A0A087WNX5_MOUSE Loading...

Small integral membrane protein 10 like 1

AlphaFold DB , UniProt , Accession A0A087WNX5, Species MOUSE (Mus musculus, Mouse), Gene Smim10l1, Length 49 aa.

						>A0A087WNX5_MOUSE|A0A087WNX5|Smim10l1
CKGLSRTLLAFFELAWQLRMNFPYFYIAGSVILNIRLQEIHLTSGGTRN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	C	54.6	Low	78.6	Confident	174 Å²	174	121.8 Å²	121.8	100%	1.176	66%	0.663	S	S	*	*				0	11	0	-52.5	0	0	0	0	116.1
2	K	60	Low	79.5	Confident	192 Å²	192	122.8 Å²	122.8	84%	0.835	66%	0.656	S	S	*	*			trans	-101.3	-14	-179.9	-80.9	176.3	158.8	80.3	0	115.4	S5	K2-S5 PolarHBondContact O-OG 2.99Å
3	G	65.9	Low	80.3	Confident	47 Å²	47	121.1 Å²	121.1	49%	0.485	64%	0.642	S	S	.	*	H	α-helix	trans	-84.1	-34.5	-178.9	0	0	0	0	0	114.2	S5 R6 T7	G3-S5 PolarHBondContact O-N 3.35Å; G3-R6 WeakPolarHBondContact O-CB 3.21Å; G3-R6 PolarHBondContact O-N 3.24Å; G3-R6 VanDerWaalsContact O-N 3.11Å; G3-T7 PolarHBondContact O-N 3.27Å; G3-T7 VanDerWaalsContact O-N 3.1Å; G3-T7 PolarHBondContact O-OG1 2.83Å
4	L	71	Confident	81.1	Confident	144 Å²	144	120.5 Å²	120.5	75%	0.754	64%	0.638	S	S	*	*	H	α-helix	trans	-62.3	-42.5	-175.4	-158.3	100.3	0	0	0	112.1	R6 T7 L8	L4-R6 VanDerWaalsContact C-N 3.31Å; L4-R6 PolarHBondContact O-N 3.43Å; L4-T7 PolarHBondContact O-N 3.36Å; L4-L8 WeakPolarHBondContact O-CB 3.28Å; L4-L8 PolarHBondContact O-N 3.37Å
5	S	79.7	Confident	81.7	Confident	70 Å²	70	115.5 Å²	115.5	49%	0.49	62%	0.621	S	S	.	*	H	α-helix	trans	-64.4	-34.1	176.3	45.1	0	0	0	0	112.3	K2 G3 L9	K2-S5 PolarHBondContact O-OG 2.99Å; G3-S5 PolarHBondContact O-N 3.35Å; S5-L9 WeakPolarHBondContact O-CB 3.43Å; S5-L9 PolarHBondContact O-N 3.4Å
6	R	84.3	Confident	82.1	Confident	205 Å²	205	117.6 Å²	117.6	77%	0.774	62%	0.617	S	S	*	*	H	α-helix	trans	-69	-42.2	176.7	-164	175.1	-145.8	-114.9	1	112	G3 L4 A10	G3-R6 WeakPolarHBondContact O-CB 3.21Å; G3-R6 PolarHBondContact O-N 3.24Å; G3-R6 VanDerWaalsContact O-N 3.11Å; L4-R6 VanDerWaalsContact C-N 3.31Å; L4-R6 PolarHBondContact O-N 3.43Å; R6-A10 WeakPolarHBondContact O-CB 3.14Å; R6-A10 PolarHBondContact O-N 2.86Å
7	T	88.2	Confident	82.5	Confident	100 Å²	100	117.1 Å²	117.1	61%	0.613	61%	0.611	S	S	*	*	H	α-helix	trans	-68	-40.5	175.9	-49.6	0	0	0	0	111.5	G3 L4 A10 F11	G3-T7 PolarHBondContact O-N 3.27Å; G3-T7 VanDerWaalsContact O-N 3.1Å; G3-T7 PolarHBondContact O-OG1 2.83Å; L4-T7 PolarHBondContact O-N 3.36Å; T7-A10 PolarHBondContact O-N 3.49Å; T7-F11 PolarHBondContact O-N 3.45Å
8	L	89.3	Confident	82.8	Confident	98 Å²	98	116.8 Å²	116.8	51%	0.513	61%	0.61	S	S	.	*	H	α-helix	trans	-63.2	-44.1	177.8	-162.8	82.1	0	0	0	111.3	L4 F11 F12	L4-L8 WeakPolarHBondContact O-CB 3.28Å; L4-L8 PolarHBondContact O-N 3.37Å; L8-F11 WeakPolarHBondContact O-CB 3.39Å; L8-F11 PolarHBondContact O-N 3.01Å; L8-F12 HydrophobicContact CD1-CE2 4.43Å; L8-F12 HydrophobicContact CD2-CD2 4.48Å; L8-F12 HydrophobicContact CD2-CE2 4.09Å; L8-F12 HydrophobicContact CG-CD2 4.03Å; L8-F12 HydrophobicContact CG-CE2 3.91Å; L8-F12 VanDerWaalsContact O-CD2 3.28Å; L8-F12 WeakPolarHBondContact O-CD2 3.18Å; L8-F12 PolarHBondContact O-N 3.24Å
9	L	90.2	Very high	83	Confident	115 Å²	115	120.5 Å²	120.5	60%	0.602	62%	0.615	S	S	*	*	H	α-helix	trans	-65.9	-40.2	178.5	-143.7	129.9	0	0	0	111.3	S5 F11 F12 E13	S5-L9 WeakPolarHBondContact O-CB 3.43Å; S5-L9 PolarHBondContact O-N 3.4Å; L9-F11 VanDerWaalsContact C-N 3.33Å; L9-F11 PolarHBondContact O-N 3.13Å; L9-F12 PolarHBondContact O-N 2.95Å; L9-E13 HydrophobicContact CD2-CG 4.44Å; L9-E13 WeakPolarHBondContact O-CB 3.45Å; L9-E13 WeakPolarHBondContact O-CG 3.47Å; L9-E13 PolarHBondContact O-N 3Å
10	A	90.7	Very high	83.3	Confident	50 Å²	50	120.1 Å²	120.1	41%	0.413	61%	0.611	S	S	.	*	H	α-helix	trans	-61.9	-39.5	172.5	0	0	0	0	0	112.4	R6 T7 E13 L14	R6-A10 WeakPolarHBondContact O-CB 3.14Å; R6-A10 PolarHBondContact O-N 2.86Å; T7-A10 PolarHBondContact O-N 3.49Å; A10-E13 PolarHBondContact O-N 2.89Å; A10-L14 WeakPolarHBondContact O-CB 2.87Å; A10-L14 VanDerWaalsContact O-CG 3.24Å; A10-L14 WeakPolarHBondContact O-CG 3.17Å; A10-L14 PolarHBondContact O-N 2.92Å
11	F	90.9	Very high	83.4	Confident	145 Å²	145	118.7 Å²	118.7	64%	0.636	61%	0.606	S	S	*	*	H	α-helix	trans	-65.1	-41.9	175.6	-170.8	-95	0	0	0	112	T7 L8 L9 L14 A15	T7-F11 PolarHBondContact O-N 3.45Å; L8-F11 WeakPolarHBondContact O-CB 3.39Å; L8-F11 PolarHBondContact O-N 3.01Å; L9-F11 VanDerWaalsContact C-N 3.33Å; L9-F11 PolarHBondContact O-N 3.13Å; F11-L14 PolarHBondContact O-N 3.47Å; F11-A15 WeakPolarHBondContact O-CB 3.17Å; F11-A15 PolarHBondContact O-N 3.42Å
12	F	89.2	Confident	85	Confident	134 Å²	134	116.3 Å²	116.3	59%	0.588	58%	0.575	S	S	*	*	H	α-helix	trans	-65.3	-42.7	175.2	-88.1	-69.9	0	0	0	112.7	L8 L9 A15 W16	L8-F12 HydrophobicContact CD1-CE2 4.43Å; L8-F12 HydrophobicContact CD2-CD2 4.48Å; L8-F12 HydrophobicContact CD2-CE2 4.09Å; L8-F12 HydrophobicContact CG-CD2 4.03Å; L8-F12 HydrophobicContact CG-CE2 3.91Å; L8-F12 VanDerWaalsContact O-CD2 3.28Å; L8-F12 WeakPolarHBondContact O-CD2 3.18Å; L8-F12 PolarHBondContact O-N 3.24Å; L9-F12 PolarHBondContact O-N 2.95Å; F12-A15 PolarHBondContact O-N 3.47Å; F12-W16 VanDerWaalsContact O-CB 3.26Å; F12-W16 WeakPolarHBondContact O-CB 3.26Å; F12-W16 PolarHBondContact O-N 2.88Å
13	E	90.6	Very high	86.3	Confident	100 Å²	100	110.6 Å²	110.6	47%	0.467	56%	0.558	S	S	.	*	H	α-helix	trans	-60.5	-43.8	174.3	-78.3	-66.1	152.2	0	0	111.7	L9 A10 W16 Q17	L9-E13 HydrophobicContact CD2-CG 4.44Å; L9-E13 WeakPolarHBondContact O-CB 3.45Å; L9-E13 WeakPolarHBondContact O-CG 3.47Å; L9-E13 PolarHBondContact O-N 3Å; A10-E13 PolarHBondContact O-N 2.89Å; E13-W16 WeakPolarHBondContact O-CB 3.24Å; E13-W16 PolarHBondContact O-N 3.29Å; E13-Q17 WeakPolarHBondContact O-CG 3.28Å; E13-Q17 PolarHBondContact O-N 2.81Å
14	L	91.1	Very high	87.3	Confident	113 Å²	113	117 Å²	117	59%	0.592	57%	0.569	S	S	*	*	H	α-helix	trans	-64.2	-43.8	175	-73.5	168.2	0	0	0	112	A10 F11 W16 Q17 L18	A10-L14 WeakPolarHBondContact O-CB 2.87Å; A10-L14 VanDerWaalsContact O-CG 3.24Å; A10-L14 WeakPolarHBondContact O-CG 3.17Å; A10-L14 PolarHBondContact O-N 2.92Å; F11-L14 PolarHBondContact O-N 3.47Å; L14-W16 VanDerWaalsContact C-N 3.28Å; L14-W16 PolarHBondContact O-N 3.41Å; L14-Q17 PolarHBondContact O-N 3.42Å; L14-L18 WeakPolarHBondContact O-CB 3.47Å; L14-L18 PolarHBondContact O-N 3.46Å
15	A	90.4	Very high	88	Confident	45 Å²	45	118 Å²	118	37%	0.372	57%	0.567	S	S	.	*	H	α-helix	trans	-64.5	-35.1	176.3	0	0	0	0	0	111.9	F11 F12 L18 R19	F11-A15 WeakPolarHBondContact O-CB 3.17Å; F11-A15 PolarHBondContact O-N 3.42Å; F12-A15 PolarHBondContact O-N 3.47Å; A15-L18 PolarHBondContact O-N 2.9Å; A15-R19 WeakPolarHBondContact O-CB 3.33Å; A15-R19 PolarHBondContact O-N 3.23Å
16	W	87.6	Confident	88.4	Confident	150 Å²	150	121.4 Å²	121.4	57%	0.568	57%	0.57	S	S	*	*	H	α-helix	trans	-68.1	-46.6	175.5	-178.2	-104.2	0	0	0	111.9	F12 E13 L14 L18 R19 M20	F12-W16 VanDerWaalsContact O-CB 3.26Å; F12-W16 WeakPolarHBondContact O-CB 3.26Å; F12-W16 PolarHBondContact O-N 2.88Å; E13-W16 WeakPolarHBondContact O-CB 3.24Å; E13-W16 PolarHBondContact O-N 3.29Å; L14-W16 VanDerWaalsContact C-N 3.28Å; L14-W16 PolarHBondContact O-N 3.41Å; W16-L18 VanDerWaalsContact C-N 3.32Å; W16-L18 PolarHBondContact O-N 3.46Å; W16-R19 WeakPolarHBondContact O-CB 3.44Å; W16-R19 PolarHBondContact O-N 3.43Å; W16-R19 VanDerWaalsContact O-N 3.15Å; W16-M20 HydrophobicContact CH2-CE 4.01Å; W16-M20 HydrophobicContact CZ2-CE 3.34Å; W16-M20 PolarHBondContact O-N 2.88Å
17	Q	89.7	Confident	88.8	Confident	109 Å²	109	116.5 Å²	116.5	51%	0.509	56%	0.558	S	S	.	*	H	α-helix	trans	-59.9	-44.3	172.2	-74.1	-176.9	4.5	0	0	111	E13 L14 R19 M20 N21	E13-Q17 WeakPolarHBondContact O-CG 3.28Å; E13-Q17 PolarHBondContact O-N 2.81Å; L14-Q17 PolarHBondContact O-N 3.42Å; Q17-R19 VanDerWaalsContact C-N 3.28Å; Q17-R19 PolarHBondContact O-N 3.02Å; Q17-M20 PolarHBondContact O-N 3.31Å; Q17-N21 WeakPolarHBondContact O-CB 3.28Å; Q17-N21 PolarHBondContact O-N 3.48Å; Q17-N21 PolarHBondContact O-ND2 2.8Å
18	L	87.8	Confident	89	Confident	112 Å²	112	114.1 Å²	114.1	59%	0.586	55%	0.549	S	S	*	.	H	α-helix	trans	-60.4	-41	175.7	-174.8	65.4	0	0	0	110.8	L14 A15 W16 N21 F22	L14-L18 WeakPolarHBondContact O-CB 3.47Å; L14-L18 PolarHBondContact O-N 3.46Å; A15-L18 PolarHBondContact O-N 2.9Å; W16-L18 VanDerWaalsContact C-N 3.32Å; W16-L18 PolarHBondContact O-N 3.46Å; L18-N21 CarbonylContact O-C 3.46Å; L18-N21 PolarHBondContact O-N 3.44Å; L18-F22 WeakPolarHBondContact O-CA 3.3Å; L18-F22 VanDerWaalsContact O-CB 3.25Å; L18-F22 WeakPolarHBondContact O-CB 3.31Å; L18-F22 PolarHBondContact O-N 2.88Å
19	R	85.8	Confident	89.1	Confident	187 Å²	187	111.2 Å²	111.2	71%	0.706	54%	0.542	S	S	*	.	H	α-helix	trans	-64.3	-39	176.8	-174.8	170.7	-179.9	106.6	-0.7	112.8	A15 W16 Q17 F22 P23	A15-R19 WeakPolarHBondContact O-CB 3.33Å; A15-R19 PolarHBondContact O-N 3.23Å; W16-R19 WeakPolarHBondContact O-CB 3.44Å; W16-R19 PolarHBondContact O-N 3.43Å; W16-R19 VanDerWaalsContact O-N 3.15Å; Q17-R19 VanDerWaalsContact C-N 3.28Å; Q17-R19 PolarHBondContact O-N 3.02Å; R19-F22 WeakPolarHBondContact O-CB 3.47Å; R19-F22 PolarHBondContact O-N 3.01Å; R19-P23 WeakPolarHBondContact O-CD 3.35Å
20	M	88.4	Confident	89.1	Confident	112 Å²	112	108.3 Å²	108.3	55%	0.552	53%	0.532	S	S	*	.	H	α-helix	trans	-70.8	-33.2	175.3	-72.6	-65.4	-177.9	0	0	112.5	W16 Q17 P23	W16-M20 HydrophobicContact CH2-CE 4.01Å; W16-M20 HydrophobicContact CZ2-CE 3.34Å; W16-M20 PolarHBondContact O-N 2.88Å; Q17-M20 PolarHBondContact O-N 3.31Å; M20-P23 VanDerWaalsContact O-CD 3.31Å; M20-P23 WeakPolarHBondContact O-CD 3.25Å
21	N	86.6	Confident	89.3	Confident	91 Å²	91	109.5 Å²	109.5	49%	0.487	53%	0.534	S	S	.	.	H	α-helix	trans	-85.6	-12.2	175.5	-69.4	-71	0	0	0	113.1	Q17 L18 P23 Y24 F25	Q17-N21 WeakPolarHBondContact O-CB 3.28Å; Q17-N21 PolarHBondContact O-N 3.48Å; Q17-N21 PolarHBondContact O-ND2 2.8Å; L18-N21 CarbonylContact O-C 3.46Å; L18-N21 PolarHBondContact O-N 3.44Å; N21-P23 VanDerWaalsContact C-CD 3.43Å; N21-Y24 WeakPolarHBondContact O-CB 3.34Å; N21-Y24 PolarHBondContact O-N 2.84Å; N21-Y24 VanDerWaalsContact O-N 3.11Å; N21-F25 PolarHBondContact O-N 3.31Å
22	F	87.1	Confident	89.4	Confident	123 Å²	123	107.6 Å²	107.6	54%	0.539	53%	0.529	S	S	.	.	H	α-helix	trans	-57.4	-41.6	-177.7	-171.3	-95.4	0	0	0	113	L18 R19 Y24 F25 Y26	L18-F22 WeakPolarHBondContact O-CA 3.3Å; L18-F22 VanDerWaalsContact O-CB 3.25Å; L18-F22 WeakPolarHBondContact O-CB 3.31Å; L18-F22 PolarHBondContact O-N 2.88Å; R19-F22 WeakPolarHBondContact O-CB 3.47Å; R19-F22 PolarHBondContact O-N 3.01Å; F22-Y24 VanDerWaalsContact C-N 3.31Å; F22-Y24 PolarHBondContact O-N 3.24Å; F22-F25 PolarHBondContact O-N 2.93Å; F22-Y26 HydrophobicContact CE1-CD2 4.41Å; F22-Y26 WeakPolarHBondContact O-CB 3.13Å; F22-Y26 PolarHBondContact O-N 3.44Å
23	P	87.3	Confident	89.4	Confident	72 Å²	72	106.5 Å²	106.5	47%	0.468	53%	0.529	S	S	.	.	H	α-helix	trans	-56.7	-45.7	175.2	-23.3	34.2	0	0	0	111.6	R19 M20 N21 Y26 I27	R19-P23 WeakPolarHBondContact O-CD 3.35Å; M20-P23 VanDerWaalsContact O-CD 3.31Å; M20-P23 WeakPolarHBondContact O-CD 3.25Å; N21-P23 VanDerWaalsContact C-CD 3.43Å; P23-Y26 PolarHBondContact O-N 3.39Å; P23-I27 WeakPolarHBondContact O-CB 3.49Å; P23-I27 WeakPolarHBondContact O-CG1 3.27Å; P23-I27 PolarHBondContact O-N 2.8Å
24	Y	86.9	Confident	89.4	Confident	183 Å²	183	106.5 Å²	106.5	72%	0.718	53%	0.532	S	S	*	.	H	α-helix	trans	-64.4	-44.6	179.3	-70.3	-80.3	0	0	0	112.2	N21 F22 I27 A28	N21-Y24 WeakPolarHBondContact O-CB 3.34Å; N21-Y24 PolarHBondContact O-N 2.84Å; N21-Y24 VanDerWaalsContact O-N 3.11Å; F22-Y24 VanDerWaalsContact C-N 3.31Å; F22-Y24 PolarHBondContact O-N 3.24Å; Y24-I27 PolarHBondContact O-N 3.3Å; Y24-A28 WeakPolarHBondContact O-CB 3.5Å; Y24-A28 PolarHBondContact O-N 3.15Å
25	F	86.4	Confident	89.3	Confident	164 Å²	164	105.4 Å²	105.4	72%	0.719	53%	0.526	S	S	*	.	H	α-helix	trans	-66.9	-38.9	179.4	-144.3	-87.8	0	0	0	112.2	N21 F22 G29	N21-F25 PolarHBondContact O-N 3.31Å; F22-F25 PolarHBondContact O-N 2.93Å; F25-G29 PolarHBondContact O-N 2.85Å
26	Y	88.8	Confident	89.2	Confident	142 Å²	142	110.6 Å²	110.6	56%	0.557	54%	0.536	S	S	*	.	H	α-helix	trans	-64.4	-47.9	176.2	176.3	-96.4	0	0	0	111.4	F22 P23 G29 S30	F22-Y26 HydrophobicContact CE1-CD2 4.41Å; F22-Y26 WeakPolarHBondContact O-CB 3.13Å; F22-Y26 PolarHBondContact O-N 3.44Å; P23-Y26 PolarHBondContact O-N 3.39Å; Y26-G29 PolarHBondContact O-N 2.7Å; Y26-S30 WeakPolarHBondContact O-CB 3.34Å; Y26-S30 PolarHBondContact O-N 3.29Å
27	I	91.8	Very high	89.1	Confident	101 Å²	101	107.5 Å²	107.5	52%	0.518	53%	0.53	S	S	.	.	H	α-helix	trans	-63.3	-45	177.3	-64.4	-63.2	0	0	0	110.6	P23 Y24 G29 S30 V31	P23-I27 WeakPolarHBondContact O-CB 3.49Å; P23-I27 WeakPolarHBondContact O-CG1 3.27Å; P23-I27 PolarHBondContact O-N 2.8Å; Y24-I27 PolarHBondContact O-N 3.3Å; I27-G29 PolarHBondContact O-N 3.38Å; I27-S30 PolarHBondContact O-N 3.07Å; I27-V31 HydrophobicContact CG2-CG2 4.33Å; I27-V31 WeakPolarHBondContact O-CB 3.28Å; I27-V31 VanDerWaalsContact O-CG2 3.28Å; I27-V31 WeakPolarHBondContact O-CG2 3.33Å; I27-V31 PolarHBondContact O-N 3.11Å
28	A	92.7	Very high	88.7	Confident	50 Å²	50	107.7 Å²	107.7	41%	0.413	53%	0.531	S	S	.	.	H	α-helix	trans	-59.1	-47.9	176.8	0	0	0	0	0	112.2	Y24 V31 I32	Y24-A28 WeakPolarHBondContact O-CB 3.5Å; Y24-A28 PolarHBondContact O-N 3.15Å; A28-V31 PolarHBondContact O-N 2.8Å; A28-I32 WeakPolarHBondContact O-CD1 3.26Å; A28-I32 VanDerWaalsContact O-CG1 3.27Å; A28-I32 WeakPolarHBondContact O-CG1 3.49Å; A28-I32 PolarHBondContact O-N 3.44Å
29	G	91.8	Very high	88.2	Confident	37 Å²	37	107.4 Å²	107.4	38%	0.381	53%	0.527	S	S	.	.	H	α-helix	trans	-64.3	-40.3	176.9	0	0	0	0	0	112.9	F25 Y26 I27 I32 L33	F25-G29 PolarHBondContact O-N 2.85Å; Y26-G29 PolarHBondContact O-N 2.7Å; I27-G29 PolarHBondContact O-N 3.38Å; G29-I32 PolarHBondContact O-N 2.91Å; G29-L33 VanDerWaalsContact O-CB 3.26Å; G29-L33 WeakPolarHBondContact O-CB 3.41Å; G29-L33 PolarHBondContact O-N 2.94Å
30	S	90.4	Very high	87.7	Confident	55 Å²	55	103.4 Å²	103.4	39%	0.385	52%	0.518	S	S	.	.	H	α-helix	trans	-62.8	-44.2	176.7	-178.4	0	0	0	0	111.6	Y26 I27 L33 N34	Y26-S30 WeakPolarHBondContact O-CB 3.34Å; Y26-S30 PolarHBondContact O-N 3.29Å; I27-S30 PolarHBondContact O-N 3.07Å; S30-L33 PolarHBondContact O-N 2.92Å; S30-N34 WeakPolarHBondContact O-CB 3.37Å; S30-N34 PolarHBondContact O-N 3.3Å
31	V	93.6	Very high	86.9	Confident	75 Å²	75	104.3 Å²	104.3	46%	0.455	52%	0.521	S	S	.	.	H	α-helix	trans	-64.5	-47.5	176.8	170.1	0	0	0	0	111	I27 A28 L33 N34 I35	I27-V31 HydrophobicContact CG2-CG2 4.33Å; I27-V31 WeakPolarHBondContact O-CB 3.28Å; I27-V31 VanDerWaalsContact O-CG2 3.28Å; I27-V31 WeakPolarHBondContact O-CG2 3.33Å; I27-V31 PolarHBondContact O-N 3.11Å; A28-V31 PolarHBondContact O-N 2.8Å; V31-L33 VanDerWaalsContact C-N 3.33Å; V31-L33 PolarHBondContact O-N 3.47Å; V31-N34 PolarHBondContact O-N 2.76Å; V31-I35 HydrophobicContact CG1-CD1 3.75Å; V31-I35 HydrophobicContact CG1-CG1 4.37Å; V31-I35 VanDerWaalsContact O-CG1 3.24Å; V31-I35 WeakPolarHBondContact O-CG1 3.32Å; V31-I35 PolarHBondContact O-N 3.31Å
32	I	93	Very high	85.9	Confident	105 Å²	105	106 Å²	106	54%	0.538	53%	0.529	S	S	.	.	H	α-helix	trans	-59.5	-46.5	177.7	-67.4	164.5	0	0	0	110.5	A28 G29 I35 R36	A28-I32 WeakPolarHBondContact O-CD1 3.26Å; A28-I32 VanDerWaalsContact O-CG1 3.27Å; A28-I32 WeakPolarHBondContact O-CG1 3.49Å; A28-I32 PolarHBondContact O-N 3.44Å; G29-I32 PolarHBondContact O-N 2.91Å; I32-I35 PolarHBondContact O-N 2.88Å; I32-R36 VanDerWaalsContact O-CG 3.28Å; I32-R36 WeakPolarHBondContact O-CG 3.32Å; I32-R36 PolarHBondContact O-N 3.46Å
33	L	89.7	Confident	84.8	Confident	110 Å²	110	104.7 Å²	104.7	58%	0.576	53%	0.532	S	S	*	.	H	α-helix	trans	-63.3	-43	177.7	-178.1	65.1	0	0	0	111.2	G29 S30 V31 R36 L37	G29-L33 VanDerWaalsContact O-CB 3.26Å; G29-L33 WeakPolarHBondContact O-CB 3.41Å; G29-L33 PolarHBondContact O-N 2.94Å; S30-L33 PolarHBondContact O-N 2.92Å; V31-L33 VanDerWaalsContact C-N 3.33Å; V31-L33 PolarHBondContact O-N 3.47Å; L33-R36 PolarHBondContact O-N 2.82Å; L33-L37 HydrophobicContact CD1-CD1 4.42Å; L33-L37 WeakPolarHBondContact O-CB 3.24Å; L33-L37 PolarHBondContact O-N 2.88Å
34	N	89.6	Confident	83.6	Confident	100 Å²	100	105.8 Å²	105.8	54%	0.535	54%	0.541	S	S	.	.	H	α-helix	trans	-63.1	-42.5	179.1	-169.4	-95.1	0	0	0	111.7	S30 V31 L37 Q38	S30-N34 WeakPolarHBondContact O-CB 3.37Å; S30-N34 PolarHBondContact O-N 3.3Å; V31-N34 PolarHBondContact O-N 2.76Å; N34-L37 PolarHBondContact O-N 3.41Å; N34-Q38 WeakPolarHBondContact O-CB 3.4Å; N34-Q38 PolarHBondContact O-N 2.87Å
35	I	89.1	Confident	82.3	Confident	91 Å²	91	99.5 Å²	99.5	47%	0.467	53%	0.532	S	S	.	.	H	α-helix	trans	-62.2	-46.1	174.7	-67.2	168.5	0	0	0	110.7	V31 I32 L37 Q38 E39	V31-I35 HydrophobicContact CG1-CD1 3.75Å; V31-I35 HydrophobicContact CG1-CG1 4.37Å; V31-I35 VanDerWaalsContact O-CG1 3.24Å; V31-I35 WeakPolarHBondContact O-CG1 3.32Å; V31-I35 PolarHBondContact O-N 3.31Å; I32-I35 PolarHBondContact O-N 2.88Å; I35-L37 PolarHBondContact O-N 3.43Å; I35-Q38 PolarHBondContact O-N 2.96Å; I35-E39 WeakPolarHBondContact O-CB 3.44Å; I35-E39 PolarHBondContact O-N 3.47Å
36	R	88.6	Confident	81.1	Confident	153 Å²	153	94.6 Å²	94.6	58%	0.577	53%	0.528	S	S	*	.	H	α-helix	trans	-63.9	-39.4	177.5	-70.9	-64.7	-153.6	-112.8	-0.7	112.5	I32 L33 I40	I32-R36 VanDerWaalsContact O-CG 3.28Å; I32-R36 WeakPolarHBondContact O-CG 3.32Å; I32-R36 PolarHBondContact O-N 3.46Å; L33-R36 PolarHBondContact O-N 2.82Å; R36-I40 VanDerWaalsContact O-CG1 3.3Å; R36-I40 WeakPolarHBondContact O-CG1 3.48Å; R36-I40 PolarHBondContact O-N 3.46Å; R36-I40 VanDerWaalsContact O-N 3.13Å
37	L	85.3	Confident	79.6	Confident	86 Å²	86	94 Å²	94	45%	0.45	54%	0.539	S	S	.	.	H	α-helix	trans	-70	-37.3	176.6	-132.5	89.6	0	0	0	111.7	L33 N34 I35 I40 H41	L33-L37 HydrophobicContact CD1-CD1 4.42Å; L33-L37 WeakPolarHBondContact O-CB 3.24Å; L33-L37 PolarHBondContact O-N 2.88Å; N34-L37 PolarHBondContact O-N 3.41Å; I35-L37 PolarHBondContact O-N 3.43Å; L37-I40 PolarHBondContact O-N 2.99Å; L37-H41 PolarHBondContact O-N 2.94Å; L37-H41 PolarHBondContact O-ND1 3.11Å
38	Q	81.2	Confident	78	Confident	112 Å²	112	100.5 Å²	100.5	52%	0.523	56%	0.557	S	S	.	*	H	α-helix	trans	-67.2	-40.4	176.8	-176.5	173.9	75.3	0	0	111.2	N34 I35 H41 L42	N34-Q38 WeakPolarHBondContact O-CB 3.4Å; N34-Q38 PolarHBondContact O-N 2.87Å; I35-Q38 PolarHBondContact O-N 2.96Å; Q38-H41 PolarHBondContact O-N 3.22Å; Q38-L42 HydrophobicContact CG-CD1 3.9Å; Q38-L42 WeakPolarHBondContact O-CB 3.42Å; Q38-L42 VanDerWaalsContact O-CG 3.28Å; Q38-L42 WeakPolarHBondContact O-CG 3.45Å; Q38-L42 PolarHBondContact O-N 3.3Å
39	E	77.4	Confident	76	Confident	106 Å²	106	109.7 Å²	109.7	50%	0.495	60%	0.599	S	S	.	*	H	α-helix	trans	-54.6	-56.1	169.7	-174.6	-172	167.7	0	0	109.9	I35 H41 L42 T43	I35-E39 WeakPolarHBondContact O-CB 3.44Å; I35-E39 PolarHBondContact O-N 3.47Å; E39-H41 VanDerWaalsContact C-N 3.3Å; E39-H41 PolarHBondContact O-N 2.93Å; E39-L42 PolarHBondContact O-N 3.35Å; E39-T43 HydrophobicContact CG-CG2 4.13Å; E39-T43 WeakPolarHBondContact O-CG2 3.32Å; E39-T43 PolarHBondContact O-N 2.91Å
40	I	75.9	Confident	75.2	Confident	103 Å²	103	113.3 Å²	113.3	53%	0.528	61%	0.61	S	S	.	*	H	α-helix	trans	-53.5	-44	179.4	-67.5	164.4	0	0	0	112.2	R36 L37 S44	R36-I40 VanDerWaalsContact O-CG1 3.3Å; R36-I40 WeakPolarHBondContact O-CG1 3.48Å; R36-I40 PolarHBondContact O-N 3.46Å; R36-I40 VanDerWaalsContact O-N 3.13Å; L37-I40 PolarHBondContact O-N 2.99Å; I40-S44 WeakPolarHBondContact O-CB 3.46Å; I40-S44 PolarHBondContact O-N 3.1Å
41	H	71.9	Confident	74.4	Confident	131 Å²	131	116.4 Å²	116.4	61%	0.606	62%	0.622	S	S	*	*	H	α-helix	trans	-67.8	-36.2	177.6	-77.9	135.7	0	0	0	113.2	L37 Q38 E39 G45	L37-H41 PolarHBondContact O-N 2.94Å; L37-H41 PolarHBondContact O-ND1 3.11Å; Q38-H41 PolarHBondContact O-N 3.22Å; E39-H41 VanDerWaalsContact C-N 3.3Å; E39-H41 PolarHBondContact O-N 2.93Å; H41-G45 PolarHBondContact O-N 3.44Å
42	L	66.4	Low	73.3	Confident	127 Å²	127	118.7 Å²	118.7	67%	0.665	63%	0.631	S	S	*	*	H	α-helix	trans	-72.3	-37.7	177	-72.1	166	0	0	0	112	Q38 E39 G45 G46	Q38-L42 HydrophobicContact CG-CD1 3.9Å; Q38-L42 WeakPolarHBondContact O-CB 3.42Å; Q38-L42 VanDerWaalsContact O-CG 3.28Å; Q38-L42 WeakPolarHBondContact O-CG 3.45Å; Q38-L42 PolarHBondContact O-N 3.3Å; E39-L42 PolarHBondContact O-N 3.35Å; L42-G45 PolarHBondContact O-N 3.37Å; L42-G46 PolarHBondContact O-N 3.06Å
43	T	62.9	Low	72.2	Confident	96 Å²	96	119.5 Å²	119.5	59%	0.589	64%	0.637	S	S	*	*	H	α-helix	trans	-71.7	-36.8	173.8	122.6	0	0	0	0	111.9	E39 G45 G46	E39-T43 HydrophobicContact CG-CG2 4.13Å; E39-T43 WeakPolarHBondContact O-CG2 3.32Å; E39-T43 PolarHBondContact O-N 2.91Å; T43-G45 VanDerWaalsContact C-N 3.29Å; T43-G45 PolarHBondContact O-N 3.38Å; T43-G46 PolarHBondContact O-N 3.27Å
44	S	61.7	Low	71.1	Confident	94 Å²	94	120.1 Å²	120.1	66%	0.657	64%	0.64	S	S	*	*	H	α-helix	trans	-73.9	-18.2	176.1	-173.6	0	0	0	0	113.6	I40	I40-S44 WeakPolarHBondContact O-CB 3.46Å; I40-S44 PolarHBondContact O-N 3.1Å
45	G	61	Low	69.8	Low	52 Å²	52	121.4 Å²	121.4	54%	0.536	65%	0.647	S	S	.	*	T	Hydrogen-bonded Turn	trans	-84.8	-10.8	172.3	0	0	0	0	0	114.1	H41 L42 T43 T47	H41-G45 PolarHBondContact O-N 3.44Å; L42-G45 PolarHBondContact O-N 3.37Å; T43-G45 VanDerWaalsContact C-N 3.29Å; T43-G45 PolarHBondContact O-N 3.38Å; G45-T47 VanDerWaalsContact C-N 3.27Å; G45-T47 PolarHBondContact O-N 3.4Å
46	G	61.2	Low	68.4	Low	61 Å²	61	123.6 Å²	123.6	63%	0.629	66%	0.66	S	S	*	*	S	Bend	trans	-84.7	26.9	-177.5	0	0	0	0	0	115.4	L42 T43	L42-G46 PolarHBondContact O-N 3.06Å; T43-G46 PolarHBondContact O-N 3.27Å
47	T	57.4	Low	66.9	Low	130 Å²	130	121.3 Å²	121.3	80%	0.798	67%	0.667	S	S	*	*			trans	-143.2	53.8	167.4	-37.6	0	0	0	0	109.9	G45	G45-T47 VanDerWaalsContact C-N 3.27Å; G45-T47 PolarHBondContact O-N 3.4Å
48	R	57.5	Low	65.4	Low	237 Å²	237	124.3 Å²	124.3	89%	0.894	69%	0.685	S	S	*	*			trans	-127.1	96.5	158.8	-76.8	-170.4	129.6	108.2	-0.8	109.1
49	N	49.7	Very low	63.9	Low	242 Å²	242	125.4 Å²	125.4	100%	1.294	70%	0.699	S	S	*	*			trans	74.3	0	164.2	-152.7	56	0	0	0	117

Retrieved 49 of 49 residues in 43.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).