaalsContact CB-CZ 3.43Å; N60-Y62 WeakPolarHBondContact CB-OH 3.38Å; N60-V76 PolarHBondContact O-N 2.74Å
61	K	98.5	Very high	96.6	Very high	82 Å²	82	75.2 Å²	75.2	36%	0.357	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.3	130.9	-172.5	-69.4	179.7	-75.1	172.8	0	109.8	A43 F45 R46 A75	A43-K61 PolarHBondContact O-NZ 3.19Å; F45-K61 WeakPolarHBondContact CA-O 3.46Å; F45-K61 HydrophobicContact CB-CB 4.34Å; F45-K61 HydrophobicContact CD1-CB 3.59Å; F45-K61 HydrophobicContact CD2-CB 4Å; F45-K61 HydrophobicContact CD2-CD 4.14Å; F45-K61 HydrophobicContact CE1-CB 3.75Å; F45-K61 HydrophobicContact CE1-CD 4.44Å; F45-K61 HydrophobicContact CE1-CG 4.25Å; F45-K61 HydrophobicContact CE2-CB 4.16Å; F45-K61 HydrophobicContact CE2-CD 3.7Å; F45-K61 HydrophobicContact CE2-CG 4.36Å; F45-K61 HydrophobicContact CG-CB 3.71Å; F45-K61 HydrophobicContact CZ-CB 4.03Å; F45-K61 HydrophobicContact CZ-CD 3.85Å; F45-K61 HydrophobicContact CZ-CG 4.14Å; R46-K61 PolarHBondContact N-O 2.83Å; K61-A75 HydrophobicContact CD-CB 4.4Å; K61-A75 HydrophobicContact CG-CB 3.77Å
62	Y	98.6	Very high	96.8	Very high	1 Å²	1	73.8 Å²	73.8	0%	0.004	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	152.6	-172	-53.2	-74.3	0	0	0	111.8	F45 R46 L48 I56 V57 N60 A73 F74 V76	F45-Y62 WeakPolarHBondContact CD1-O 3.3Å; R46-Y62 HydrophobicContact CB-CD1 4.04Å; R46-Y62 HydrophobicContact CB-CE1 4.37Å; R46-Y62 VanDerWaalsContact NH2-CE1 3.28Å; R46-Y62 CarbonylContact O-C 3.49Å; R46-Y62 VanDerWaalsContact O-CA 3.25Å; R46-Y62 WeakPolarHBondContact O-CA 3.48Å; L48-Y62 HydrophobicContact CD1-CD1 4.24Å; L48-Y62 HydrophobicContact CD1-CG 4.07Å; L48-Y62 HydrophobicContact CD2-CD1 3.9Å; L48-Y62 HydrophobicContact CG-CD1 4.16Å; L48-Y62 HydrophobicContact CG-CG 4.4Å; I56-Y62 HydrophobicContact CD1-CD2 4.03Å; I56-Y62 HydrophobicContact CD1-CE2 4.14Å; I56-Y62 HydrophobicContact CD1-CG 4.25Å; I56-Y62 HydrophobicContact CG2-CD2 4.3Å; I56-Y62 HydrophobicContact CG2-CE2 3.94Å; V57-Y62 PolarHBondContact N-OH 2.94Å; N60-Y62 HydrophobicContact CB-CE1 4.24Å; N60-Y62 HydrophobicContact CB-CE2 3.66Å; N60-Y62 VanDerWaalsContact CB-CZ 3.43Å; N60-Y62 WeakPolarHBondContact CB-OH 3.38Å; Y62-A73 WeakPolarHBondContact O-CA 3.47Å; Y62-F74 HydrophobicContact CD2-CD2 4.18Å; Y62-F74 AromaticContact CD2-CE2 3.53Å; Y62-F74 HydrophobicContact CD2-CE2 3.53Å; Y62-F74 HydrophobicContact CD2-CZ 4.02Å; Y62-F74 HydrophobicContact CG-CE2 4.09Å; Y62-F74 HydrophobicContact CG-CZ 4.13Å; Y62-F74 PolarHBondContact N-O 3.14Å; Y62-F74 PolarHBondContact O-N 3.2Å; Y62-F74 VanDerWaalsContact O-O 3.14Å; Y62-V76 HydrophobicContact CD2-CG2 3.96Å; Y62-V76 HydrophobicContact CE2-CG2 3.78Å
63	F	98.7	Very high	96.9	Very high	0 Å²	0	71.5 Å²	71.5	0%	0	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144	160.8	165.9	76.7	-82.4	0	0	0	110.9	R37 L40 L41 F45 R46 E47 L48 T65 I71 I72 A73	R37-F63 HydrophobicContact CB-CE2 4.12Å; R37-F63 HydrophobicContact CB-CZ 4.44Å; R37-F63 HydrophobicContact CG-CE2 3.7Å; R37-F63 HydrophobicContact CG-CZ 3.7Å; L40-F63 HydrophobicContact CB-CD1 4.02Å; L40-F63 HydrophobicContact CB-CE1 4.28Å; L40-F63 HydrophobicContact CB-CG 4.4Å; L40-F63 HydrophobicContact CD1-CB 3.89Å; L40-F63 HydrophobicContact CD1-CD1 4.35Å; L40-F63 HydrophobicContact CD1-CD2 4.24Å; L40-F63 HydrophobicContact CD1-CG 3.9Å; L41-F63 HydrophobicContact CD2-CE1 3.85Å; L41-F63 HydrophobicContact CD2-CZ 4.08Å; L41-F63 HydrophobicContact CG-CE1 4.05Å; L41-F63 HydrophobicContact CG-CZ 4.07Å; F45-F63 HydrophobicContact CB-CD1 3.8Å; F45-F63 HydrophobicContact CB-CE1 4.39Å; R46-F63 PolarHBondContact O-N 2.92Å; E47-F63 CarbonylContact C-O 3.59Å; E47-F63 WeakPolarHBondContact CA-O 3.48Å; E47-F63 HydrophobicContact CB-CD1 4.43Å; E47-F63 HydrophobicContact CB-CE1 3.68Å; E47-F63 HydrophobicContact CB-CE2 4.02Å; E47-F63 HydrophobicContact CB-CZ 3.43Å; E47-F63 VanDerWaalsContact CB-CZ 3.43Å; E47-F63 HydrophobicContact CG-CD2 4.36Å; E47-F63 HydrophobicContact CG-CE1 4.25Å; E47-F63 HydrophobicContact CG-CE2 3.64Å; E47-F63 HydrophobicContact CG-CZ 3.57Å; L48-F63 PolarHBondContact N-O 2.81Å; F63-T65 HydrophobicContact CE2-CG2 4.49Å; F63-I71 HydrophobicContact CD2-CD1 3.88Å; F63-I71 HydrophobicContact CD2-CG1 4.21Å; F63-I71 HydrophobicContact CE2-CD1 4.44Å; F63-I72 CarbonylContact C-O 3.55Å; F63-I72 WeakPolarHBondContact CA-O 3.24Å; F63-I72 VanDerWaalsContact CB-O 3.28Å; F63-I72 WeakPolarHBondContact CB-O 3.37Å; F63-A73 HydrophobicContact CB-CB 3.84Å
64	L	98.4	Very high	97.1	Very high	16 Å²	16	70.5 Å²	70.5	8%	0.084	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	160.1	170.3	69	160.2	0	0	0	109.8	L48 W54 I71 I72 F74	L48-L64 HydrophobicContact CB-CB 4.42Å; W54-L64 HydrophobicContact CH2-CD1 3.64Å; W54-L64 HydrophobicContact CZ2-CD1 3.73Å; L64-I71 WeakPolarHBondContact O-CA 3.3Å; L64-I71 WeakPolarHBondContact O-CG1 3.37Å; L64-I72 HydrophobicContact CD2-CB 3.83Å; L64-I72 HydrophobicContact CD2-CG2 4.2Å; L64-I72 PolarHBondContact N-O 2.81Å; L64-I72 PolarHBondContact O-N 2.83Å; L64-F74 HydrophobicContact CD2-CE1 4.32Å
65	T	98.1	Very high	97.2	Very high	35 Å²	35	68.3 Å²	68.3	22%	0.215	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.3	148.4	172.7	67.1	0	0	0	0	110.2	V33 F63 S70 I71	V33-T65 HydrophobicContact CG1-CG2 3.56Å; F63-T65 HydrophobicContact CE2-CG2 4.49Å; T65-S70 CarbonylContact C-O 3.58Å; T65-S70 VanDerWaalsContact CA-O 3.24Å; T65-S70 WeakPolarHBondContact CA-O 3.5Å; T65-S70 WeakPolarHBondContact CB-O 3.41Å; T65-I71 HydrophobicContact CG2-CB 4.27Å; T65-I71 HydrophobicContact CG2-CD1 4.08Å; T65-I71 HydrophobicContact CG2-CG1 3.99Å
66	R	97.1	Very high	97.4	Very high	154 Å²	154	63.3 Å²	63.3	58%	0.581	35%	0.35	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123	129.4	170.5	-176.1	150	67.5	-171.1	4.1	109.6	E50 S68 S69 S70	E50-R66 VanDerWaalsContact OE1-CD 3.32Å; E50-R66 WeakPolarHBondContact OE1-CD 3.47Å; E50-R66 IonicContact OE1-CZ 3.88Å; E50-R66 IonicContact OE1-NH1 2.96Å; E50-R66 PolarHBondContact OE1-NH1 2.99Å; E50-R66 WeakPolarHBondContact OE2-CD 3.43Å; R66-S68 PolarHBondContact O-N 2.97Å; R66-S69 PolarHBondContact O-N 2.84Å; R66-S70 PolarHBondContact N-O 3.15Å; R66-S70 PolarHBondContact O-N 2.95Å; R66-S70 VanDerWaalsContact O-N 3.14Å
67	N	95.1	Very high	97.4	Very high	127 Å²	127	63 Å²	63	68%	0.679	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.5	22.3	-175.9	-168.8	34.7	0	0	0	113.8	S69	N67-S69 PolarHBondContact ND2-OG 2.97Å; N67-S69 PolarHBondContact O-N 3.22Å; N67-S69 PolarHBondContact O-OG 2.94Å
68	S	94.6	Very high	97.4	Very high	69 Å²	69	61.6 Å²	61.6	48%	0.483	36%	0.357	S	S	.	.	T	Hydrogen-bonded Turn	trans	51.2	13.1	-173.2	-54.5	0	0	0	0	115.9	F30 V33 R66	F30-S68 WeakPolarHBondContact CA-O 3.47Å; F30-S68 WeakPolarHBondContact CD1-O 3.47Å; V33-S68 WeakPolarHBondContact CB-O 3.5Å; R66-S68 PolarHBondContact O-N 2.97Å
69	S	96.6	Very high	97.3	Very high	37 Å²	37	67.8 Å²	67.8	26%	0.259	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	-125.4	-4	-176.1	50.4	0	0	0	0	112.4	R66 N67	R66-S69 PolarHBondContact O-N 2.84Å; N67-S69 PolarHBondContact ND2-OG 2.97Å; N67-S69 PolarHBondContact O-N 3.22Å; N67-S69 PolarHBondContact O-OG 2.94Å
70	S	97.8	Very high	97.2	Very high	71 Å²	71	66.1 Å²	66.1	50%	0.497	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	144.5	167.3	-64.5	0	0	0	0	109.7	T65 R66	T65-S70 CarbonylContact C-O 3.58Å; T65-S70 VanDerWaalsContact CA-O 3.24Å; T65-S70 WeakPolarHBondContact CA-O 3.5Å; T65-S70 WeakPolarHBondContact CB-O 3.41Å; R66-S70 PolarHBondContact N-O 3.15Å; R66-S70 PolarHBondContact O-N 2.95Å; R66-S70 VanDerWaalsContact O-N 3.14Å
71	I	98.5	Very high	96.8	Very high	50 Å²	50	67.1 Å²	67.1	26%	0.256	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.6	137.3	177.1	-169.9	165.5	0	0	0	109.7	V33 C36 R37 L40 F63 L64 T65	V33-I71 HydrophobicContact CG1-CB 4.22Å; V33-I71 HydrophobicContact CG1-CD1 4.5Å; V33-I71 HydrophobicContact CG2-CB 4.23Å; V33-I71 HydrophobicContact CG2-CG2 4.24Å; C36-I71 HydrophobicContact CB-CD1 3.86Å; C36-I71 HydrophobicContact CB-CG2 4.25Å; R37-I71 HydrophobicContact CB-CD1 4.45Å; L40-I71 HydrophobicContact CD1-CD1 3.56Å; L40-I71 HydrophobicContact CD1-CG1 4.32Å; F63-I71 HydrophobicContact CD2-CD1 3.88Å; F63-I71 HydrophobicContact CD2-CG1 4.21Å; F63-I71 HydrophobicContact CE2-CD1 4.44Å; L64-I71 WeakPolarHBondContact O-CA 3.3Å; L64-I71 WeakPolarHBondContact O-CG1 3.37Å; T65-I71 HydrophobicContact CG2-CB 4.27Å; T65-I71 HydrophobicContact CG2-CD1 4.08Å; T65-I71 HydrophobicContact CG2-CG1 3.99Å
72	I	98.4	Very high	96.2	Very high	103 Å²	103	68.1 Å²	68.1	53%	0.528	39%	0.393	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	129.2	171.8	-62.6	172.6	0	0	0	106.6	F63 L64 F74	F63-I72 CarbonylContact C-O 3.55Å; F63-I72 WeakPolarHBondContact CA-O 3.24Å; F63-I72 VanDerWaalsContact CB-O 3.28Å; F63-I72 WeakPolarHBondContact CB-O 3.37Å; L64-I72 HydrophobicContact CD2-CB 3.83Å; L64-I72 HydrophobicContact CD2-CG2 4.2Å; L64-I72 PolarHBondContact N-O 2.81Å; L64-I72 PolarHBondContact O-N 2.83Å; I72-F74 HydrophobicContact CG2-CD1 4.37Å
73	A	98.5	Very high	95.5	Very high	50 Å²	50	72 Å²	72	41%	0.413	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	137.6	175	0	0	0	0	0	109.4	L40 F45 Y62 F63	L40-A73 HydrophobicContact CD1-CB 3.78Å; L40-A73 HydrophobicContact CD2-CB 3.71Å; L40-A73 HydrophobicContact CG-CB 4.42Å; F45-A73 HydrophobicContact CD1-CB 4.43Å; F45-A73 HydrophobicContact CE1-CB 4.19Å; Y62-A73 WeakPolarHBondContact O-CA 3.47Å; F63-A73 HydrophobicContact CB-CB 3.84Å
74	F	98.3	Very high	93.9	Very high	62 Å²	62	79 Å²	79	27%	0.272	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.9	147.3	-179.2	59.7	-84.6	0	0	0	111.3	L48 I56 Y62 L64 I72 V76	L48-F74 HydrophobicContact CD1-CE1 4.37Å; L48-F74 HydrophobicContact CD1-CZ 3.96Å; I56-F74 HydrophobicContact CD1-CE2 4.16Å; I56-F74 HydrophobicContact CD1-CZ 3.95Å; I56-F74 HydrophobicContact CG2-CE2 4.07Å; Y62-F74 HydrophobicContact CD2-CD2 4.18Å; Y62-F74 AromaticContact CD2-CE2 3.53Å; Y62-F74 HydrophobicContact CD2-CE2 3.53Å; Y62-F74 HydrophobicContact CD2-CZ 4.02Å; Y62-F74 HydrophobicContact CG-CE2 4.09Å; Y62-F74 HydrophobicContact CG-CZ 4.13Å; Y62-F74 PolarHBondContact N-O 3.14Å; Y62-F74 PolarHBondContact O-N 3.2Å; Y62-F74 VanDerWaalsContact O-O 3.14Å; L64-F74 HydrophobicContact CD2-CE1 4.32Å; I72-F74 HydrophobicContact CG2-CD1 4.37Å; F74-V76 HydrophobicContact CD2-CG2 4.05Å; F74-V76 HydrophobicContact CE2-CG2 4.11Å
75	A	98.1	Very high	91.9	Very high	69 Å²	69	85.1 Å²	85.1	57%	0.57	54%	0.538	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.8	124.7	173.9	0	0	0	0	0	108	K61 G77	K61-A75 HydrophobicContact CD-CB 4.4Å; K61-A75 HydrophobicContact CG-CB 3.77Å; A75-G77 PolarHBondContact O-N 3.12Å
76	V	97.1	Very high	91.6	Very high	14 Å²	14	87.6 Å²	87.6	9%	0.085	55%	0.554	C	S	.	*			trans	-84.9	116.1	-177.6	-169.1	0	0	0	0	108.3	I56 E59 N60 Y62 F74 Y80	I56-V76 HydrophobicContact CG2-CG2 3.55Å; E59-V76 WeakPolarHBondContact CA-O 3.46Å; E59-V76 PolarHBondContact N-O 2.68Å; N60-V76 PolarHBondContact O-N 2.74Å; Y62-V76 HydrophobicContact CD2-CG2 3.96Å; Y62-V76 HydrophobicContact CE2-CG2 3.78Å; F74-V76 HydrophobicContact CD2-CG2 4.05Å; F74-V76 HydrophobicContact CE2-CG2 4.11Å; V76-Y80 HydrophobicContact CG1-CD1 3.59Å; V76-Y80 HydrophobicContact CG1-CE1 4.47Å; V76-Y80 HydrophobicContact CG1-CG 3.84Å
77	G	96.3	Very high	91.3	Very high	46 Å²	46	84.1 Å²	84.1	47%	0.474	55%	0.553	S	S	.	*			trans	-59.3	143.5	177	0	0	0	0	0	111.2	A75 Q79 Y80	A75-G77 PolarHBondContact O-N 3.12Å; G77-Q79 PolarHBondContact O-N 3.08Å; G77-Q79 VanDerWaalsContact O-N 3.08Å; G77-Y80 WeakPolarHBondContact O-CB 3.32Å; G77-Y80 PolarHBondContact O-N 2.99Å
78	G	95.8	Very high	91.1	Very high	31 Å²	31	81.7 Å²	81.7	32%	0.32	55%	0.546	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.6	-18.5	-175.7	0	0	0	0	0	115	E59	E59-G78 VanDerWaalsContact CG-CA 3.47Å
79	Q	94.3	Very high	90.9	Very high	177 Å²	177	82.5 Å²	82.5	83%	0.827	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	-105.4	12.1	176.9	-57.9	-60.2	-72.7	0	0	112.6	G77 V81	G77-Q79 PolarHBondContact O-N 3.08Å; G77-Q79 VanDerWaalsContact O-N 3.08Å; Q79-V81 PolarHBondContact O-N 2.96Å
80	Y	93.7	Very high	90.6	Very high	125 Å²	125	85.3 Å²	85.3	49%	0.49	57%	0.567	S	S	.	*			trans	-65	130.4	175.5	172.3	-103	0	0	0	110.3	V76 G77 P82	V76-Y80 HydrophobicContact CG1-CD1 3.59Å; V76-Y80 HydrophobicContact CG1-CE1 4.47Å; V76-Y80 HydrophobicContact CG1-CG 3.84Å; G77-Y80 WeakPolarHBondContact O-CB 3.32Å; G77-Y80 PolarHBondContact O-N 2.99Å; Y80-P82 HydrophobicContact CE1-CG 4.32Å
81	V	89.7	Confident	90.1	Very high	90 Å²	90	86.3 Å²	86.3	55%	0.545	57%	0.572	S	S	.	*			trans	-130.4	133.8	172.1	-178.2	0	0	0	0	107.6	Q79 G83 N84	Q79-V81 PolarHBondContact O-N 2.96Å; V81-G83 PolarHBondContact O-N 3.37Å; V81-N84 PolarHBondContact O-N 3.15Å
82	P	87.5	Confident	89.5	Confident	103 Å²	103	88.9 Å²	88.9	67%	0.669	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54	137.2	175.4	-26.2	34.8	0	0	0	112.2	Y80	Y80-P82 HydrophobicContact CE1-CG 4.32Å
83	G	82.4	Confident	88.8	Confident	83 Å²	83	87.8 Å²	87.8	86%	0.856	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	87.8	0.3	176.7	0	0	0	0	0	116.3	V81 G85	V81-G83 PolarHBondContact O-N 3.37Å; G83-G85 VanDerWaalsContact C-N 3.34Å
84	N	66.4	Low	88	Confident	146 Å²	146	90.9 Å²	90.9	78%	0.781	62%	0.615	S	S	*	*			trans	-97.6	36.4	175.3	-163.3	36.2	0	0	0	113	V81	V81-N84 PolarHBondContact O-N 3.15Å
85	G	56.3	Low	87	Confident	145 Å²	145	93.5 Å²	93.5	100%	1.495	65%	0.647	S	S	*	*			trans	-116.3	0	-177.6	0	0	0	0	0	112.5	G83	G83-G85 VanDerWaalsContact C-N 3.34Å

Retrieved 85 of 85 residues in 60.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).