A0A087WP93_MOUSE Loading...

Erythrocyte membrane protein band 4.1 like 5

AlphaFold DB , UniProt , Accession A0A087WP93, Species MOUSE (Mus musculus, Mouse), Gene Epb41l5, Length 114 aa.

						>A0A087WP93_MOUSE|A0A087WP93|Epb41l5
MLSFLRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDAKSIITCRVSLLDGTDVSVDLPKKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43	Very low	49.5	Very low	244 Å²	244	169.5 Å²	169.5	100%	1.202	83%	0.831	S	S	*	*				0	107.9	0	-80.6	176	175.4	0	0	108.1
2	L	39.1	Very low	49.9	Very low	166 Å²	166	174.2 Å²	174.2	87%	0.869	83%	0.833	S	S	*	*			trans	-104.3	103.2	178.7	-78.8	153.3	0	0	0	108.4
3	S	45	Very low	50.3	Low	118 Å²	118	167.3 Å²	167.3	83%	0.825	81%	0.814	S	S	*	*			trans	-80.3	114.5	175.8	49.4	0	0	0	0	110.3	L5	S3-L5 PolarHBondContact O-N 3.33Å
4	F	48.3	Very low	50.7	Low	194 Å²	194	165.7 Å²	165.7	85%	0.851	81%	0.807	S	S	*	*			trans	-74.6	107.1	170.2	-74.5	-90	0	0	0	110.2	R6	F4-R6 PolarHBondContact O-N 3.2Å
5	L	52.4	Low	51.4	Low	166 Å²	166	166.9 Å²	166.9	87%	0.869	80%	0.8	S	S	*	*			trans	-83.4	88.5	169.8	-154.2	78.8	0	0	0	109.4	S3 R7	S3-L5 PolarHBondContact O-N 3.33Å; L5-R7 PolarHBondContact O-N 2.93Å; L5-R7 VanDerWaalsContact O-N 3.11Å
6	R	47.9	Very low	51.9	Low	225 Å²	225	166.9 Å²	166.9	85%	0.849	80%	0.795	S	S	*	*			trans	-68.8	105.7	169	-86.7	-172.4	175.5	-131	0.9	109.2	F4 T8	F4-R6 PolarHBondContact O-N 3.2Å; R6-T8 PolarHBondContact O-N 3.11Å
7	R	52.3	Low	52.3	Low	221 Å²	221	164 Å²	164	83%	0.834	78%	0.78	S	S	*	*			trans	-58.2	94.1	163.8	-83.5	175.4	160.2	-174.3	-5	109.9	L5 L9	L5-R7 PolarHBondContact O-N 2.93Å; L5-R7 VanDerWaalsContact O-N 3.11Å; R7-L9 VanDerWaalsContact C-N 3.27Å; R7-L9 PolarHBondContact O-N 3.13Å; R7-L9 VanDerWaalsContact O-N 3.13Å
8	T	56.3	Low	53.1	Low	128 Å²	128	157.8 Å²	157.8	79%	0.785	76%	0.761	S	S	*	*			trans	-83.6	71	166.9	55.3	0	0	0	0	110	R6	R6-T8 PolarHBondContact O-N 3.11Å
9	L	53.8	Low	53.7	Low	143 Å²	143	156.2 Å²	156.2	75%	0.749	75%	0.752	S	S	*	*			trans	-106.7	6.8	179.6	-100.7	149.9	0	0	0	114.1	R7	R7-L9 VanDerWaalsContact C-N 3.27Å; R7-L9 PolarHBondContact O-N 3.13Å; R7-L9 VanDerWaalsContact O-N 3.13Å
10	G	53.8	Low	54.2	Low	50 Å²	50	156 Å²	156	52%	0.515	75%	0.747	S	S	.	*	S	Bend	trans	-97.4	-25	179.7	0	0	0	0	0	115.8
11	R	52.4	Low	54.6	Low	209 Å²	209	153 Å²	153	79%	0.789	73%	0.732	S	S	*	*	H	α-helix	trans	-80.8	-26.7	-167.2	-135	178.4	-167.1	-166.1	3.2	114.2	R15	R11-R15 PolarHBondContact O-N 3.46Å
12	R	54.2	Low	55.5	Low	226 Å²	226	150.5 Å²	150.5	85%	0.853	71%	0.71	S	S	*	*	H	α-helix	trans	-78.3	-36	-178.9	-124.2	179	-176.6	-175.8	1.5	112.4	K16	R12-K16 PolarHBondContact O-N 3.38Å
13	S	55.5	Low	56.6	Low	85 Å²	85	147.2 Å²	147.2	59%	0.594	69%	0.693	S	S	*	*	H	α-helix	trans	-71	-46.5	-179.8	-169.9	0	0	0	0	112.1	R15 K16 H17	S13-R15 VanDerWaalsContact C-N 3.31Å; S13-R15 PolarHBondContact O-N 3.18Å; S13-K16 PolarHBondContact O-N 2.94Å; S13-H17 PolarHBondContact O-N 3.41Å
14	M	56.1	Low	57.3	Low	145 Å²	145	149.9 Å²	149.9	71%	0.714	69%	0.685	S	S	*	*	H	α-helix	trans	-61.2	-37.7	175.4	-72.6	-72.5	-82.3	0	0	112.5	H17 A18	M14-H17 PolarHBondContact O-N 3.01Å; M14-A18 VanDerWaalsContact O-CB 3.31Å; M14-A18 WeakPolarHBondContact O-CB 3.31Å; M14-A18 PolarHBondContact O-N 3.18Å
15	R	60.3	Low	57.9	Low	184 Å²	184	146.6 Å²	146.6	69%	0.694	67%	0.672	S	S	*	*	H	α-helix	trans	-63.4	-43.6	173.5	-91.6	-176.4	170.4	177.5	-4	112.6	R11 S13 H17 A18 E19	R11-R15 PolarHBondContact O-N 3.46Å; S13-R15 VanDerWaalsContact C-N 3.31Å; S13-R15 PolarHBondContact O-N 3.18Å; R15-H17 VanDerWaalsContact C-N 3.35Å; R15-H17 PolarHBondContact O-N 3.07Å; R15-A18 PolarHBondContact O-N 2.92Å; R15-E19 WeakPolarHBondContact O-CB 3.38Å; R15-E19 PolarHBondContact O-N 3.43Å
16	K	59.5	Low	58.1	Low	167 Å²	167	142.3 Å²	142.3	73%	0.726	66%	0.66	S	S	*	*	H	α-helix	trans	-62.5	-40.1	175.4	-88.8	-169.1	171.6	-171.6	0	112.5	R12 S13 K20	R12-K16 PolarHBondContact O-N 3.38Å; S13-K16 PolarHBondContact O-N 2.94Å; K16-K20 WeakPolarHBondContact O-CB 3.25Å; K16-K20 PolarHBondContact O-N 3.49Å
17	H	59.8	Low	58.6	Low	117 Å²	117	137.5 Å²	137.5	54%	0.542	65%	0.647	S	S	.	*	H	α-helix	trans	-68.8	-43.4	178.5	-155.3	-77.6	0	0	0	111.6	S13 M14 R15 E19 K20 E21	S13-H17 PolarHBondContact O-N 3.41Å; M14-H17 PolarHBondContact O-N 3.01Å; R15-H17 VanDerWaalsContact C-N 3.35Å; R15-H17 PolarHBondContact O-N 3.07Å; H17-E19 PolarHBondContact O-N 3.33Å; H17-K20 PolarHBondContact O-N 3.49Å; H17-E21 WeakPolarHBondContact O-CB 3.34Å; H17-E21 WeakPolarHBondContact O-CG 3.19Å; H17-E21 PolarHBondContact O-N 3.46Å
18	A	66.4	Low	59.1	Low	52 Å²	52	135.8 Å²	135.8	43%	0.43	64%	0.641	S	S	.	*	H	α-helix	trans	-64.4	-37.9	176.5	0	0	0	0	0	112.6	M14 R15 R22	M14-A18 VanDerWaalsContact O-CB 3.31Å; M14-A18 WeakPolarHBondContact O-CB 3.31Å; M14-A18 PolarHBondContact O-N 3.18Å; R15-A18 PolarHBondContact O-N 2.92Å; A18-R22 WeakPolarHBondContact O-CB 3.4Å; A18-R22 VanDerWaalsContact O-CG 3.25Å; A18-R22 WeakPolarHBondContact O-CG 3.37Å; A18-R22 PolarHBondContact O-N 2.93Å
19	E	64.1	Low	59.6	Low	128 Å²	128	130.8 Å²	130.8	60%	0.598	61%	0.613	S	S	*	*	H	α-helix	trans	-66.8	-41.9	175.4	-169.2	178	132.1	0	0	111.6	R15 H17 R22 L23	R15-E19 WeakPolarHBondContact O-CB 3.38Å; R15-E19 PolarHBondContact O-N 3.43Å; H17-E19 PolarHBondContact O-N 3.33Å; E19-R22 PolarHBondContact O-N 2.87Å; E19-L23 HydrophobicContact CG-CD1 4.43Å; E19-L23 WeakPolarHBondContact O-CB 3.44Å; E19-L23 VanDerWaalsContact O-CG 3.27Å; E19-L23 WeakPolarHBondContact O-CG 3.27Å; E19-L23 PolarHBondContact O-N 3.37Å
20	K	64.6	Low	60.5	Low	151 Å²	151	128.3 Å²	128.3	66%	0.657	61%	0.612	S	S	*	*	H	α-helix	trans	-64.3	-41.2	175.9	-164.5	178.9	-177.3	-176.2	0	112.2	K16 H17 R24	K16-K20 WeakPolarHBondContact O-CB 3.25Å; K16-K20 PolarHBondContact O-N 3.49Å; H17-K20 PolarHBondContact O-N 3.49Å; K20-R24 WeakPolarHBondContact O-CB 3.38Å; K20-R24 PolarHBondContact O-N 2.9Å
21	E	61.9	Low	62.1	Low	93 Å²	93	128.2 Å²	128.2	44%	0.435	60%	0.602	S	S	.	*	H	α-helix	trans	-65.7	-45	174.5	-74	-85.6	102	0	0	111.4	H17 L23 R24 E25	H17-E21 WeakPolarHBondContact O-CB 3.34Å; H17-E21 WeakPolarHBondContact O-CG 3.19Å; H17-E21 PolarHBondContact O-N 3.46Å; E21-L23 VanDerWaalsContact C-N 3.35Å; E21-L23 PolarHBondContact O-N 2.81Å; E21-R24 CarbonylContact O-C 3.55Å; E21-R24 WeakPolarHBondContact O-CA 3.33Å; E21-R24 WeakPolarHBondContact O-CB 3.47Å; E21-R24 PolarHBondContact O-N 2.79Å; E21-R24 VanDerWaalsContact O-N 3.08Å; E21-E25 WeakPolarHBondContact O-CB 3.48Å; E21-E25 PolarHBondContact O-N 3.1Å
22	R	62.3	Low	63.9	Low	192 Å²	192	123.2 Å²	123.2	73%	0.725	59%	0.587	S	S	*	*	H	α-helix	trans	-62.6	-38.8	175.5	-74.4	-178.4	88.3	-169.2	7.4	112.7	A18 E19 R24 E25 A26	A18-R22 WeakPolarHBondContact O-CB 3.4Å; A18-R22 VanDerWaalsContact O-CG 3.25Å; A18-R22 WeakPolarHBondContact O-CG 3.37Å; A18-R22 PolarHBondContact O-N 2.93Å; E19-R22 PolarHBondContact O-N 2.87Å; R22-R24 VanDerWaalsContact C-N 3.32Å; R22-E25 PolarHBondContact O-N 3.27Å; R22-A26 WeakPolarHBondContact O-CB 3.39Å; R22-A26 PolarHBondContact O-N 3.43Å
23	L	61.8	Low	65.7	Low	98 Å²	98	113.5 Å²	113.5	51%	0.513	55%	0.552	S	S	.	*	H	α-helix	trans	-63.7	-40.1	172.5	-74.4	167.8	0	0	0	111.1	E19 E21 Q27	E19-L23 HydrophobicContact CG-CD1 4.43Å; E19-L23 WeakPolarHBondContact O-CB 3.44Å; E19-L23 VanDerWaalsContact O-CG 3.27Å; E19-L23 WeakPolarHBondContact O-CG 3.27Å; E19-L23 PolarHBondContact O-N 3.37Å; E21-L23 VanDerWaalsContact C-N 3.35Å; E21-L23 PolarHBondContact O-N 2.81Å; L23-Q27 WeakPolarHBondContact O-CB 3.35Å; L23-Q27 WeakPolarHBondContact O-CG 3.46Å; L23-Q27 PolarHBondContact O-N 3.08Å
24	R	60	Low	67.4	Low	174 Å²	174	114 Å²	114	66%	0.657	55%	0.554	S	S	*	*	H	α-helix	trans	-68.9	-35.2	178.5	-152.8	176.5	-170.3	-161.2	-0.4	112.4	K20 E21 R22 Q27 R28	K20-R24 WeakPolarHBondContact O-CB 3.38Å; K20-R24 PolarHBondContact O-N 2.9Å; E21-R24 CarbonylContact O-C 3.55Å; E21-R24 WeakPolarHBondContact O-CA 3.33Å; E21-R24 WeakPolarHBondContact O-CB 3.47Å; E21-R24 PolarHBondContact O-N 2.79Å; E21-R24 VanDerWaalsContact O-N 3.08Å; R22-R24 VanDerWaalsContact C-N 3.32Å; R24-Q27 CarbonylContact O-C 3.1Å; R24-Q27 PolarHBondContact O-N 3.23Å; R24-R28 PolarHBondContact O-N 2.67Å; R24-R28 VanDerWaalsContact O-N 3.1Å
25	E	60.8	Low	69	Low	125 Å²	125	108.6 Å²	108.6	58%	0.584	53%	0.532	S	S	*	.	H	α-helix	trans	-77.3	-39.2	177	-164.8	155.3	-145.9	0	0	111.6	E21 R22 Q27 R28	E21-E25 WeakPolarHBondContact O-CB 3.48Å; E21-E25 PolarHBondContact O-N 3.1Å; R22-E25 PolarHBondContact O-N 3.27Å; E25-Q27 PolarHBondContact O-N 3.47Å; E25-R28 WeakPolarHBondContact O-CB 3.49Å; E25-R28 PolarHBondContact O-N 3.21Å; E25-R28 VanDerWaalsContact O-N 3.1Å
26	A	56.5	Low	70.3	Confident	75 Å²	75	100.3 Å²	100.3	62%	0.62	50%	0.503	S	S	*	.	H	α-helix	trans	-64.4	-21.2	166.4	0	0	0	0	0	112.3	R22 R46	R22-A26 WeakPolarHBondContact O-CB 3.39Å; R22-A26 PolarHBondContact O-N 3.43Å; A26-R46 PolarHBondContact O-NH2 3.38Å
27	Q	57.3	Low	71.6	Confident	124 Å²	124	95.3 Å²	95.3	58%	0.579	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.1	-1.5	174.3	-74	178.1	-7.6	0	0	114.5	L23 R24 E25 A29 R46	L23-Q27 WeakPolarHBondContact O-CB 3.35Å; L23-Q27 WeakPolarHBondContact O-CG 3.46Å; L23-Q27 PolarHBondContact O-N 3.08Å; R24-Q27 CarbonylContact O-C 3.1Å; R24-Q27 PolarHBondContact O-N 3.23Å; E25-Q27 PolarHBondContact O-N 3.47Å; Q27-A29 PolarHBondContact O-N 2.63Å; Q27-R46 VanDerWaalsContact CB-NH1 3.32Å; Q27-R46 VanDerWaalsContact O-CZ 3.22Å; Q27-R46 PolarHBondContact O-NH1 3.27Å; Q27-R46 VanDerWaalsContact O-NH1 3.12Å
28	R	63.5	Low	72.9	Confident	186 Å²	186	97.9 Å²	97.9	70%	0.702	52%	0.516	S	S	*	.	S	Bend	trans	-73	124.4	171.7	-92.3	180	167.6	157	-4.4	109	R24 E25	R24-R28 PolarHBondContact O-N 2.67Å; R24-R28 VanDerWaalsContact O-N 3.1Å; E25-R28 WeakPolarHBondContact O-CB 3.49Å; E25-R28 PolarHBondContact O-N 3.21Å; E25-R28 VanDerWaalsContact O-N 3.1Å
29	A	66	Low	74	Confident	23 Å²	23	96.8 Å²	96.8	19%	0.19	51%	0.507	C	S	.	.			trans	-61.7	142.5	165	0	0	0	0	0	109.8	Q27 T31 D54 S56	Q27-A29 PolarHBondContact O-N 2.63Å; A29-T31 WeakPolarHBondContact CB-O 3.34Å; A29-T31 PolarHBondContact O-N 2.82Å; A29-D54 WeakPolarHBondContact CA-O 3.33Å; A29-D54 HydrophobicContact CB-CB 4.15Å; A29-D54 WeakPolarHBondContact CB-O 3.45Å; A29-S56 VanDerWaalsContact CB-CB 3.47Å; A29-S56 VanDerWaalsContact CB-N 3.26Å
30	A	73.6	Confident	75	Confident	90 Å²	90	101.2 Å²	101.2	74%	0.744	52%	0.524	S	S	*	.	S	Bend	trans	-66.8	-32.9	176.8	0	0	0	0	0	110.9	D54	A30-D54 PolarHBondContact N-O 2.96Å
31	T	86.7	Confident	76.1	Confident	49 Å²	49	96.7 Å²	96.7	30%	0.301	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	137.6	178.9	-53.6	0	0	0	0	110.7	A29 I33 V55 S56	A29-T31 WeakPolarHBondContact CB-O 3.34Å; A29-T31 PolarHBondContact O-N 2.82Å; T31-I33 HydrophobicContact CG2-CG1 4.42Å; T31-V55 HydrophobicContact CG2-CG1 4.41Å; T31-S56 PolarHBondContact O-N 3Å
32	H	91.4	Very high	77.6	Confident	103 Å²	103	95.9 Å²	95.9	48%	0.477	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	127.6	174.5	177.9	-109.9	0	0	0	110.9	S56 D58	H32-S56 CarbonylContact C-O 3.59Å; H32-S56 VanDerWaalsContact CA-O 3.3Å; H32-S56 WeakPolarHBondContact CA-O 3.13Å; H32-D58 IonicContact CD2-OD2 2.75Å; H32-D58 IonicContact CE1-OD2 2.63Å; H32-D58 PolarHBondContact CE1-OD2 2.9Å; H32-D58 VanDerWaalsContact NE2-CG 3.32Å; H32-D58 IonicContact NE2-OD1 3.26Å; H32-D58 IonicContact NE2-OD2 3.23Å; H32-D58 PolarHBondContact NE2-OD2 3.1Å
33	I	91	Very high	79	Confident	23 Å²	23	88 Å²	88	12%	0.118	48%	0.482	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	106.3	-178.7	-55.1	178.8	0	0	0	108.5	T31 A35 V55 S56 V57 D58 H75	T31-I33 HydrophobicContact CG2-CG1 4.42Å; I33-A35 VanDerWaalsContact C-N 3.28Å; I33-A35 HydrophobicContact CG2-CB 4.19Å; I33-A35 PolarHBondContact O-N 3.12Å; I33-V55 HydrophobicContact CD1-CG1 3.7Å; I33-V55 HydrophobicContact CG1-CG1 4.04Å; I33-S56 PolarHBondContact N-O 2.78Å; I33-V57 HydrophobicContact CB-CB 4.48Å; I33-V57 HydrophobicContact CB-CG1 4.14Å; I33-V57 HydrophobicContact CB-CG2 4.28Å; I33-V57 HydrophobicContact CD1-CG2 4.13Å; I33-V57 HydrophobicContact CG2-CG1 4.25Å; I33-V57 WeakPolarHBondContact O-CA 3.23Å; I33-D58 PolarHBondContact O-N 3.01Å; I33-H75 HydrophobicContact CD1-CB 3.74Å
34	P	91	Very high	80.5	Confident	96 Å²	96	87.8 Å²	87.8	62%	0.623	48%	0.484	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.7	65.3	179.1	34	-35.7	0	0	0	112	A36	P34-A36 PolarHBondContact O-N 3.39Å
35	A	90.8	Very high	82	Confident	31 Å²	31	80.3 Å²	80.3	26%	0.256	46%	0.459	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.5	6	-178.3	0	0	0	0	0	114.5	I33 V57 D58 L59 Q71	I33-A35 VanDerWaalsContact C-N 3.28Å; I33-A35 HydrophobicContact CG2-CB 4.19Å; I33-A35 PolarHBondContact O-N 3.12Å; A35-V57 HydrophobicContact CB-CG1 4.15Å; A35-D58 CarbonylContact C-O 3.5Å; A35-D58 VanDerWaalsContact CA-O 3.22Å; A35-D58 WeakPolarHBondContact CA-O 3.49Å; A35-D58 WeakPolarHBondContact CB-O 3.2Å; A35-D58 PolarHBondContact N-O 2.86Å; A35-L59 HydrophobicContact CB-CD2 3.72Å; A35-Q71 HydrophobicContact CB-CG 3.88Å
36	A	87.4	Confident	83.5	Confident	10 Å²	10	79.3 Å²	79.3	8%	0.083	45%	0.45	C	S	.	.	T	Hydrogen-bonded Turn	trans	-79.6	-19.6	-176.6	0	0	0	0	0	114.7	P34 D38 A39 I42 D58	P34-A36 PolarHBondContact O-N 3.39Å; A36-D38 PolarHBondContact O-N 3.32Å; A36-A39 WeakPolarHBondContact O-CB 3.45Å; A36-A39 PolarHBondContact O-N 3.2Å; A36-I42 HydrophobicContact CB-CB 4.36Å; A36-I42 HydrophobicContact CB-CD1 3.49Å; A36-I42 VanDerWaalsContact CB-CD1 3.49Å; A36-I42 HydrophobicContact CB-CG1 3.64Å; A36-I42 HydrophobicContact CB-CG2 3.88Å; A36-D58 HydrophobicContact CB-CB 4.21Å; A36-D58 PolarHBondContact N-O 2.63Å
37	G	87.3	Confident	85.3	Confident	62 Å²	62	76.3 Å²	76.3	64%	0.639	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.2	-136.3	-174	0	0	0	0	0	112.4	A39	G37-A39 PolarHBondContact O-N 3.01Å
38	D	87.1	Confident	87	Confident	171 Å²	171	74.7 Å²	74.7	91%	0.914	43%	0.426	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.9	17.6	-179.8	-58.8	-50.1	0	0	0	114.2	A36 K40	A36-D38 PolarHBondContact O-N 3.32Å; D38-K40 PolarHBondContact O-N 2.85Å
39	A	88.6	Confident	88.5	Confident	29 Å²	29	67.2 Å²	67.2	24%	0.24	40%	0.4	C	S	.	.			trans	-65.7	122.5	-176	0	0	0	0	0	111.9	A36 G37 S41 I42 P60	A36-A39 WeakPolarHBondContact O-CB 3.45Å; A36-A39 PolarHBondContact O-N 3.2Å; G37-A39 PolarHBondContact O-N 3.01Å; A39-S41 PolarHBondContact O-N 3.31Å; A39-S41 VanDerWaalsContact O-N 3.15Å; A39-I42 HydrophobicContact CB-CG1 4.34Å; A39-I42 WeakPolarHBondContact O-CG1 3.32Å; A39-P60 HydrophobicContact CB-CB 4.05Å; A39-P60 HydrophobicContact CB-CG 4.13Å
40	K	84.4	Confident	89.7	Confident	220 Å²	220	74.1 Å²	74.1	96%	0.957	43%	0.433	S	S	*	.	S	Bend	trans	-62.4	-21.2	175.8	-65.7	-178.3	-179.9	-179.9	0	114.2	D38	D38-K40 PolarHBondContact O-N 2.85Å
41	S	89.7	Confident	90.5	Very high	56 Å²	56	75.3 Å²	75.3	39%	0.392	43%	0.427	S	S	.	.	S	Bend	trans	-135.7	116.4	-178.7	-163	0	0	0	0	109.9	A39 K61	A39-S41 PolarHBondContact O-N 3.31Å; A39-S41 VanDerWaalsContact O-N 3.15Å; S41-K61 WeakPolarHBondContact O-CB 3.4Å; S41-K61 PolarHBondContact O-N 3.23Å; S41-K61 WeakPolarHBondContact OG-CD 3.46Å
42	I	92.6	Very high	90.5	Very high	77 Å²	77	76 Å²	76	40%	0.395	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	149.2	-170.1	-59.8	176.5	0	0	0	109.2	A36 A39 D58 L59	A36-I42 HydrophobicContact CB-CB 4.36Å; A36-I42 HydrophobicContact CB-CD1 3.49Å; A36-I42 VanDerWaalsContact CB-CD1 3.49Å; A36-I42 HydrophobicContact CB-CG1 3.64Å; A36-I42 HydrophobicContact CB-CG2 3.88Å; A39-I42 HydrophobicContact CB-CG1 4.34Å; A39-I42 WeakPolarHBondContact O-CG1 3.32Å; I42-D58 HydrophobicContact CG2-CB 3.76Å; I42-L59 CarbonylContact C-O 3.58Å; I42-L59 VanDerWaalsContact CA-O 3.28Å; I42-L59 WeakPolarHBondContact CA-O 3.42Å; I42-L59 WeakPolarHBondContact CG2-O 3.31Å
43	I	91.6	Very high	90.5	Very high	26 Å²	26	73.8 Å²	73.8	13%	0.133	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	136.8	165.9	55.6	172.3	0	0	0	108.2	D58 L59 K61 I104	I43-D58 WeakPolarHBondContact O-CA 3.24Å; I43-L59 HydrophobicContact CG1-CB 4.18Å; I43-L59 WeakPolarHBondContact CG1-O 3.36Å; I43-L59 PolarHBondContact N-O 3.02Å; I43-L59 PolarHBondContact O-N 2.82Å; I43-K61 HydrophobicContact CG2-CB 4.05Å; I43-K61 HydrophobicContact CG2-CG 3.93Å; I43-I104 HydrophobicContact CD1-CB 4.03Å; I43-I104 HydrophobicContact CD1-CD1 4.15Å; I43-I104 HydrophobicContact CD1-CG2 4.25Å
44	T	92.1	Very high	90.6	Very high	93 Å²	93	74.1 Å²	74.1	57%	0.571	44%	0.439	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.2	117.9	174.5	-56.1	0	0	0	0	108.4	S56 D58	T44-S56 WeakPolarHBondContact CG2-OG 3.33Å; T44-D58 WeakPolarHBondContact CA-OD1 3.47Å; T44-D58 VanDerWaalsContact CB-OD1 3.24Å; T44-D58 WeakPolarHBondContact CB-OD1 3.36Å; T44-D58 VanDerWaalsContact CG2-OD1 3.23Å; T44-D58 WeakPolarHBondContact CG2-OD1 3.42Å; T44-D58 PolarHBondContact OG1-OD1 2.87Å
45	C	92.7	Very high	90.7	Very high	17 Å²	17	69.6 Å²	69.6	12%	0.115	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	118	178.6	-68.4	0	0	0	0	109.1	S56 V57 L68	C45-S56 CarbonylContact O-C 3.43Å; C45-S56 WeakPolarHBondContact O-CA 3.4Å; C45-V57 PolarHBondContact N-O 2.75Å; C45-V57 PolarHBondContact O-N 3.32Å; C45-L68 HydrophobicContact CB-CD1 3.77Å; C45-L68 HydrophobicContact CB-CD2 3.86Å; C45-L68 HydrophobicContact CB-CG 4.49Å
46	R	93	Very high	90.9	Very high	104 Å²	104	68.9 Å²	68.9	39%	0.392	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.3	125.1	170.7	-172.6	179.1	177.7	-176.4	7.3	109.3	A26 Q27 D54 V55	A26-R46 PolarHBondContact O-NH2 3.38Å; Q27-R46 VanDerWaalsContact CB-NH1 3.32Å; Q27-R46 VanDerWaalsContact O-CZ 3.22Å; Q27-R46 PolarHBondContact O-NH1 3.27Å; Q27-R46 VanDerWaalsContact O-NH1 3.12Å; R46-D54 HydrophobicContact CG-CB 4.33Å; R46-D54 IonicContact CZ-OD2 3.98Å; R46-D54 VanDerWaalsContact CZ-OD2 3.26Å; R46-D54 IonicContact NE-OD1 2.78Å; R46-D54 IonicContact NE-OD2 3.32Å; R46-D54 PolarHBondContact NE-OD2 3.23Å; R46-D54 IonicContact NH2-OD2 3.82Å; R46-D54 PolarHBondContact NH2-OD2 3.46Å; R46-V55 CarbonylContact C-O 3.51Å; R46-V55 WeakPolarHBondContact CA-O 3.3Å
47	V	93.7	Very high	91.2	Very high	13 Å²	13	68.4 Å²	68.4	8%	0.079	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	122.8	-179.8	-178.6	0	0	0	0	108.2	L49 D54 V55 L68 I72 L86	V47-L49 HydrophobicContact CG1-CD2 4.2Å; V47-D54 WeakPolarHBondContact O-CA 3.14Å; V47-V55 PolarHBondContact N-O 2.81Å; V47-V55 PolarHBondContact O-N 3.26Å; V47-L68 HydrophobicContact CG2-CD1 4.07Å; V47-L68 HydrophobicContact CG2-CD2 4.2Å; V47-L68 HydrophobicContact CG2-CG 4.37Å; V47-I72 HydrophobicContact CB-CD1 4.04Å; V47-I72 HydrophobicContact CB-CG1 4.49Å; V47-I72 HydrophobicContact CG1-CD1 4.28Å; V47-I72 HydrophobicContact CG1-CG1 4.39Å; V47-I72 HydrophobicContact CG2-CD1 4.08Å; V47-I72 HydrophobicContact CG2-CG1 4.23Å; V47-L86 HydrophobicContact CG1-CD2 3.61Å
48	S	93.8	Very high	91.6	Very high	90 Å²	90	66.8 Å²	66.8	63%	0.629	38%	0.376	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.7	124.3	171.7	-55.8	0	0	0	0	109.3	D54	S48-D54 VanDerWaalsContact CA-OD1 3.25Å; S48-D54 WeakPolarHBondContact CA-OD1 3.23Å; S48-D54 VanDerWaalsContact CB-OD1 3.23Å; S48-D54 WeakPolarHBondContact CB-OD1 3.46Å; S48-D54 PolarHBondContact OG-OD1 3.31Å
49	L	93.4	Very high	91.9	Very high	28 Å²	28	58.9 Å²	58.9	15%	0.147	33%	0.333	C	S	.	.			trans	-86.9	170.1	-179.5	-60.3	-174.9	0	0	0	111.4	V47 D51 G52 T53 V55 I72 L76	V47-L49 HydrophobicContact CG1-CD2 4.2Å; L49-D51 VanDerWaalsContact C-N 3.27Å; L49-D51 WeakPolarHBondContact CB-OD1 3.23Å; L49-D51 PolarHBondContact O-N 2.58Å; L49-G52 PolarHBondContact O-N 2.8Å; L49-T53 WeakPolarHBondContact CD1-OG1 3.33Å; L49-T53 PolarHBondContact N-O 3.04Å; L49-V55 HydrophobicContact CD1-CG2 3.6Å; L49-V55 HydrophobicContact CG-CG2 4.04Å; L49-I72 HydrophobicContact CD2-CG2 3.98Å; L49-L76 HydrophobicContact CD1-CD1 4.46Å; L49-L76 HydrophobicContact CD1-CD2 3.82Å; L49-L76 HydrophobicContact CD2-CD1 4.14Å
50	L	92.2	Very high	92.2	Very high	168 Å²	168	59.3 Å²	59.3	88%	0.88	33%	0.334	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.1	-22	-176.7	-63.1	179.2	0	0	0	113.6	G52 F84	L50-G52 VanDerWaalsContact C-N 3.25Å; L50-F84 HydrophobicContact CD1-CE1 4.23Å
51	D	89.7	Confident	92.5	Very high	116 Å²	116	52.8 Å²	52.8	62%	0.62	31%	0.306	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.2	1	176.1	66.7	-10	0	0	0	113.1	L49 T53	L49-D51 VanDerWaalsContact C-N 3.27Å; L49-D51 WeakPolarHBondContact CB-OD1 3.23Å; L49-D51 PolarHBondContact O-N 2.58Å; D51-T53 VanDerWaalsContact C-N 3.32Å; D51-T53 WeakPolarHBondContact OD1-CB 3.25Å; D51-T53 PolarHBondContact OD1-N 3.3Å; D51-T53 PolarHBondContact OD1-OG1 3.01Å; D51-T53 WeakPolarHBondContact OD2-CG2 3.44Å; D51-T53 PolarHBondContact OD2-OG1 3.42Å
52	G	88	Confident	92.6	Very high	64 Å²	64	59.3 Å²	59.3	66%	0.66	33%	0.327	S	S	*	.	S	Bend	trans	83.4	3.5	-178.1	0	0	0	0	0	114.4	L49 L50	L49-G52 PolarHBondContact O-N 2.8Å; L50-G52 VanDerWaalsContact C-N 3.25Å
53	T	90.8	Very high	92.7	Very high	55 Å²	55	55.7 Å²	55.7	34%	0.337	31%	0.308	S	S	.	.			trans	-80.4	155.8	171.5	67	0	0	0	0	111.2	L49 D51	L49-T53 WeakPolarHBondContact CD1-OG1 3.33Å; L49-T53 PolarHBondContact N-O 3.04Å; D51-T53 VanDerWaalsContact C-N 3.32Å; D51-T53 WeakPolarHBondContact OD1-CB 3.25Å; D51-T53 PolarHBondContact OD1-N 3.3Å; D51-T53 PolarHBondContact OD1-OG1 3.01Å; D51-T53 WeakPolarHBondContact OD2-CG2 3.44Å; D51-T53 PolarHBondContact OD2-OG1 3.42Å
54	D	91.9	Very high	92.9	Very high	30 Å²	30	59.7 Å²	59.7	16%	0.16	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	137.1	175.6	-69.9	-52.7	0	0	0	110.6	A29 A30 R46 V47 S48	A29-D54 WeakPolarHBondContact CA-O 3.33Å; A29-D54 HydrophobicContact CB-CB 4.15Å; A29-D54 WeakPolarHBondContact CB-O 3.45Å; A30-D54 PolarHBondContact N-O 2.96Å; R46-D54 HydrophobicContact CG-CB 4.33Å; R46-D54 IonicContact CZ-OD2 3.98Å; R46-D54 VanDerWaalsContact CZ-OD2 3.26Å; R46-D54 IonicContact NE-OD1 2.78Å; R46-D54 IonicContact NE-OD2 3.32Å; R46-D54 PolarHBondContact NE-OD2 3.23Å; R46-D54 IonicContact NH2-OD2 3.82Å; R46-D54 PolarHBondContact NH2-OD2 3.46Å; V47-D54 WeakPolarHBondContact O-CA 3.14Å; S48-D54 VanDerWaalsContact CA-OD1 3.25Å; S48-D54 WeakPolarHBondContact CA-OD1 3.23Å; S48-D54 VanDerWaalsContact CB-OD1 3.23Å; S48-D54 WeakPolarHBondContact CB-OD1 3.46Å; S48-D54 PolarHBondContact OG-OD1 3.31Å
55	V	93.7	Very high	93.1	Very high	1 Å²	1	55.3 Å²	55.3	1%	0.006	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	132.1	174.6	-177.7	0	0	0	0	109	T31 I33 R46 V47 L49 V57 I72	T31-V55 HydrophobicContact CG2-CG1 4.41Å; I33-V55 HydrophobicContact CD1-CG1 3.7Å; I33-V55 HydrophobicContact CG1-CG1 4.04Å; R46-V55 CarbonylContact C-O 3.51Å; R46-V55 WeakPolarHBondContact CA-O 3.3Å; V47-V55 PolarHBondContact N-O 2.81Å; V47-V55 PolarHBondContact O-N 3.26Å; L49-V55 HydrophobicContact CD1-CG2 3.6Å; L49-V55 HydrophobicContact CG-CG2 4.04Å; V55-V57 HydrophobicContact CG1-CG2 4.07Å; V55-I72 HydrophobicContact CB-CD1 4.05Å; V55-I72 HydrophobicContact CG1-CD1 3.84Å
56	S	94.5	Very high	93.2	Very high	17 Å²	17	58.5 Å²	58.5	12%	0.119	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	125.2	174.3	-178.6	0	0	0	0	109.4	A29 T31 H32 I33 T44 C45	A29-S56 VanDerWaalsContact CB-CB 3.47Å; A29-S56 VanDerWaalsContact CB-N 3.26Å; T31-S56 PolarHBondContact O-N 3Å; H32-S56 CarbonylContact C-O 3.59Å; H32-S56 VanDerWaalsContact CA-O 3.3Å; H32-S56 WeakPolarHBondContact CA-O 3.13Å; I33-S56 PolarHBondContact N-O 2.78Å; T44-S56 WeakPolarHBondContact CG2-OG 3.33Å; C45-S56 CarbonylContact O-C 3.43Å; C45-S56 WeakPolarHBondContact O-CA 3.4Å
57	V	94.9	Very high	93.3	Very high	0 Å²	0	57.2 Å²	57.2	0%	0	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	121.2	180	-167.9	0	0	0	0	109.1	I33 A35 C45 V55 L59 L68 Q71 I72	I33-V57 HydrophobicContact CB-CB 4.48Å; I33-V57 HydrophobicContact CB-CG1 4.14Å; I33-V57 HydrophobicContact CB-CG2 4.28Å; I33-V57 HydrophobicContact CD1-CG2 4.13Å; I33-V57 HydrophobicContact CG2-CG1 4.25Å; I33-V57 WeakPolarHBondContact O-CA 3.23Å; A35-V57 HydrophobicContact CB-CG1 4.15Å; C45-V57 PolarHBondContact N-O 2.75Å; C45-V57 PolarHBondContact O-N 3.32Å; V55-V57 HydrophobicContact CG1-CG2 4.07Å; V57-L59 HydrophobicContact CG1-CD1 4.19Å; V57-L59 HydrophobicContact CG1-CD2 4.24Å; V57-L59 HydrophobicContact CG1-CG 3.91Å; V57-L68 HydrophobicContact CB-CD1 3.7Å; V57-L68 HydrophobicContact CG1-CD1 4.08Å; V57-L68 HydrophobicContact CG2-CD1 3.81Å; V57-Q71 HydrophobicContact CG1-CB 4.09Å; V57-Q71 HydrophobicContact CG1-CG 4.35Å; V57-I72 HydrophobicContact CG2-CD1 3.67Å; V57-I72 HydrophobicContact CG2-CG1 4.42Å
58	D	94.7	Very high	93.4	Very high	28 Å²	28	57.1 Å²	57.1	15%	0.15	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	123.7	172.2	-74	-18.2	0	0	0	109.3	H32 I33 A35 A36 I42 I43 T44	H32-D58 IonicContact CD2-OD2 2.75Å; H32-D58 IonicContact CE1-OD2 2.63Å; H32-D58 PolarHBondContact CE1-OD2 2.9Å; H32-D58 VanDerWaalsContact NE2-CG 3.32Å; H32-D58 IonicContact NE2-OD1 3.26Å; H32-D58 IonicContact NE2-OD2 3.23Å; H32-D58 PolarHBondContact NE2-OD2 3.1Å; I33-D58 PolarHBondContact O-N 3.01Å; A35-D58 CarbonylContact C-O 3.5Å; A35-D58 VanDerWaalsContact CA-O 3.22Å; A35-D58 WeakPolarHBondContact CA-O 3.49Å; A35-D58 WeakPolarHBondContact CB-O 3.2Å; A35-D58 PolarHBondContact N-O 2.86Å; A36-D58 HydrophobicContact CB-CB 4.21Å; A36-D58 PolarHBondContact N-O 2.63Å; I42-D58 HydrophobicContact CG2-CB 3.76Å; I43-D58 WeakPolarHBondContact O-CA 3.24Å; T44-D58 WeakPolarHBondContact CA-OD1 3.47Å; T44-D58 VanDerWaalsContact CB-OD1 3.24Å; T44-D58 WeakPolarHBondContact CB-OD1 3.36Å; T44-D58 VanDerWaalsContact CG2-OD1 3.23Å; T44-D58 WeakPolarHBondContact CG2-OD1 3.42Å; T44-D58 PolarHBondContact OG1-OD1 2.87Å
59	L	94.4	Very high	93.5	Very high	4 Å²	4	53.9 Å²	53.9	2%	0.021	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.3	157.9	-177.5	-71.9	166.2	0	0	0	111.1	A35 I42 I43 V57 K61 A63 L68 Q71 I104	A35-L59 HydrophobicContact CB-CD2 3.72Å; I42-L59 CarbonylContact C-O 3.58Å; I42-L59 VanDerWaalsContact CA-O 3.28Å; I42-L59 WeakPolarHBondContact CA-O 3.42Å; I42-L59 WeakPolarHBondContact CG2-O 3.31Å; I43-L59 HydrophobicContact CG1-CB 4.18Å; I43-L59 WeakPolarHBondContact CG1-O 3.36Å; I43-L59 PolarHBondContact N-O 3.02Å; I43-L59 PolarHBondContact O-N 2.82Å; V57-L59 HydrophobicContact CG1-CD1 4.19Å; V57-L59 HydrophobicContact CG1-CD2 4.24Å; V57-L59 HydrophobicContact CG1-CG 3.91Å; L59-K61 PolarHBondContact O-N 3.23Å; L59-A63 HydrophobicContact CB-CB 3.88Å; L59-A63 HydrophobicContact CD1-CB 4.45Å; L59-L68 HydrophobicContact CD1-CB 3.61Å; L59-L68 HydrophobicContact CD1-CD1 3.79Å; L59-L68 HydrophobicContact CD1-CG 4.27Å; L59-Q71 HydrophobicContact CD2-CG 4.37Å; L59-I104 HydrophobicContact CD1-CD1 3.96Å
60	P	94.6	Very high	93.6	Very high	38 Å²	38	56.3 Å²	56.3	25%	0.247	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-57.2	142.9	170.1	-21.9	34.1	0	0	0	110.8	A39 K62 A63	A39-P60 HydrophobicContact CB-CB 4.05Å; A39-P60 HydrophobicContact CB-CG 4.13Å; P60-K62 PolarHBondContact O-N 3.22Å; P60-A63 WeakPolarHBondContact O-CB 3.28Å; P60-A63 PolarHBondContact O-N 3.29Å
61	K	91.3	Very high	93.7	Very high	84 Å²	84	51.5 Å²	51.5	37%	0.365	27%	0.269	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.7	-19.5	-177	-177	169.5	-178.1	173.7	0	115.1	S41 I43 L59 K105	S41-K61 WeakPolarHBondContact O-CB 3.4Å; S41-K61 PolarHBondContact O-N 3.23Å; S41-K61 WeakPolarHBondContact OG-CD 3.46Å; I43-K61 HydrophobicContact CG2-CB 4.05Å; I43-K61 HydrophobicContact CG2-CG 3.93Å; L59-K61 PolarHBondContact O-N 3.23Å; K61-K105 HydrophobicContact CG-CD 4.05Å
62	K	91.1	Very high	93.9	Very high	193 Å²	193	46 Å²	46	84%	0.839	24%	0.24	S	C	*	.	T	Hydrogen-bonded Turn	trans	-94.4	-0.3	176.9	-64.1	-177.1	-178.8	178.2	0	113	P60	P60-K62 PolarHBondContact O-N 3.22Å
63	A	94.6	Very high	94.2	Very high	1 Å²	1	43.9 Å²	43.9	1%	0.008	21%	0.213	C	C	.	.			trans	-56.5	142.2	-177.3	0	0	0	0	0	111.8	L59 P60 E67 S103 I104	L59-A63 HydrophobicContact CB-CB 3.88Å; L59-A63 HydrophobicContact CD1-CB 4.45Å; P60-A63 WeakPolarHBondContact O-CB 3.28Å; P60-A63 PolarHBondContact O-N 3.29Å; A63-E67 WeakPolarHBondContact CA-OE1 3.43Å; A63-E67 HydrophobicContact CB-CB 4.46Å; A63-S103 VanDerWaalsContact O-CA 3.31Å; A63-S103 WeakPolarHBondContact O-CA 3.22Å; A63-I104 HydrophobicContact CB-CD1 4.47Å; A63-I104 PolarHBondContact O-N 3.02Å
64	K	96.4	Very high	94.3	Very high	109 Å²	109	50.4 Å²	50.4	47%	0.474	23%	0.233	S	C	.	.	B	Isolated β-bridge	trans	-81.1	161.1	175	-67.1	-178.3	179.7	177	0	111.5	Q66 E67 G100 K102	K64-Q66 PolarHBondContact O-N 2.81Å; K64-E67 PolarHBondContact N-OE1 3.34Å; K64-E67 PolarHBondContact O-N 3.08Å; K64-G100 WeakPolarHBondContact CB-O 3.48Å; K64-K102 WeakPolarHBondContact CA-O 3.31Å
65	G	95.2	Very high	94.2	Very high	1 Å²	1	52.8 Å²	52.8	1%	0.01	24%	0.243	C	C	.	.	H	α-helix	trans	-56.9	-34.5	174.1	0	0	0	0	0	112.4	E67 L68 F69 K102	G65-E67 PolarHBondContact O-N 3.45Å; G65-L68 PolarHBondContact O-N 3.41Å; G65-F69 PolarHBondContact O-N 2.87Å; G65-F69 VanDerWaalsContact O-N 3.1Å; G65-K102 PolarHBondContact N-O 2.88Å
66	Q	95.8	Very high	94.1	Very high	84 Å²	84	56 Å²	56	39%	0.393	26%	0.26	S	S	.	.	H	α-helix	trans	-62.1	-42.8	178.9	-166.4	63.8	45.4	0	0	112	K64 L68 F69 D70 G100	K64-Q66 PolarHBondContact O-N 2.81Å; Q66-L68 VanDerWaalsContact C-N 3.27Å; Q66-L68 PolarHBondContact O-N 3.23Å; Q66-F69 WeakPolarHBondContact O-CB 3.25Å; Q66-F69 PolarHBondContact O-N 3.04Å; Q66-D70 PolarHBondContact NE2-OD1 2.83Å; Q66-D70 PolarHBondContact O-N 3.38Å; Q66-G100 WeakPolarHBondContact CB-O 3.22Å; Q66-G100 PolarHBondContact N-O 3.19Å; Q66-G100 VanDerWaalsContact N-O 3.15Å
67	E	95.6	Very high	94	Very high	78 Å²	78	62 Å²	62	36%	0.364	29%	0.29	S	S	.	.	H	α-helix	trans	-60.9	-37.4	-179.9	-66.6	172.5	-118.7	0	0	111.9	A63 K64 G65 Q71	A63-E67 WeakPolarHBondContact CA-OE1 3.43Å; A63-E67 HydrophobicContact CB-CB 4.46Å; K64-E67 PolarHBondContact N-OE1 3.34Å; K64-E67 PolarHBondContact O-N 3.08Å; G65-E67 PolarHBondContact O-N 3.45Å; E67-Q71 VanDerWaalsContact O-CG 3.25Å; E67-Q71 WeakPolarHBondContact O-CG 3.41Å; E67-Q71 PolarHBondContact O-N 2.79Å
68	L	95.6	Very high	93.7	Very high	10 Å²	10	65.2 Å²	65.2	5%	0.052	31%	0.307	C	S	.	.	H	α-helix	trans	-66.7	-44.6	173.4	176.8	62.8	0	0	0	111.6	C45 V47 V57 L59 G65 Q66 Q71 I72 L86 L98 I104	C45-L68 HydrophobicContact CB-CD1 3.77Å; C45-L68 HydrophobicContact CB-CD2 3.86Å; C45-L68 HydrophobicContact CB-CG 4.49Å; V47-L68 HydrophobicContact CG2-CD1 4.07Å; V47-L68 HydrophobicContact CG2-CD2 4.2Å; V47-L68 HydrophobicContact CG2-CG 4.37Å; V57-L68 HydrophobicContact CB-CD1 3.7Å; V57-L68 HydrophobicContact CG1-CD1 4.08Å; V57-L68 HydrophobicContact CG2-CD1 3.81Å; L59-L68 HydrophobicContact CD1-CB 3.61Å; L59-L68 HydrophobicContact CD1-CD1 3.79Å; L59-L68 HydrophobicContact CD1-CG 4.27Å; G65-L68 PolarHBondContact O-N 3.41Å; Q66-L68 VanDerWaalsContact C-N 3.27Å; Q66-L68 PolarHBondContact O-N 3.23Å; L68-Q71 PolarHBondContact O-N 3.5Å; L68-I72 HydrophobicContact CD1-CG1 4.49Å; L68-I72 WeakPolarHBondContact O-CG1 3.14Å; L68-I72 PolarHBondContact O-N 2.98Å; L68-L86 HydrophobicContact CD2-CD1 3.91Å; L68-L86 HydrophobicContact CG-CD1 3.85Å; L68-L98 HydrophobicContact CD2-CD2 4.15Å; L68-I104 HydrophobicContact CB-CD1 3.79Å; L68-I104 HydrophobicContact CD2-CD1 4.17Å
69	F	95.4	Very high	93.3	Very high	23 Å²	23	71.6 Å²	71.6	10%	0.101	34%	0.34	C	S	.	.	H	α-helix	trans	-60.6	-48.2	179.4	-176.3	-105.7	0	0	0	111.3	G65 Q66 Q71 I72 M73 S81 F84 L86	G65-F69 PolarHBondContact O-N 2.87Å; G65-F69 VanDerWaalsContact O-N 3.1Å; Q66-F69 WeakPolarHBondContact O-CB 3.25Å; Q66-F69 PolarHBondContact O-N 3.04Å; F69-Q71 VanDerWaalsContact C-N 3.31Å; F69-Q71 PolarHBondContact O-N 2.88Å; F69-I72 PolarHBondContact O-N 3.19Å; F69-I72 VanDerWaalsContact O-N 3.08Å; F69-M73 HydrophobicContact CD1-CG 3.83Å; F69-M73 HydrophobicContact CD2-CE 4.3Å; F69-M73 HydrophobicContact CD2-CG 4.37Å; F69-M73 HydrophobicContact CE1-CG 3.52Å; F69-M73 HydrophobicContact CE1-SD 4.03Å; F69-M73 HydrophobicContact CE2-CE 3.81Å; F69-M73 HydrophobicContact CE2-CG 4.09Å; F69-M73 HydrophobicContact CE2-SD 3.87Å; F69-M73 HydrophobicContact CG-CG 4.28Å; F69-M73 HydrophobicContact CZ-CE 4.14Å; F69-M73 HydrophobicContact CZ-CG 3.67Å; F69-M73 HydrophobicContact CZ-SD 3.54Å; F69-M73 VanDerWaalsContact CZ-SD 3.54Å; F69-M73 WeakPolarHBondContact O-CG 2.97Å; F69-M73 PolarHBondContact O-N 3.1Å; F69-S81 WeakPolarHBondContact CZ-O 3.45Å; F69-F84 HydrophobicContact CE2-CB 4.15Å; F69-F84 HydrophobicContact CZ-CB 4.14Å; F69-F84 WeakPolarHBondContact CZ-O 3.42Å; F69-L86 HydrophobicContact CB-CD1 4.29Å; F69-L86 HydrophobicContact CD2-CD1 4.27Å; F69-L86 HydrophobicContact CD2-CG 4.04Å
70	D	94.8	Very high	93	Very high	79 Å²	79	77.3 Å²	77.3	42%	0.422	37%	0.367	S	S	.	.	H	α-helix	trans	-59.5	-41.3	-179.9	-62.2	-14.9	0	0	0	111.5	Q66 I72 M73 Y74	Q66-D70 PolarHBondContact NE2-OD1 2.83Å; Q66-D70 PolarHBondContact O-N 3.38Å; D70-I72 VanDerWaalsContact C-N 3.34Å; D70-I72 PolarHBondContact O-N 3.49Å; D70-M73 PolarHBondContact O-N 3.07Å; D70-Y74 VanDerWaalsContact O-CB 3.23Å; D70-Y74 WeakPolarHBondContact O-CB 3.42Å; D70-Y74 PolarHBondContact O-N 3.02Å
71	Q	94.6	Very high	92.7	Very high	66 Å²	66	77.2 Å²	77.2	31%	0.308	37%	0.367	S	S	.	.	H	α-helix	trans	-63.3	-38.4	176.3	-70.7	-62.8	-36.3	0	0	112.6	A35 V57 L59 E67 L68 F69 H75	A35-Q71 HydrophobicContact CB-CG 3.88Å; V57-Q71 HydrophobicContact CG1-CB 4.09Å; V57-Q71 HydrophobicContact CG1-CG 4.35Å; L59-Q71 HydrophobicContact CD2-CG 4.37Å; E67-Q71 VanDerWaalsContact O-CG 3.25Å; E67-Q71 WeakPolarHBondContact O-CG 3.41Å; E67-Q71 PolarHBondContact O-N 2.79Å; L68-Q71 PolarHBondContact O-N 3.5Å; F69-Q71 VanDerWaalsContact C-N 3.31Å; F69-Q71 PolarHBondContact O-N 2.88Å; Q71-H75 WeakPolarHBondContact O-CB 3.49Å; Q71-H75 PolarHBondContact O-N 2.89Å
72	I	94.3	Very high	92.6	Very high	2 Å²	2	80.6 Å²	80.6	1%	0.01	39%	0.389	C	S	.	.	H	α-helix	trans	-70.8	-44.4	176.6	-63.4	-65.6	0	0	0	110.7	V47 L49 V55 V57 L68 F69 D70 Y74 H75 L76	V47-I72 HydrophobicContact CB-CD1 4.04Å; V47-I72 HydrophobicContact CB-CG1 4.49Å; V47-I72 HydrophobicContact CG1-CD1 4.28Å; V47-I72 HydrophobicContact CG1-CG1 4.39Å; V47-I72 HydrophobicContact CG2-CD1 4.08Å; V47-I72 HydrophobicContact CG2-CG1 4.23Å; L49-I72 HydrophobicContact CD2-CG2 3.98Å; V55-I72 HydrophobicContact CB-CD1 4.05Å; V55-I72 HydrophobicContact CG1-CD1 3.84Å; V57-I72 HydrophobicContact CG2-CD1 3.67Å; V57-I72 HydrophobicContact CG2-CG1 4.42Å; L68-I72 HydrophobicContact CD1-CG1 4.49Å; L68-I72 WeakPolarHBondContact O-CG1 3.14Å; L68-I72 PolarHBondContact O-N 2.98Å; F69-I72 PolarHBondContact O-N 3.19Å; F69-I72 VanDerWaalsContact O-N 3.08Å; D70-I72 VanDerWaalsContact C-N 3.34Å; D70-I72 PolarHBondContact O-N 3.49Å; I72-Y74 VanDerWaalsContact C-N 3.33Å; I72-Y74 PolarHBondContact O-N 3.15Å; I72-H75 PolarHBondContact O-N 3.23Å; I72-L76 HydrophobicContact CG2-CD1 3.87Å; I72-L76 HydrophobicContact CG2-CG 4.44Å; I72-L76 WeakPolarHBondContact O-CG 3.17Å; I72-L76 PolarHBondContact O-N 3.38Å
73	M	93.9	Very high	92.7	Very high	19 Å²	19	80 Å²	80	9%	0.094	38%	0.383	C	S	.	.	H	α-helix	trans	-61.7	-42.9	177.7	-64.4	-58.1	93.3	0	0	111.4	F69 D70 L76 D77 L78 F84	F69-M73 HydrophobicContact CD1-CG 3.83Å; F69-M73 HydrophobicContact CD2-CE 4.3Å; F69-M73 HydrophobicContact CD2-CG 4.37Å; F69-M73 HydrophobicContact CE1-CG 3.52Å; F69-M73 HydrophobicContact CE1-SD 4.03Å; F69-M73 HydrophobicContact CE2-CE 3.81Å; F69-M73 HydrophobicContact CE2-CG 4.09Å; F69-M73 HydrophobicContact CE2-SD 3.87Å; F69-M73 HydrophobicContact CG-CG 4.28Å; F69-M73 HydrophobicContact CZ-CE 4.14Å; F69-M73 HydrophobicContact CZ-CG 3.67Å; F69-M73 HydrophobicContact CZ-SD 3.54Å; F69-M73 VanDerWaalsContact CZ-SD 3.54Å; F69-M73 WeakPolarHBondContact O-CG 2.97Å; F69-M73 PolarHBondContact O-N 3.1Å; D70-M73 PolarHBondContact O-N 3.07Å; M73-L76 HydrophobicContact CE-CD1 4.42Å; M73-L76 PolarHBondContact O-N 3.23Å; M73-D77 PolarHBondContact O-N 2.82Å; M73-L78 HydrophobicContact CE-CD1 4.08Å; M73-L78 PolarHBondContact O-N 3.17Å; M73-L78 HydrophobicContact SD-CB 4.4Å; M73-L78 HydrophobicContact SD-CD1 3.97Å; M73-F84 HydrophobicContact SD-CB 4.45Å
74	Y	92.9	Very high	92.6	Very high	191 Å²	191	84.4 Å²	84.4	75%	0.749	40%	0.402	S	S	*	.	H	α-helix	trans	-62.1	-42.6	175	-178.5	-100.3	0	0	0	112	D70 I72 L76 D77	D70-Y74 VanDerWaalsContact O-CB 3.23Å; D70-Y74 WeakPolarHBondContact O-CB 3.42Å; D70-Y74 PolarHBondContact O-N 3.02Å; I72-Y74 VanDerWaalsContact C-N 3.33Å; I72-Y74 PolarHBondContact O-N 3.15Å; Y74-L76 VanDerWaalsContact C-N 3.3Å; Y74-L76 PolarHBondContact O-N 2.85Å; Y74-D77 PolarHBondContact O-N 3.07Å
75	H	90.4	Very high	92.5	Very high	80 Å²	80	81 Å²	81	37%	0.37	40%	0.397	S	S	.	.	H	α-helix	trans	-63.9	-35.1	177.7	178.8	54.1	0	0	0	113	I33 Q71 I72	I33-H75 HydrophobicContact CD1-CB 3.74Å; Q71-H75 WeakPolarHBondContact O-CB 3.49Å; Q71-H75 PolarHBondContact O-N 2.89Å; I72-H75 PolarHBondContact O-N 3.23Å
76	L	91.5	Very high	92.5	Very high	68 Å²	68	82.2 Å²	82.2	36%	0.356	40%	0.403	S	S	.	.	H	α-helix	trans	-87.3	-5.1	-179.7	-63.8	176.1	0	0	0	113.7	L49 I72 M73 Y74 L78	L49-L76 HydrophobicContact CD1-CD1 4.46Å; L49-L76 HydrophobicContact CD1-CD2 3.82Å; L49-L76 HydrophobicContact CD2-CD1 4.14Å; I72-L76 HydrophobicContact CG2-CD1 3.87Å; I72-L76 HydrophobicContact CG2-CG 4.44Å; I72-L76 WeakPolarHBondContact O-CG 3.17Å; I72-L76 PolarHBondContact O-N 3.38Å; M73-L76 HydrophobicContact CE-CD1 4.42Å; M73-L76 PolarHBondContact O-N 3.23Å; Y74-L76 VanDerWaalsContact C-N 3.3Å; Y74-L76 PolarHBondContact O-N 2.85Å; L76-L78 HydrophobicContact CB-CD1 3.88Å; L76-L78 HydrophobicContact CB-CG 3.7Å; L76-L78 HydrophobicContact CD1-CD1 3.88Å; L76-L78 PolarHBondContact O-N 2.87Å
77	D	91.8	Very high	92.5	Very high	143 Å²	143	86.2 Å²	86.2	77%	0.765	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.8	42.1	-175.9	-160.7	32	0	0	0	112.7	M73 Y74	M73-D77 PolarHBondContact O-N 2.82Å; Y74-D77 PolarHBondContact O-N 3.07Å
78	L	88.8	Confident	92.3	Very high	68 Å²	68	84.3 Å²	84.3	36%	0.356	41%	0.405	S	S	.	.			trans	-87.2	125.2	-178.1	-67.4	175.2	0	0	0	111.4	M73 L76 F84	M73-L78 HydrophobicContact CE-CD1 4.08Å; M73-L78 PolarHBondContact O-N 3.17Å; M73-L78 HydrophobicContact SD-CB 4.4Å; M73-L78 HydrophobicContact SD-CD1 3.97Å; L76-L78 HydrophobicContact CB-CD1 3.88Å; L76-L78 HydrophobicContact CB-CG 3.7Å; L76-L78 HydrophobicContact CD1-CD1 3.88Å; L76-L78 PolarHBondContact O-N 2.87Å; L78-F84 HydrophobicContact CD1-CD2 4.48Å; L78-F84 HydrophobicContact CD1-CE2 4.39Å
79	I	85.5	Confident	92.1	Very high	162 Å²	162	88.5 Å²	88.5	83%	0.831	43%	0.426	S	S	*	.	S	Bend	trans	-81.1	-38.7	177	-60.2	172.8	0	0	0	111.1	S81	I79-S81 PolarHBondContact O-N 2.8Å
80	E	90.1	Very high	91.7	Very high	125 Å²	125	89.5 Å²	89.5	58%	0.584	43%	0.432	S	S	*	.			trans	-96.3	62.1	-175.1	-56.8	-172.4	153.1	0	0	112.2	D82 Y83 F84	E80-D82 PolarHBondContact O-N 2.67Å; E80-Y83 HydrophobicContact CB-CD2 3.79Å; E80-Y83 HydrophobicContact CB-CE2 4.02Å; E80-Y83 HydrophobicContact CG-CE2 4.47Å; E80-F84 VanDerWaalsContact O-CD2 3.31Å; E80-F84 WeakPolarHBondContact O-CD2 3.47Å; E80-F84 WeakPolarHBondContact O-CE2 3.45Å
81	S	87.9	Confident	91.2	Very high	36 Å²	36	91.2 Å²	91.2	25%	0.252	45%	0.45	S	S	.	.	G	3₁₀ helix	trans	-64.1	-23	-177.6	54.8	0	0	0	0	114.3	F69 I79 Y83 F84	F69-S81 WeakPolarHBondContact CZ-O 3.45Å; I79-S81 PolarHBondContact O-N 2.8Å; S81-Y83 PolarHBondContact O-N 2.75Å; S81-Y83 VanDerWaalsContact O-N 3.17Å; S81-F84 PolarHBondContact O-N 2.94Å; S81-F84 VanDerWaalsContact O-N 3.07Å
82	D	89.2	Confident	90.8	Very high	154 Å²	154	91.5 Å²	91.5	82%	0.824	46%	0.464	S	S	*	.	G	3₁₀ helix	trans	-69.2	-15.7	-171.7	-60.2	-20.6	0	0	0	113.9	E80	E80-D82 PolarHBondContact O-N 2.67Å
83	Y	92.4	Very high	90.4	Very high	181 Å²	181	97.9 Å²	97.9	71%	0.71	49%	0.494	S	S	*	.	G	3₁₀ helix	trans	-87	-10.7	175.7	-62.9	-69.8	0	0	0	113.6	E80 S81	E80-Y83 HydrophobicContact CB-CD2 3.79Å; E80-Y83 HydrophobicContact CB-CE2 4.02Å; E80-Y83 HydrophobicContact CG-CE2 4.47Å; S81-Y83 PolarHBondContact O-N 2.75Å; S81-Y83 VanDerWaalsContact O-N 3.17Å
84	F	93.5	Very high	90.2	Very high	94 Å²	94	100.5 Å²	100.5	41%	0.412	51%	0.511	S	S	.	.			trans	-110.1	158	-172.6	-60.4	-82	0	0	0	111.8	L50 F69 M73 L78 E80 S81	L50-F84 HydrophobicContact CD1-CE1 4.23Å; F69-F84 HydrophobicContact CE2-CB 4.15Å; F69-F84 HydrophobicContact CZ-CB 4.14Å; F69-F84 WeakPolarHBondContact CZ-O 3.42Å; M73-F84 HydrophobicContact SD-CB 4.45Å; L78-F84 HydrophobicContact CD1-CD2 4.48Å; L78-F84 HydrophobicContact CD1-CE2 4.39Å; E80-F84 VanDerWaalsContact O-CD2 3.31Å; E80-F84 WeakPolarHBondContact O-CD2 3.47Å; E80-F84 WeakPolarHBondContact O-CE2 3.45Å; S81-F84 PolarHBondContact O-N 2.94Å; S81-F84 VanDerWaalsContact O-N 3.07Å
85	G	93.8	Very high	90.2	Very high	36 Å²	36	93.7 Å²	93.7	37%	0.371	49%	0.494	S	S	.	.			trans	-157.8	164.1	172.3	0	0	0	0	0	110.7
86	L	95.4	Very high	90.3	Very high	28 Å²	28	93.4 Å²	93.4	15%	0.147	49%	0.492	C	S	.	.			trans	-98.6	140.7	174.6	-66.1	172.4	0	0	0	110.1	V47 L68 F69 L98	V47-L86 HydrophobicContact CG1-CD2 3.61Å; L68-L86 HydrophobicContact CD2-CD1 3.91Å; L68-L86 HydrophobicContact CG-CD1 3.85Å; F69-L86 HydrophobicContact CB-CD1 4.29Å; F69-L86 HydrophobicContact CD2-CD1 4.27Å; F69-L86 HydrophobicContact CD2-CG 4.04Å; L86-L98 HydrophobicContact CB-CB 4Å; L86-L98 HydrophobicContact CB-CD2 4.02Å; L86-L98 HydrophobicContact CD1-CD2 3.94Å; L86-L98 WeakPolarHBondContact O-CB 3.43Å; L86-L98 PolarHBondContact O-N 3.23Å
87	R	94.8	Very high	90.5	Very high	168 Å²	168	98.2 Å²	98.2	63%	0.634	51%	0.506	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118.7	150	170.4	-60	-174.4	-47.2	-178.4	6.4	110.3	H96 W97	R87-H96 CarbonylContact C-O 3.5Å; R87-H96 WeakPolarHBondContact CA-O 3.29Å; R87-H96 WeakPolarHBondContact CB-O 3.43Å; R87-W97 HydrophobicContact CG-CD2 3.64Å; R87-W97 HydrophobicContact CG-CE3 3.37Å; R87-W97 HydrophobicContact CG-CG 4.36Å; R87-W97 HydrophobicContact CG-CH2 3.92Å; R87-W97 HydrophobicContact CG-CZ2 4.15Å; R87-W97 HydrophobicContact CG-CZ3 3.51Å
88	F	92.8	Very high	90.7	Very high	37 Å²	37	92.8 Å²	92.8	16%	0.162	48%	0.477	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130	158.9	172.8	72	-83.9	0	0	0	110.3	D90 A95 H96 L98 Q107 V108	F88-D90 HydrophobicContact CE2-CB 4.43Å; F88-A95 WeakPolarHBondContact O-CA 3.4Å; F88-H96 HydrophobicContact CD1-CB 4.26Å; F88-H96 WeakPolarHBondContact CD1-O 3.46Å; F88-H96 HydrophobicContact CE1-CB 3.7Å; F88-H96 HydrophobicContact CE2-CB 4.35Å; F88-H96 HydrophobicContact CZ-CB 3.75Å; F88-H96 PolarHBondContact N-O 2.87Å; F88-H96 PolarHBondContact O-N 3.28Å; F88-L98 HydrophobicContact CD1-CD1 4.34Å; F88-Q107 HydrophobicContact CE1-CB 4.31Å; F88-Q107 WeakPolarHBondContact CE2-O 3.41Å; F88-Q107 HydrophobicContact CZ-CB 4.17Å; F88-V108 HydrophobicContact CB-CG2 4.18Å; F88-V108 HydrophobicContact CD1-CG2 4.13Å; F88-V108 HydrophobicContact CD2-CB 4.41Å; F88-V108 HydrophobicContact CD2-CG1 4.35Å; F88-V108 HydrophobicContact CD2-CG2 3.83Å; F88-V108 HydrophobicContact CE1-CG2 4.49Å; F88-V108 HydrophobicContact CE2-CG2 4.21Å; F88-V108 HydrophobicContact CG-CG2 3.78Å
89	M	90.3	Very high	91	Very high	98 Å²	98	91.8 Å²	91.8	48%	0.483	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.9	129.9	173.6	-58.5	-60.8	-79.7	0	0	108.7	Q93 V94 A95	M89-Q93 VanDerWaalsContact CE-C 3.43Å; M89-Q93 HydrophobicContact CE-CB 4.18Å; M89-Q93 WeakPolarHBondContact CE-O 3.44Å; M89-V94 WeakPolarHBondContact CA-O 3.09Å; M89-A95 HydrophobicContact SD-CB 3.68Å
90	D	87.1	Confident	91.4	Very high	45 Å²	45	85 Å²	85	24%	0.241	44%	0.441	C	S	.	.			trans	-79.6	-176.1	172.7	73.1	7.5	0	0	0	112.3	F88 A92 Q93 V94 H96	F88-D90 HydrophobicContact CE2-CB 4.43Å; D90-A92 PolarHBondContact O-N 3.28Å; D90-A92 VanDerWaalsContact OD1-C 3.3Å; D90-A92 VanDerWaalsContact OD1-CA 3.29Å; D90-A92 WeakPolarHBondContact OD1-CA 3.35Å; D90-A92 WeakPolarHBondContact OD1-CB 3.05Å; D90-A92 PolarHBondContact OD1-N 3.47Å; D90-Q93 PolarHBondContact O-N 3.15Å; D90-Q93 PolarHBondContact O-NE2 2.83Å; D90-Q93 PolarHBondContact OD1-N 2.77Å; D90-V94 PolarHBondContact N-O 2.85Å; D90-V94 PolarHBondContact OD1-N 2.96Å; D90-H96 IonicContact OD2-CD2 2.73Å; D90-H96 IonicContact OD2-CE1 3.5Å; D90-H96 IonicContact OD2-NE2 3.88Å; D90-H96 PolarHBondContact OD2-NE2 3.3Å
91	S	84.6	Confident	91.6	Very high	114 Å²	114	83.9 Å²	83.9	80%	0.797	44%	0.443	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.3	-23.1	177.1	54.2	0	0	0	0	113.8	Q93	S91-Q93 VanDerWaalsContact C-N 3.3Å
92	A	85.8	Confident	91.9	Very high	72 Å²	72	87.6 Å²	87.6	60%	0.595	46%	0.455	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.6	8.3	176.3	0	0	0	0	0	112.4	D90 V94	D90-A92 PolarHBondContact O-N 3.28Å; D90-A92 VanDerWaalsContact OD1-C 3.3Å; D90-A92 VanDerWaalsContact OD1-CA 3.29Å; D90-A92 WeakPolarHBondContact OD1-CA 3.35Å; D90-A92 WeakPolarHBondContact OD1-CB 3.05Å; D90-A92 PolarHBondContact OD1-N 3.47Å; A92-V94 HydrophobicContact CB-CG2 4.19Å; A92-V94 PolarHBondContact O-N 3.02Å
93	Q	86.1	Confident	92.1	Very high	137 Å²	137	81.3 Å²	81.3	64%	0.64	42%	0.423	S	S	*	.	S	Bend	trans	58.2	32.9	-174.6	-59.4	-65.4	-73.7	0	0	112.6	M89 D90 S91	M89-Q93 VanDerWaalsContact CE-C 3.43Å; M89-Q93 HydrophobicContact CE-CB 4.18Å; M89-Q93 WeakPolarHBondContact CE-O 3.44Å; D90-Q93 PolarHBondContact O-N 3.15Å; D90-Q93 PolarHBondContact O-NE2 2.83Å; D90-Q93 PolarHBondContact OD1-N 2.77Å; S91-Q93 VanDerWaalsContact C-N 3.3Å
94	V	90.1	Very high	92.2	Very high	73 Å²	73	73.2 Å²	73.2	44%	0.442	39%	0.392	S	S	.	.			trans	-95.3	133.9	170.5	-178.9	0	0	0	0	108.6	M89 D90 A92 H96	M89-V94 WeakPolarHBondContact CA-O 3.09Å; D90-V94 PolarHBondContact N-O 2.85Å; D90-V94 PolarHBondContact OD1-N 2.96Å; A92-V94 HydrophobicContact CB-CG2 4.19Å; A92-V94 PolarHBondContact O-N 3.02Å; V94-H96 PolarHBondContact O-CD2 3.34Å
95	A	91.3	Very high	92.1	Very high	48 Å²	48	74.3 Å²	74.3	40%	0.397	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.2	126.5	177.1	0	0	0	0	0	110.6	F88 M89	F88-A95 WeakPolarHBondContact O-CA 3.4Å; M89-A95 HydrophobicContact SD-CB 3.68Å
96	H	93.5	Very high	91.9	Very high	74 Å²	74	80.5 Å²	80.5	34%	0.343	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	146.2	175.8	-62.5	-82.5	0	0	0	110.5	R87 F88 D90 V94	R87-H96 CarbonylContact C-O 3.5Å; R87-H96 WeakPolarHBondContact CA-O 3.29Å; R87-H96 WeakPolarHBondContact CB-O 3.43Å; F88-H96 HydrophobicContact CD1-CB 4.26Å; F88-H96 WeakPolarHBondContact CD1-O 3.46Å; F88-H96 HydrophobicContact CE1-CB 3.7Å; F88-H96 HydrophobicContact CE2-CB 4.35Å; F88-H96 HydrophobicContact CZ-CB 3.75Å; F88-H96 PolarHBondContact N-O 2.87Å; F88-H96 PolarHBondContact O-N 3.28Å; D90-H96 IonicContact OD2-CD2 2.73Å; D90-H96 IonicContact OD2-CE1 3.5Å; D90-H96 IonicContact OD2-NE2 3.88Å; D90-H96 PolarHBondContact OD2-NE2 3.3Å; V94-H96 PolarHBondContact O-CD2 3.34Å
97	W	95.1	Very high	91.7	Very high	170 Å²	170	80.8 Å²	80.8	64%	0.644	41%	0.414	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-71.8	138.8	170.1	-69.1	103.7	0	0	0	110.4	R87 D99	R87-W97 HydrophobicContact CG-CD2 3.64Å; R87-W97 HydrophobicContact CG-CE3 3.37Å; R87-W97 HydrophobicContact CG-CG 4.36Å; R87-W97 HydrophobicContact CG-CH2 3.92Å; R87-W97 HydrophobicContact CG-CZ2 4.15Å; R87-W97 HydrophobicContact CG-CZ3 3.51Å; W97-D99 PolarHBondContact O-N 3.17Å
98	L	95.4	Very high	91.3	Very high	29 Å²	29	74.7 Å²	74.7	15%	0.152	40%	0.395	C	S	.	.	P	Polyproline II helix	trans	-73.5	121	172.7	-172.6	71.3	0	0	0	109.1	L68 L86 F88 G100 V108	L68-L98 HydrophobicContact CD2-CD2 4.15Å; L86-L98 HydrophobicContact CB-CB 4Å; L86-L98 HydrophobicContact CB-CD2 4.02Å; L86-L98 HydrophobicContact CD1-CD2 3.94Å; L86-L98 WeakPolarHBondContact O-CB 3.43Å; L86-L98 PolarHBondContact O-N 3.23Å; F88-L98 HydrophobicContact CD1-CD1 4.34Å; L98-G100 PolarHBondContact O-N 3.15Å; L98-V108 HydrophobicContact CD1-CG2 4.37Å
99	D	95.6	Very high	90.6	Very high	46 Å²	46	81.2 Å²	81.2	25%	0.246	42%	0.424	C	S	.	.	P	Polyproline II helix	trans	-78.2	119.2	175.2	-175.2	-25.7	0	0	0	109.8	W97 T101 K102 Q107	W97-D99 PolarHBondContact O-N 3.17Å; D99-T101 PolarHBondContact O-N 2.99Å; D99-T101 WeakPolarHBondContact OD1-CB 3.49Å; D99-T101 PolarHBondContact OD1-N 2.78Å; D99-T101 PolarHBondContact OD1-OG1 3.45Å; D99-K102 HydrophobicContact CB-CB 4.34Å; D99-K102 HydrophobicContact CB-CD 4.23Å; D99-K102 HydrophobicContact CB-CG 4.43Å; D99-K102 PolarHBondContact O-N 2.82Å; D99-K102 VanDerWaalsContact OD2-CD 3.31Å; D99-K102 WeakPolarHBondContact OD2-CD 3.47Å; D99-K102 VanDerWaalsContact OD2-CE 3.22Å; D99-K102 WeakPolarHBondContact OD2-CE 3.31Å; D99-K102 IonicContact OD2-NZ 3.76Å; D99-K102 PolarHBondContact OD2-NZ 3.47Å; D99-Q107 PolarHBondContact O-NE2 3.47Å
100	G	94.1	Very high	89.3	Confident	19 Å²	19	83.8 Å²	83.8	20%	0.196	44%	0.438	C	S	.	.	T	Hydrogen-bonded Turn	trans	-61.8	-26.6	179.4	0	0	0	0	0	113.8	K64 Q66 L98	K64-G100 WeakPolarHBondContact CB-O 3.48Å; Q66-G100 WeakPolarHBondContact CB-O 3.22Å; Q66-G100 PolarHBondContact N-O 3.19Å; Q66-G100 VanDerWaalsContact N-O 3.15Å; L98-G100 PolarHBondContact O-N 3.15Å
101	T	94.5	Very high	87.5	Confident	102 Å²	102	84 Å²	84	63%	0.626	45%	0.451	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.4	-21.8	-174.6	71.2	0	0	0	0	113.5	D99	D99-T101 PolarHBondContact O-N 2.99Å; D99-T101 WeakPolarHBondContact OD1-CB 3.49Å; D99-T101 PolarHBondContact OD1-N 2.78Å; D99-T101 PolarHBondContact OD1-OG1 3.45Å
102	K	94.8	Very high	85.3	Confident	115 Å²	115	83.3 Å²	83.3	50%	0.5	45%	0.446	S	S	.	.	S	Bend	trans	-100.4	148.8	-174.5	-68.9	175.5	-173.2	131.2	0	111.5	K64 G65 D99 I104 Q107	K64-K102 WeakPolarHBondContact CA-O 3.31Å; G65-K102 PolarHBondContact N-O 2.88Å; D99-K102 HydrophobicContact CB-CB 4.34Å; D99-K102 HydrophobicContact CB-CD 4.23Å; D99-K102 HydrophobicContact CB-CG 4.43Å; D99-K102 PolarHBondContact O-N 2.82Å; D99-K102 VanDerWaalsContact OD2-CD 3.31Å; D99-K102 WeakPolarHBondContact OD2-CD 3.47Å; D99-K102 VanDerWaalsContact OD2-CE 3.22Å; D99-K102 WeakPolarHBondContact OD2-CE 3.31Å; D99-K102 IonicContact OD2-NZ 3.76Å; D99-K102 PolarHBondContact OD2-NZ 3.47Å; K102-I104 PolarHBondContact O-N 3.1Å; K102-Q107 HydrophobicContact CB-CG 3.9Å; K102-Q107 HydrophobicContact CD-CG 4.42Å; K102-Q107 PolarHBondContact O-NE2 3.02Å; K102-Q107 VanDerWaalsContact O-NE2 3.08Å
103	S	93.9	Very high	83.2	Confident	22 Å²	22	85.5 Å²	85.5	15%	0.154	45%	0.454	C	S	.	.	B	Isolated β-bridge	trans	-62.1	135.4	173.8	61.7	0	0	0	0	111.1	A63 K105 K106	A63-S103 VanDerWaalsContact O-CA 3.31Å; A63-S103 WeakPolarHBondContact O-CA 3.22Å; S103-K105 VanDerWaalsContact C-N 3.28Å; S103-K105 PolarHBondContact O-N 3.01Å; S103-K106 PolarHBondContact O-N 3.24Å; S103-K106 WeakPolarHBondContact OG-CB 3.38Å; S103-K106 VanDerWaalsContact OG-CD 3.31Å; S103-K106 WeakPolarHBondContact OG-CD 3.31Å; S103-K106 WeakPolarHBondContact OG-CG 3.16Å
104	I	93.4	Very high	81.2	Confident	10 Å²	10	92.5 Å²	92.5	5%	0.051	48%	0.476	C	S	.	.	H	α-helix	trans	-54.6	-46.2	-176.7	-62.3	163.4	0	0	0	110.8	I43 L59 A63 L68 K102 K106 Q107 V108	I43-I104 HydrophobicContact CD1-CB 4.03Å; I43-I104 HydrophobicContact CD1-CD1 4.15Å; I43-I104 HydrophobicContact CD1-CG2 4.25Å; L59-I104 HydrophobicContact CD1-CD1 3.96Å; A63-I104 HydrophobicContact CB-CD1 4.47Å; A63-I104 PolarHBondContact O-N 3.02Å; L68-I104 HydrophobicContact CB-CD1 3.79Å; L68-I104 HydrophobicContact CD2-CD1 4.17Å; K102-I104 PolarHBondContact O-N 3.1Å; I104-K106 PolarHBondContact O-N 3.08Å; I104-K106 VanDerWaalsContact O-N 3.1Å; I104-Q107 PolarHBondContact O-N 2.8Å; I104-V108 HydrophobicContact CG2-CB 4.49Å; I104-V108 HydrophobicContact CG2-CG2 4.1Å; I104-V108 PolarHBondContact O-N 2.97Å
105	K	91.1	Very high	80.7	Confident	117 Å²	117	93.5 Å²	93.5	51%	0.509	48%	0.478	S	S	.	.	H	α-helix	trans	-56.4	-29.5	179.9	-169.1	-173.9	-178.7	-148.6	0	114.4	K61 S103	K61-K105 HydrophobicContact CG-CD 4.05Å; S103-K105 VanDerWaalsContact C-N 3.28Å; S103-K105 PolarHBondContact O-N 3.01Å
106	K	90.3	Very high	80.2	Confident	166 Å²	166	95.8 Å²	95.8	72%	0.722	48%	0.482	S	S	*	.	H	α-helix	trans	-79.5	-27.7	179.9	-76.4	-177.7	-177.1	-177.7	0	112.4	S103 I104	S103-K106 PolarHBondContact O-N 3.24Å; S103-K106 WeakPolarHBondContact OG-CB 3.38Å; S103-K106 VanDerWaalsContact OG-CD 3.31Å; S103-K106 WeakPolarHBondContact OG-CD 3.31Å; S103-K106 WeakPolarHBondContact OG-CG 3.16Å; I104-K106 PolarHBondContact O-N 3.08Å; I104-K106 VanDerWaalsContact O-N 3.1Å
107	Q	90.2	Very high	79.4	Confident	34 Å²	34	97.1 Å²	97.1	16%	0.159	49%	0.49	C	S	.	.	H	α-helix	trans	-91	-50.4	-176.4	-54.1	-175	66.9	0	0	110.5	F88 D99 K102 I104 K109	F88-Q107 HydrophobicContact CE1-CB 4.31Å; F88-Q107 WeakPolarHBondContact CE2-O 3.41Å; F88-Q107 HydrophobicContact CZ-CB 4.17Å; D99-Q107 PolarHBondContact O-NE2 3.47Å; K102-Q107 HydrophobicContact CB-CG 3.9Å; K102-Q107 HydrophobicContact CD-CG 4.42Å; K102-Q107 PolarHBondContact O-NE2 3.02Å; K102-Q107 VanDerWaalsContact O-NE2 3.08Å; I104-Q107 PolarHBondContact O-N 2.8Å; Q107-K109 PolarHBondContact O-N 3.41Å; Q107-K109 VanDerWaalsContact O-N 3.15Å
108	V	86.9	Confident	78.5	Confident	40 Å²	40	92.8 Å²	92.8	24%	0.242	48%	0.481	C	S	.	.	S	Bend	trans	-88.9	84.9	177.4	-168.5	0	0	0	0	107.3	F88 L98 I104 I110	F88-V108 HydrophobicContact CB-CG2 4.18Å; F88-V108 HydrophobicContact CD1-CG2 4.13Å; F88-V108 HydrophobicContact CD2-CB 4.41Å; F88-V108 HydrophobicContact CD2-CG1 4.35Å; F88-V108 HydrophobicContact CD2-CG2 3.83Å; F88-V108 HydrophobicContact CE1-CG2 4.49Å; F88-V108 HydrophobicContact CE2-CG2 4.21Å; F88-V108 HydrophobicContact CG-CG2 3.78Å; L98-V108 HydrophobicContact CD1-CG2 4.37Å; I104-V108 HydrophobicContact CG2-CB 4.49Å; I104-V108 HydrophobicContact CG2-CG2 4.1Å; I104-V108 PolarHBondContact O-N 2.97Å; V108-I110 VanDerWaalsContact C-N 3.3Å; V108-I110 HydrophobicContact CG1-CG1 4.47Å; V108-I110 PolarHBondContact O-N 3.25Å
109	K	78.1	Confident	77.4	Confident	175 Å²	175	96.8 Å²	96.8	76%	0.761	50%	0.502	S	S	*	.			trans	-67.7	98.1	167.5	-66.4	-178.9	-175.6	174.2	0	106.6	Q107 G111	Q107-K109 PolarHBondContact O-N 3.41Å; Q107-K109 VanDerWaalsContact O-N 3.15Å; K109-G111 PolarHBondContact O-N 2.73Å
110	I	63.7	Low	76.2	Confident	152 Å²	152	100.1 Å²	100.1	78%	0.779	52%	0.519	S	S	*	.			trans	-63.8	85.1	166.5	-59.1	163.6	0	0	0	105.7	V108	V108-I110 VanDerWaalsContact C-N 3.3Å; V108-I110 HydrophobicContact CG1-CG1 4.47Å; V108-I110 PolarHBondContact O-N 3.25Å
111	G	49.5	Very low	74.9	Confident	50 Å²	50	105.9 Å²	105.9	52%	0.515	54%	0.542	S	S	.	.			trans	-70.7	137.9	165.4	0	0	0	0	0	107.5	K109	K109-G111 PolarHBondContact O-N 2.73Å
112	S	37.1	Very low	73.4	Confident	98 Å²	98	106.2 Å²	106.2	69%	0.685	54%	0.535	S	S	*	.			trans	-51.8	128.9	163.4	-163.3	0	0	0	0	107.4	Y114	S112-Y114 PolarHBondContact O-N 2.63Å; S112-Y114 PolarHBondContact OG-O 2.85Å
113	P	43.6	Very low	71.7	Confident	119 Å²	119	105.5 Å²	105.5	77%	0.773	54%	0.538	S	S	*	.			trans	-71.9	81.1	167	31.3	-29.9	0	0	0	106.5
114	Y	42.2	Very low	69.6	Low	283 Å²	283	113.1 Å²	113.1	100%	1.11	57%	0.573	S	S	*	*			trans	62.1	0	-172.5	-55.3	-86.2	0	0	0	115.3	S112	S112-Y114 PolarHBondContact O-N 2.63Å; S112-Y114 PolarHBondContact OG-O 2.85Å

Retrieved 114 of 114 residues in 71 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).