A0A087WNX9_MOUSE Loading...

BCL2-associated athanogene 2

AlphaFold DB , UniProt , Accession A0A087WNX9, Species MOUSE (Mus musculus, Mouse), Gene Bag2, Length 57 aa.

						>A0A087WNX9_MOUSE|A0A087WNX9|Bag2
MAQAKISAKAHEGRFCRSSSMADRSSRLLESLDQLELRRKRGTKPDCQPSDGPDPHG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38.1	Very low	57.1	Low	251 Å²	251	140.1 Å²	140.1	100%	1.236	79%	0.794	S	S	*	*				0	126.1	0	-72.4	178.1	-170.8	0	0	108.1
2	A	51	Low	57	Low	110 Å²	110	143.2 Å²	143.2	91%	0.909	80%	0.797	S	S	*	*			trans	-90.1	122.5	176.5	0	0	0	0	0	109.4
3	Q	54.8	Low	57	Low	181 Å²	181	136.9 Å²	136.9	85%	0.846	79%	0.785	S	S	*	*			trans	-85.2	112	175.3	-171.1	-177.4	68.5	0	0	108.6	K5	Q3-K5 PolarHBondContact O-N 3.2Å
4	A	62.6	Low	57	Low	86 Å²	86	139.4 Å²	139.4	71%	0.711	78%	0.775	S	S	*	*			trans	-67	113.7	173.2	0	0	0	0	0	109.4	I6	A4-I6 PolarHBondContact O-N 3.14Å; A4-I6 VanDerWaalsContact O-N 3.14Å
5	K	58.7	Low	56.8	Low	194 Å²	194	141.1 Å²	141.1	84%	0.843	77%	0.772	S	S	*	*			trans	-75.8	97.3	173	-82.7	175.4	170.1	177.8	0	108.9	Q3 S7	Q3-K5 PolarHBondContact O-N 3.2Å; K5-S7 PolarHBondContact O-N 3.19Å
6	I	66	Low	56.6	Low	152 Å²	152	139.4 Å²	139.4	78%	0.779	77%	0.771	S	S	*	*			trans	-77.7	99.4	170.4	-58.3	171.5	0	0	0	107.1	A4 A8	A4-I6 PolarHBondContact O-N 3.14Å; A4-I6 VanDerWaalsContact O-N 3.14Å; I6-A8 HydrophobicContact CG2-CB 4.23Å; I6-A8 PolarHBondContact O-N 2.99Å
7	S	59.3	Low	56.8	Low	116 Å²	116	145.4 Å²	145.4	81%	0.811	78%	0.779	S	S	*	*			trans	-76.8	75.7	166.7	60.2	0	0	0	0	109	K5 K9	K5-S7 PolarHBondContact O-N 3.19Å; S7-K9 VanDerWaalsContact C-N 3.33Å; S7-K9 PolarHBondContact O-N 3.01Å
8	A	58.1	Low	56.9	Low	83 Å²	83	141.1 Å²	141.1	69%	0.686	76%	0.763	S	S	*	*			trans	-72.3	93.5	168	0	0	0	0	0	107.5	I6 A10	I6-A8 HydrophobicContact CG2-CB 4.23Å; I6-A8 PolarHBondContact O-N 2.99Å; A8-A10 PolarHBondContact O-N 2.81Å
9	K	59	Low	57.4	Low	206 Å²	206	137.2 Å²	137.2	90%	0.896	75%	0.747	S	S	*	*			trans	-67.4	88.7	169	-154	171.3	-172.7	174.4	0	106.4	S7 H11	S7-K9 VanDerWaalsContact C-N 3.33Å; S7-K9 PolarHBondContact O-N 3.01Å; K9-H11 PolarHBondContact O-N 2.84Å
10	A	60.1	Low	58.5	Low	74 Å²	74	133.6 Å²	133.6	61%	0.612	73%	0.732	S	S	*	*			trans	-54.2	115.7	175.3	0	0	0	0	0	107.2	A8 E12	A8-A10 PolarHBondContact O-N 2.81Å; A10-E12 HydrophobicContact CB-CG 4.23Å; A10-E12 PolarHBondContact O-N 3.03Å
11	H	59.9	Low	59.7	Low	88 Å²	88	134 Å²	134	41%	0.407	73%	0.731	S	S	.	*			trans	-73.3	74	174.9	-175.5	-71.3	0	0	0	108	K9 G13 R14	K9-H11 PolarHBondContact O-N 2.84Å; H11-G13 PolarHBondContact O-N 3.15Å; H11-G13 VanDerWaalsContact O-N 3.13Å; H11-R14 PolarHBondContact CD2-NH2 3.13Å; H11-R14 WeakPolarHBondContact CE1-CB 3.43Å; H11-R14 WeakPolarHBondContact CE1-CG 3.32Å; H11-R14 PolarHBondContact CE1-N 3.25Å; H11-R14 PolarHBondContact CE1-NE 2.68Å; H11-R14 PolarHBondContact NE2-NE 3.07Å; H11-R14 PolarHBondContact NE2-NH1 3.41Å; H11-R14 PolarHBondContact NE2-NH2 2.9Å
12	E	56.5	Low	62.1	Low	177 Å²	177	124.8 Å²	124.8	83%	0.827	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.3	-3.4	-177.2	-86.4	-175.9	153.5	0	0	114	A10	A10-E12 HydrophobicContact CB-CG 4.23Å; A10-E12 PolarHBondContact O-N 3.03Å
13	G	57.5	Low	63.7	Low	62 Å²	62	123.7 Å²	123.7	64%	0.639	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.8	-3.6	-168.5	0	0	0	0	0	118.1	H11	H11-G13 PolarHBondContact O-N 3.15Å; H11-G13 VanDerWaalsContact O-N 3.13Å
14	R	56.3	Low	65.2	Low	172 Å²	172	122.3 Å²	122.3	65%	0.649	66%	0.661	S	S	*	*	S	Bend	trans	-125.1	-5.6	-170.2	-81.9	-176.8	-51.2	-115.6	7.4	116.3	H11 C16 S18	H11-R14 PolarHBondContact CD2-NH2 3.13Å; H11-R14 WeakPolarHBondContact CE1-CB 3.43Å; H11-R14 WeakPolarHBondContact CE1-CG 3.32Å; H11-R14 PolarHBondContact CE1-N 3.25Å; H11-R14 PolarHBondContact CE1-NE 2.68Å; H11-R14 PolarHBondContact NE2-NE 3.07Å; H11-R14 PolarHBondContact NE2-NH1 3.41Å; H11-R14 PolarHBondContact NE2-NH2 2.9Å; R14-C16 VanDerWaalsContact C-N 3.33Å; R14-S18 PolarHBondContact O-OG 2.89Å
15	F	54.1	Low	66.5	Low	165 Å²	165	120.9 Å²	120.9	72%	0.724	65%	0.645	S	S	*	*	G	3₁₀ helix	trans	-77.1	-19.8	177	-83.7	-83.3	0	0	0	113.1	R17 S18	F15-R17 PolarHBondContact O-N 3.17Å; F15-R17 VanDerWaalsContact O-N 3.11Å; F15-S18 PolarHBondContact O-N 3.11Å; F15-S18 VanDerWaalsContact O-N 3.17Å
16	C	54	Low	68.1	Low	113 Å²	113	114.4 Å²	114.4	76%	0.764	63%	0.625	S	S	*	*	G	3₁₀ helix	trans	-73.2	-1.3	-177.9	-51.7	0	0	0	0	115.2	R14	R14-C16 VanDerWaalsContact C-N 3.33Å
17	R	58.9	Low	69.3	Low	241 Å²	241	115.2 Å²	115.2	91%	0.909	62%	0.618	S	S	*	*	G	3₁₀ helix	trans	-123.1	-2.7	172.6	-69.5	-75.1	154.3	169.9	-5.5	113	F15	F15-R17 PolarHBondContact O-N 3.17Å; F15-R17 VanDerWaalsContact O-N 3.11Å
18	S	59.5	Low	71	Confident	69 Å²	69	115.2 Å²	115.2	48%	0.483	61%	0.608	S	S	.	*	S	Bend	trans	-88.7	112.7	173.4	-59.6	0	0	0	0	106.4	R14 F15 S20	R14-S18 PolarHBondContact O-OG 2.89Å; F15-S18 PolarHBondContact O-N 3.11Å; F15-S18 VanDerWaalsContact O-N 3.17Å; S18-S20 PolarHBondContact O-N 3.12Å
19	S	66.3	Low	72.7	Confident	66 Å²	66	116.7 Å²	116.7	46%	0.462	60%	0.604	S	S	.	*			trans	-39.8	126.7	171.8	-42.7	0	0	0	0	109.2	R24	S19-R24 WeakPolarHBondContact O-CD 3.42Å
20	S	79.8	Confident	74.4	Confident	65 Å²	65	112.6 Å²	112.6	46%	0.455	59%	0.588	S	S	.	*			trans	-52.7	153.2	-178.1	177.9	0	0	0	0	109.7	S18 A22 D23 R24	S18-S20 PolarHBondContact O-N 3.12Å; S20-A22 PolarHBondContact O-N 2.92Å; S20-A22 VanDerWaalsContact O-N 3.07Å; S20-A22 PolarHBondContact OG-N 3.39Å; S20-D23 WeakPolarHBondContact CB-OD2 3.39Å; S20-D23 PolarHBondContact N-OD2 3.02Å; S20-D23 VanDerWaalsContact N-OD2 3.14Å; S20-D23 PolarHBondContact O-N 3.28Å; S20-R24 WeakPolarHBondContact O-CG 3.31Å; S20-R24 PolarHBondContact O-N 3.14Å
21	M	83.9	Confident	75.9	Confident	143 Å²	143	112.3 Å²	112.3	70%	0.704	58%	0.582	S	S	*	*	H	α-helix	trans	-50.1	-35.1	171.4	-83.9	-64.7	-62.5	0	0	111.5	S25	M21-S25 WeakPolarHBondContact O-CB 3.2Å; M21-S25 PolarHBondContact O-N 3.24Å; M21-S25 PolarHBondContact O-OG 3.34Å
22	A	86.8	Confident	77.6	Confident	57 Å²	57	113.2 Å²	113.2	47%	0.471	59%	0.589	S	S	.	*	H	α-helix	trans	-61.8	-54.5	172.8	0	0	0	0	0	112.2	S20 R24 S25 S26	S20-A22 PolarHBondContact O-N 2.92Å; S20-A22 VanDerWaalsContact O-N 3.07Å; S20-A22 PolarHBondContact OG-N 3.39Å; A22-R24 VanDerWaalsContact C-N 3.27Å; A22-R24 PolarHBondContact O-N 3.08Å; A22-S25 WeakPolarHBondContact CA-OG 3.43Å; A22-S25 PolarHBondContact O-N 3.18Å; A22-S25 PolarHBondContact O-OG 3.18Å; A22-S26 PolarHBondContact O-N 3.46Å; A22-S26 PolarHBondContact O-OG 3.29Å; A22-S26 VanDerWaalsContact O-OG 3.12Å
23	D	85.9	Confident	79.3	Confident	87 Å²	87	109 Å²	109	47%	0.465	57%	0.572	S	S	.	*	H	α-helix	trans	-59.2	-37.9	178.6	-62.5	-59.4	0	0	0	112.7	S20 R27	S20-D23 WeakPolarHBondContact CB-OD2 3.39Å; S20-D23 PolarHBondContact N-OD2 3.02Å; S20-D23 VanDerWaalsContact N-OD2 3.14Å; S20-D23 PolarHBondContact O-N 3.28Å; D23-R27 WeakPolarHBondContact O-CG 3.31Å; D23-R27 PolarHBondContact O-N 3.32Å
24	R	86.8	Confident	80.8	Confident	153 Å²	153	111.5 Å²	111.5	58%	0.577	57%	0.567	S	S	*	*	H	α-helix	trans	-66.2	-43.7	175.5	-64.8	179.3	80.1	-169.4	5.1	110.5	S19 S20 A22 L28	S19-R24 WeakPolarHBondContact O-CD 3.42Å; S20-R24 WeakPolarHBondContact O-CG 3.31Å; S20-R24 PolarHBondContact O-N 3.14Å; A22-R24 VanDerWaalsContact C-N 3.27Å; A22-R24 PolarHBondContact O-N 3.08Å; R24-L28 VanDerWaalsContact O-CG 3.31Å; R24-L28 WeakPolarHBondContact O-CG 3.49Å; R24-L28 PolarHBondContact O-N 3.05Å
25	S	89.8	Confident	82.5	Confident	56 Å²	56	106.1 Å²	106.1	39%	0.392	55%	0.551	S	S	.	*	H	α-helix	trans	-64.9	-39.1	178	69.1	0	0	0	0	112.6	M21 A22 L28 L29	M21-S25 WeakPolarHBondContact O-CB 3.2Å; M21-S25 PolarHBondContact O-N 3.24Å; M21-S25 PolarHBondContact O-OG 3.34Å; A22-S25 WeakPolarHBondContact CA-OG 3.43Å; A22-S25 PolarHBondContact O-N 3.18Å; A22-S25 PolarHBondContact O-OG 3.18Å; S25-L28 PolarHBondContact O-N 2.91Å; S25-L29 WeakPolarHBondContact O-CG 3.38Å; S25-L29 PolarHBondContact O-N 2.98Å
26	S	91.3	Very high	84	Confident	58 Å²	58	102.7 Å²	102.7	41%	0.406	54%	0.537	S	S	.	.	H	α-helix	trans	-62.1	-47.6	177	-57.1	0	0	0	0	111.9	A22 L28 L29 E30	A22-S26 PolarHBondContact O-N 3.46Å; A22-S26 PolarHBondContact O-OG 3.29Å; A22-S26 VanDerWaalsContact O-OG 3.12Å; S26-L28 VanDerWaalsContact C-N 3.27Å; S26-L28 PolarHBondContact O-N 3.19Å; S26-L29 PolarHBondContact O-N 3.01Å; S26-E30 PolarHBondContact O-N 3.02Å
27	R	91.8	Very high	85.6	Confident	168 Å²	168	100.9 Å²	100.9	63%	0.634	52%	0.519	S	S	*	.	H	α-helix	trans	-62.4	-34.2	177.7	-69.7	174.8	-176.1	-115.9	1.1	112.9	D23 S31	D23-R27 WeakPolarHBondContact O-CG 3.31Å; D23-R27 PolarHBondContact O-N 3.32Å; R27-S31 WeakPolarHBondContact O-CB 3.48Å; R27-S31 PolarHBondContact O-N 3.17Å; R27-S31 VanDerWaalsContact O-N 3.13Å; R27-S31 PolarHBondContact O-OG 3.33Å
28	L	94.1	Very high	86.7	Confident	116 Å²	116	97.5 Å²	97.5	61%	0.607	51%	0.506	S	S	*	.	H	α-helix	trans	-67.8	-44.6	175.3	-71.7	171.2	0	0	0	111.3	R24 S25 S26 S31 L32	R24-L28 VanDerWaalsContact O-CG 3.31Å; R24-L28 WeakPolarHBondContact O-CG 3.49Å; R24-L28 PolarHBondContact O-N 3.05Å; S25-L28 PolarHBondContact O-N 2.91Å; S26-L28 VanDerWaalsContact C-N 3.27Å; S26-L28 PolarHBondContact O-N 3.19Å; L28-S31 WeakPolarHBondContact O-CB 3.38Å; L28-S31 PolarHBondContact O-N 3.23Å; L28-L32 WeakPolarHBondContact O-CG 3.38Å; L28-L32 PolarHBondContact O-N 3.21Å
29	L	95.3	Very high	87.6	Confident	115 Å²	115	102.6 Å²	102.6	60%	0.602	52%	0.515	S	S	*	.	H	α-helix	trans	-60.6	-45	176.5	-74	169.1	0	0	0	112	S25 S26 S31 L32 D33	S25-L29 WeakPolarHBondContact O-CG 3.38Å; S25-L29 PolarHBondContact O-N 2.98Å; S26-L29 PolarHBondContact O-N 3.01Å; L29-S31 VanDerWaalsContact C-N 3.28Å; L29-S31 PolarHBondContact O-N 2.65Å; L29-L32 WeakPolarHBondContact O-CB 3.12Å; L29-L32 PolarHBondContact O-N 3.47Å; L29-D33 PolarHBondContact O-N 2.97Å
30	E	93.4	Very high	88	Confident	119 Å²	119	105.6 Å²	105.6	56%	0.556	52%	0.52	S	S	*	.	H	α-helix	trans	-60.5	-37.1	175.1	-72.1	170.3	-174.9	0	0	112.6	S26 D33 Q34	S26-E30 PolarHBondContact O-N 3.02Å; E30-D33 PolarHBondContact O-N 3.13Å; E30-Q34 WeakPolarHBondContact O-CG 3.49Å; E30-Q34 PolarHBondContact O-N 3.36Å; E30-Q34 VanDerWaalsContact O-N 3.1Å; E30-Q34 PolarHBondContact O-NE2 2.9Å
31	S	92.6	Very high	87.5	Confident	69 Å²	69	112.4 Å²	112.4	48%	0.483	54%	0.536	S	S	.	.	H	α-helix	trans	-69.3	-35.5	177.2	-59	0	0	0	0	112	R27 L28 L29 L35	R27-S31 WeakPolarHBondContact O-CB 3.48Å; R27-S31 PolarHBondContact O-N 3.17Å; R27-S31 VanDerWaalsContact O-N 3.13Å; R27-S31 PolarHBondContact O-OG 3.33Å; L28-S31 WeakPolarHBondContact O-CB 3.38Å; L28-S31 PolarHBondContact O-N 3.23Å; L29-S31 VanDerWaalsContact C-N 3.28Å; L29-S31 PolarHBondContact O-N 2.65Å; S31-L35 PolarHBondContact O-N 3.13Å; S31-L35 VanDerWaalsContact O-N 3.13Å
32	L	95.6	Very high	86.4	Confident	106 Å²	106	108.8 Å²	108.8	56%	0.555	54%	0.535	S	S	*	.	H	α-helix	trans	-67.8	-42.3	174.6	-69.4	173.2	0	0	0	111.5	L28 L29 Q34 L35 E36	L28-L32 WeakPolarHBondContact O-CG 3.38Å; L28-L32 PolarHBondContact O-N 3.21Å; L29-L32 WeakPolarHBondContact O-CB 3.12Å; L29-L32 PolarHBondContact O-N 3.47Å; L32-Q34 PolarHBondContact O-N 2.79Å; L32-L35 WeakPolarHBondContact O-CB 3.5Å; L32-L35 PolarHBondContact O-N 3.1Å; L32-L35 VanDerWaalsContact O-N 3.13Å; L32-E36 PolarHBondContact O-N 3.48Å
33	D	90.8	Very high	84.8	Confident	88 Å²	88	110.4 Å²	110.4	47%	0.471	54%	0.539	S	S	.	.	H	α-helix	trans	-60	-44.9	175.8	-179.1	66.5	0	0	0	111.7	L29 E30 L35 E36 L37	L29-D33 PolarHBondContact O-N 2.97Å; E30-D33 PolarHBondContact O-N 3.13Å; D33-L35 VanDerWaalsContact C-N 3.29Å; D33-L35 PolarHBondContact O-N 2.89Å; D33-E36 PolarHBondContact O-N 3.17Å; D33-E36 VanDerWaalsContact O-N 3.17Å; D33-L37 WeakPolarHBondContact O-CG 3.32Å; D33-L37 PolarHBondContact O-N 3.28Å; D33-L37 WeakPolarHBondContact OD2-CD1 3.48Å
34	Q	90	Very high	83.5	Confident	115 Å²	115	114.7 Å²	114.7	54%	0.537	55%	0.554	S	S	.	*	H	α-helix	trans	-60.3	-37.5	174.1	-72.5	172.7	57.6	0	0	112.9	E30 L32 R38	E30-Q34 WeakPolarHBondContact O-CG 3.49Å; E30-Q34 PolarHBondContact O-N 3.36Å; E30-Q34 VanDerWaalsContact O-N 3.1Å; E30-Q34 PolarHBondContact O-NE2 2.9Å; L32-Q34 PolarHBondContact O-N 2.79Å; Q34-R38 WeakPolarHBondContact O-CG 3.47Å; Q34-R38 PolarHBondContact O-N 2.97Å; Q34-R38 VanDerWaalsContact O-N 3.15Å
35	L	90.9	Very high	82.2	Confident	59 Å²	59	112.4 Å²	112.4	31%	0.309	56%	0.559	S	S	.	*	H	α-helix	trans	-69.3	-40.3	176.3	-177.9	62.5	0	0	0	111.4	S31 L32 D33 R38 R39	S31-L35 PolarHBondContact O-N 3.13Å; S31-L35 VanDerWaalsContact O-N 3.13Å; L32-L35 WeakPolarHBondContact O-CB 3.5Å; L32-L35 PolarHBondContact O-N 3.1Å; L32-L35 VanDerWaalsContact O-N 3.13Å; D33-L35 VanDerWaalsContact C-N 3.29Å; D33-L35 PolarHBondContact O-N 2.89Å; L35-R38 VanDerWaalsContact CD1-NH2 3.32Å; L35-R38 PolarHBondContact O-N 3.33Å; L35-R39 WeakPolarHBondContact O-CG 3.36Å; L35-R39 PolarHBondContact O-N 3.44Å
36	E	87.4	Confident	80.7	Confident	94 Å²	94	116.1 Å²	116.1	44%	0.439	57%	0.574	S	S	.	*	H	α-helix	trans	-64.2	-45	177	-170.9	179.3	166.9	0	0	111.4	L32 D33 R38 R39 K40	L32-E36 PolarHBondContact O-N 3.48Å; D33-E36 PolarHBondContact O-N 3.17Å; D33-E36 VanDerWaalsContact O-N 3.17Å; E36-R38 VanDerWaalsContact C-N 3.29Å; E36-R38 PolarHBondContact O-N 3.18Å; E36-R39 PolarHBondContact O-N 3.39Å; E36-R39 VanDerWaalsContact O-N 3.15Å; E36-K40 HydrophobicContact CG-CD 4.09Å; E36-K40 HydrophobicContact CG-CG 4.46Å; E36-K40 WeakPolarHBondContact O-CB 3.41Å; E36-K40 WeakPolarHBondContact O-CG 3.21Å; E36-K40 PolarHBondContact O-N 2.81Å; E36-K40 WeakPolarHBondContact OE1-CE 3.42Å; E36-K40 IonicContact OE1-NZ 2.65Å; E36-K40 PolarHBondContact OE1-NZ 3.15Å
37	L	86.4	Confident	78.9	Confident	74 Å²	74	118.6 Å²	118.6	39%	0.387	59%	0.591	S	S	.	*	H	α-helix	trans	-58.5	-40.8	174.5	-74.4	163.4	0	0	0	111.9	D33 R41	D33-L37 WeakPolarHBondContact O-CG 3.32Å; D33-L37 PolarHBondContact O-N 3.28Å; D33-L37 WeakPolarHBondContact OD2-CD1 3.48Å; L37-R41 WeakPolarHBondContact O-CB 3.43Å; L37-R41 WeakPolarHBondContact O-CG 3.14Å; L37-R41 PolarHBondContact O-N 3.37Å
38	R	82.4	Confident	77.5	Confident	170 Å²	170	117.4 Å²	117.4	64%	0.642	59%	0.592	S	S	*	*	H	α-helix	trans	-66.2	-41.4	174.6	-80.5	164.7	37.9	-155.6	-9.2	112.6	Q34 L35 E36 R41 G42	Q34-R38 WeakPolarHBondContact O-CG 3.47Å; Q34-R38 PolarHBondContact O-N 2.97Å; Q34-R38 VanDerWaalsContact O-N 3.15Å; L35-R38 VanDerWaalsContact CD1-NH2 3.32Å; L35-R38 PolarHBondContact O-N 3.33Å; E36-R38 VanDerWaalsContact C-N 3.29Å; E36-R38 PolarHBondContact O-N 3.18Å; R38-R41 PolarHBondContact O-N 2.92Å; R38-G42 PolarHBondContact O-N 3.15Å; R38-G42 VanDerWaalsContact O-N 3.15Å
39	R	78	Confident	75.8	Confident	176 Å²	176	116.6 Å²	116.6	66%	0.664	59%	0.594	S	S	*	*	H	α-helix	trans	-62.4	-48.1	174.1	-75.3	-163.4	-175.7	-177.4	3.4	111.1	L35 E36 R41 G42 T43	L35-R39 WeakPolarHBondContact O-CG 3.36Å; L35-R39 PolarHBondContact O-N 3.44Å; E36-R39 PolarHBondContact O-N 3.39Å; E36-R39 VanDerWaalsContact O-N 3.15Å; R39-R41 VanDerWaalsContact C-N 3.28Å; R39-R41 PolarHBondContact O-N 3.33Å; R39-G42 PolarHBondContact O-N 3.13Å; R39-T43 PolarHBondContact O-N 3.38Å; R39-T43 PolarHBondContact O-OG1 3.06Å
40	K	75.3	Confident	74.3	Confident	129 Å²	129	116.4 Å²	116.4	56%	0.561	60%	0.602	S	S	*	*	H	α-helix	trans	-59.6	-36.2	178	-75.4	174.9	167.7	168.5	0	112.7	E36 T43	E36-K40 HydrophobicContact CG-CD 4.09Å; E36-K40 HydrophobicContact CG-CG 4.46Å; E36-K40 WeakPolarHBondContact O-CB 3.41Å; E36-K40 WeakPolarHBondContact O-CG 3.21Å; E36-K40 PolarHBondContact O-N 2.81Å; E36-K40 WeakPolarHBondContact OE1-CE 3.42Å; E36-K40 IonicContact OE1-NZ 2.65Å; E36-K40 PolarHBondContact OE1-NZ 3.15Å; K40-T43 PolarHBondContact O-OG1 2.92Å
41	R	68.1	Low	72.7	Confident	208 Å²	208	117.7 Å²	117.7	79%	0.785	61%	0.613	S	S	*	*	H	α-helix	trans	-73.2	-26.1	175.4	-72.7	174.6	-168.9	-134.6	5	113.7	L37 R38 R39	L37-R41 WeakPolarHBondContact O-CB 3.43Å; L37-R41 WeakPolarHBondContact O-CG 3.14Å; L37-R41 PolarHBondContact O-N 3.37Å; R38-R41 PolarHBondContact O-N 2.92Å; R39-R41 VanDerWaalsContact C-N 3.28Å; R39-R41 PolarHBondContact O-N 3.33Å
42	G	60.8	Low	71.7	Confident	68 Å²	68	117.3 Å²	117.3	70%	0.701	62%	0.62	S	S	*	*	H	α-helix	trans	-88.7	-20.5	176.9	0	0	0	0	0	113.9	R38 R39 K44	R38-G42 PolarHBondContact O-N 3.15Å; R38-G42 VanDerWaalsContact O-N 3.15Å; R39-G42 PolarHBondContact O-N 3.13Å; G42-K44 PolarHBondContact O-N 2.81Å
43	T	55.1	Low	70.6	Confident	90 Å²	90	118.4 Å²	118.4	55%	0.552	63%	0.633	S	S	*	*			trans	-94.3	81.1	170.6	59.5	0	0	0	0	108.5	R39 K40 P45	R39-T43 PolarHBondContact O-N 3.38Å; R39-T43 PolarHBondContact O-OG1 3.06Å; K40-T43 PolarHBondContact O-OG1 2.92Å; T43-P45 WeakPolarHBondContact O-CD 3.4Å
44	K	57.4	Low	69.5	Low	178 Å²	178	121.3 Å²	121.3	77%	0.774	65%	0.649	S	S	*	*			trans	-60.4	117.6	147.1	-81.8	-178.8	173.8	-178	0	104.8	G42 D46	G42-K44 PolarHBondContact O-N 2.81Å; K44-D46 VanDerWaalsContact C-N 3.28Å; K44-D46 PolarHBondContact O-N 2.74Å
45	P	60.8	Low	68.6	Low	104 Å²	104	121 Å²	121	68%	0.675	66%	0.657	S	S	*	*			trans	-62.2	111.1	150.5	28.7	-26.4	0	0	0	103.2	T43 C47	T43-P45 WeakPolarHBondContact O-CD 3.4Å; P45-C47 PolarHBondContact O-N 3.05Å
46	D	57.8	Low	67.2	Low	134 Å²	134	126.4 Å²	126.4	72%	0.717	68%	0.68	S	S	*	*			trans	-54.7	94	155.7	-96.3	-83.8	0	0	0	105.1	K44 Q48	K44-D46 VanDerWaalsContact C-N 3.28Å; K44-D46 PolarHBondContact O-N 2.74Å; D46-Q48 HydrophobicContact CB-CG 4.48Å; D46-Q48 PolarHBondContact O-N 3.42Å
47	C	52.9	Low	65.5	Low	111 Å²	111	129.3 Å²	129.3	75%	0.75	74%	0.735	S	S	*	*			trans	-66.5	80.7	161	-66.4	0	0	0	0	104.6	P45 P49	P45-C47 PolarHBondContact O-N 3.05Å; C47-P49 WeakPolarHBondContact O-CD 3.48Å
48	Q	61.8	Low	64.5	Low	143 Å²	143	132.1 Å²	132.1	67%	0.668	75%	0.753	S	S	*	*			trans	-63.7	112	158.6	-73	-90.6	8.2	0	0	105.4	D46 S50	D46-Q48 HydrophobicContact CB-CG 4.48Å; D46-Q48 PolarHBondContact O-N 3.42Å; Q48-S50 VanDerWaalsContact C-N 3.26Å; Q48-S50 PolarHBondContact O-N 2.94Å
49	P	57.9	Low	63.5	Low	99 Å²	99	130.1 Å²	130.1	64%	0.643	76%	0.758	S	S	*	*			trans	-65.2	100	160.8	27.8	-28.6	0	0	0	106	C47 D51	C47-P49 WeakPolarHBondContact O-CD 3.48Å; P49-D51 PolarHBondContact O-N 3.05Å
50	S	64.1	Low	62.7	Low	111 Å²	111	127.5 Å²	127.5	78%	0.776	76%	0.764	S	S	*	*			trans	-80.5	67.3	167.1	-59	0	0	0	0	107.7	Q48	Q48-S50 VanDerWaalsContact C-N 3.26Å; Q48-S50 PolarHBondContact O-N 2.94Å
51	D	61.3	Low	62	Low	145 Å²	145	127.4 Å²	127.4	78%	0.775	78%	0.776	S	S	*	*			trans	-100.4	88.8	166.9	-68	-62.6	0	0	0	105	P49	P49-D51 PolarHBondContact O-N 3.05Å
52	G	71.1	Confident	61.6	Low	62 Å²	62	122.4 Å²	122.4	64%	0.639	78%	0.775	S	S	*	*				88.6	128.5	90.2	0	0	0	0	0	109.5	D54	G52-D54 PolarHBondContact O-N 3.15Å
53	P	71.5	Confident	61.7	Low	128 Å²	128	126 Å²	126	83%	0.831	78%	0.78	S	S	*	*			trans	-63.8	131.9	-176.9	26.1	-32.7	0	0	0	111.2	P55	P53-P55 WeakPolarHBondContact O-CD 3.12Å
54	D	68.6	Low	62.1	Low	150 Å²	150	128.6 Å²	128.6	80%	0.802	80%	0.796	S	S	*	*			trans	-42.8	121.5	174	-106.7	-55.7	0	0	0	112	G52	G52-D54 PolarHBondContact O-N 3.15Å
55	P	70.9	Confident	62.5	Low	108 Å²	108	124.8 Å²	124.8	70%	0.701	80%	0.798	S	S	*	*			trans	-102.1	56.5	173.8	39.1	-31.3	0	0	0	111.1	P53	P53-P55 WeakPolarHBondContact O-CD 3.12Å
56	H	61.8	Low	62.6	Low	172 Å²	172	126.5 Å²	126.5	80%	0.796	81%	0.808	S	S	*	*			trans	-147.8	111.8	159.9	-71.6	-70.3	0	0	0	105.6
57	G	52	Low	63.1	Low	155 Å²	155	125.8 Å²	125.8	100%	1.598	82%	0.816	S	S	*	*				96.7	0	68.9	0	0	0	0	0	107.4

Retrieved 57 of 57 residues in 70.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).