A0A087WPD3_MOUSE Loading...

Pbx/knotted 1 homeobox 2

AlphaFold DB , UniProt , Accession A0A087WPD3, Species MOUSE (Mus musculus, Mouse), Gene Pknox2, Length 49 aa.

						>A0A087WPD3_MOUSE|A0A087WPD3|Pknox2
MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.5	Low	70.1	Confident	221 Å²	221	139.4 Å²	139.4	100%	1.089	82%	0.82	S	S	*	*				0	115.3	0	-71.4	-175.2	-82.6	0	107.4	Q3	M1-Q3 PolarHBondContact O-N 3.35Å
2	M	70.6	Confident	70.1	Confident	169 Å²	169	137.8 Å²	137.8	83%	0.833	81%	0.813	S	S	*	*			trans	-81.3	114.5	169.1	-72.4	-60	-172.8	0	107.1	H4	M2-H4 PolarHBondContact O-CD2 2.95Å; M2-H4 PolarHBondContact O-N 2.91Å; M2-H4 VanDerWaalsContact O-CD2 3.25Å
3	Q	71.8	Confident	70.7	Confident	175 Å²	175	141 Å²	141	82%	0.818	82%	0.818	S	S	*	*			trans	-70	100.6	175	-66.8	-78.7	-17.1	0	106.9	M1 A5	M1-Q3 PolarHBondContact O-N 3.35Å; Q3-A5 VanDerWaalsContact C-N 3.32Å; Q3-A5 PolarHBondContact O-N 3.33Å
4	H	62.2	Low	71.3	Confident	179 Å²	179	143 Å²	143	83%	0.829	82%	0.819	S	S	*	*			trans	-70.2	93.5	171	-64.8	-89.2	0	0	107.4	M2 S6	M2-H4 PolarHBondContact O-CD2 2.95Å; M2-H4 PolarHBondContact O-N 2.91Å; M2-H4 VanDerWaalsContact O-CD2 3.25Å; H4-S6 PolarHBondContact O-N 2.9Å
5	A	70.6	Confident	71.3	Confident	95 Å²	95	139.5 Å²	139.5	79%	0.785	82%	0.815	S	S	*	*	P	Polyproline II helix	trans	-62.7	126.8	170.7	0	0	0	0	108.3	Q3	Q3-A5 VanDerWaalsContact C-N 3.32Å; Q3-A5 PolarHBondContact O-N 3.33Å
6	S	68.4	Low	71.2	Confident	105 Å²	105	139.3 Å²	139.3	73%	0.734	82%	0.816	S	S	*	*	P	Polyproline II helix	trans	-62.7	134.5	175.1	61.3	0	0	0	109.1	H4 A8	H4-S6 PolarHBondContact O-N 2.9Å; S6-A8 PolarHBondContact O-N 2.74Å
7	P	68.5	Low	71	Confident	122 Å²	122	140.8 Å²	140.8	79%	0.792	81%	0.813	S	S	*	*	P	Polyproline II helix	trans	-58.7	137.5	174.9	23.4	-30.8	0	0	109.7
8	A	70.6	Confident	70.9	Confident	87 Å²	87	141.6 Å²	141.6	72%	0.719	81%	0.814	S	S	*	*	P	Polyproline II helix	trans	-60.4	147.7	177.8	0	0	0	0	110.4	S6 A10	S6-A8 PolarHBondContact O-N 2.74Å; A8-A10 PolarHBondContact O-N 2.88Å
9	P	71.7	Confident	71.3	Confident	121 Å²	121	140.1 Å²	140.1	79%	0.786	81%	0.807	S	S	*	*	P	Polyproline II helix	trans	-57.9	127	176	-20.1	30.6	0	0	110.5	L11	P9-L11 PolarHBondContact O-N 3.28Å
10	A	73.6	Confident	71.8	Confident	91 Å²	91	138.7 Å²	138.7	75%	0.752	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-69.8	124.2	171.8	0	0	0	0	109.1	A8 T12	A8-A10 PolarHBondContact O-N 2.88Å; A10-T12 PolarHBondContact O-N 3.22Å; A10-T12 VanDerWaalsContact O-N 3.11Å
11	L	77.4	Confident	72.2	Confident	168 Å²	168	137.6 Å²	137.6	88%	0.88	80%	0.801	S	S	*	*			trans	-71.8	103.6	175.6	-66	173.8	0	0	109.2	P9 M13	P9-L11 PolarHBondContact O-N 3.28Å; L11-M13 PolarHBondContact O-N 2.91Å
12	T	70.8	Confident	73	Confident	121 Å²	121	132.3 Å²	132.3	74%	0.742	78%	0.783	S	S	*	*			trans	-75.4	107.9	169.5	-57.2	0	0	0	108.9	A10 M14	A10-T12 PolarHBondContact O-N 3.22Å; A10-T12 VanDerWaalsContact O-N 3.11Å; T12-M14 PolarHBondContact O-N 3.14Å
13	M	77.9	Confident	73.6	Confident	179 Å²	179	130 Å²	130	88%	0.882	78%	0.781	S	S	*	*			trans	-70.1	111.6	173.4	-59.6	-133.9	77.8	0	109.1	L11 A15	L11-M13 PolarHBondContact O-N 2.91Å; M13-A15 PolarHBondContact O-N 3.16Å
14	M	78.1	Confident	74.2	Confident	169 Å²	169	132.6 Å²	132.6	83%	0.833	79%	0.785	S	S	*	*			trans	-80.4	113.5	176.5	-58.1	-102.9	-76	0	108.4	T12 T16	T12-M14 PolarHBondContact O-N 3.14Å; M14-T16 PolarHBondContact O-N 3.05Å
15	A	72.1	Confident	75	Confident	91 Å²	91	132.5 Å²	132.5	75%	0.752	79%	0.785	S	S	*	*			trans	-73.1	112.4	175.5	0	0	0	0	109.9	M13 Q17	M13-A15 PolarHBondContact O-N 3.16Å; A15-Q17 PolarHBondContact O-N 3.27Å; A15-Q17 VanDerWaalsContact O-N 3.16Å
16	T	69.1	Low	75.2	Confident	136 Å²	136	135.4 Å²	135.4	83%	0.834	79%	0.787	S	S	*	*			trans	-78.4	98	175	56.7	0	0	0	109.6	M14 N18	M14-T16 PolarHBondContact O-N 3.05Å; T16-N18 VanDerWaalsContact O-N 3.14Å; T16-N18 VanDerWaalsContact C-N 3.25Å; T16-N18 PolarHBondContact O-N 3.28Å
17	Q	68.3	Low	75.4	Confident	164 Å²	164	134.4 Å²	134.4	77%	0.766	78%	0.78	S	S	*	*			trans	-81.3	36.7	-177.2	-92.5	-93	81	0	114.1	A15 V19	A15-Q17 PolarHBondContact O-N 3.27Å; A15-Q17 VanDerWaalsContact O-N 3.16Å; Q17-V19 PolarHBondContact O-N 3.41Å
18	N	69.9	Low	75.5	Confident	155 Å²	155	134.2 Å²	134.2	83%	0.829	78%	0.779	S	S	*	*			trans	-82.6	23.1	-170.7	-148.1	80.7	0	0	115.3	T16	T16-N18 VanDerWaalsContact O-N 3.14Å; T16-N18 VanDerWaalsContact C-N 3.25Å; T16-N18 PolarHBondContact O-N 3.28Å
19	V	78.3	Confident	75.3	Confident	113 Å²	113	138.4 Å²	138.4	69%	0.685	78%	0.784	S	S	*	*	S	Bend	trans	-98.9	124.2	172.9	-75.6	0	0	0	109.2	Q17	Q17-V19 PolarHBondContact O-N 3.41Å
20	P	81	Confident	75.2	Confident	113 Å²	113	141.6 Å²	141.6	73%	0.734	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-61.3	143.7	174.9	26.1	-32.5	0	0	109.3
21	P	79.2	Confident	74.7	Confident	115 Å²	115	142.4 Å²	142.4	75%	0.747	79%	0.786	S	S	*	*	P	Polyproline II helix	trans	-58.4	147.7	175.6	25.3	-33.3	0	0	110.3
22	P	82.3	Confident	74.1	Confident	111 Å²	111	139.1 Å²	139.1	72%	0.721	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-60	149.1	176.3	26.1	-33.6	0	0	110.4
23	P	84.6	Confident	73.7	Confident	119 Å²	119	139.4 Å²	139.4	77%	0.773	78%	0.784	S	S	*	*	P	Polyproline II helix	trans	-61.3	140.6	177.2	26.2	-33.5	0	0	110.3	Q25	P23-Q25 PolarHBondContact O-N 3.38Å
24	Y	83.6	Confident	72.8	Confident	230 Å²	230	135 Å²	135	90%	0.902	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-61.5	125.7	169.3	-65.9	-73.5	0	0	108.9	D26	Y24-D26 PolarHBondContact O-N 3.2Å
25	Q	80.3	Confident	71.9	Confident	178 Å²	178	135.3 Å²	135.3	83%	0.832	78%	0.776	S	S	*	*			trans	-74.8	115.8	169.6	-62.7	-173.4	-74.2	0	108	P23 S27	P23-Q25 PolarHBondContact O-N 3.38Å; Q25-S27 PolarHBondContact O-N 3.43Å
26	D	74.1	Confident	71	Confident	155 Å²	155	136.1 Å²	136.1	83%	0.829	77%	0.774	S	S	*	*			trans	-69.3	86.2	163.4	-169.1	-100.7	0	0	107.2	Y24 P28	Y24-D26 PolarHBondContact O-N 3.2Å; D26-P28 WeakPolarHBondContact O-CD 3.36Å
27	S	72.4	Confident	70.2	Confident	85 Å²	85	135 Å²	135	59%	0.594	77%	0.769	S	S	*	*			trans	-77.7	119.2	167.5	-71.1	0	0	0	107.2	Q25 Q29	Q25-S27 PolarHBondContact O-N 3.43Å; S27-Q29 PolarHBondContact O-N 3.28Å
28	P	69.9	Low	69.5	Low	117 Å²	117	132.7 Å²	132.7	76%	0.76	77%	0.771	S	S	*	*			trans	-60.1	110	169.7	-18.8	31.1	0	0	107.9	D26 M30	D26-P28 WeakPolarHBondContact O-CD 3.36Å; P28-M30 VanDerWaalsContact C-N 3.34Å; P28-M30 PolarHBondContact O-N 3.11Å
29	Q	67.1	Low	68.6	Low	176 Å²	176	133.8 Å²	133.8	82%	0.822	77%	0.768	S	S	*	*			trans	-65	102.4	166.1	-65.8	-175.8	-57.5	0	105.8	S27 T31	S27-Q29 PolarHBondContact O-N 3.28Å; Q29-T31 PolarHBondContact O-N 3.25Å; Q29-T31 PolarHBondContact O-OG1 3.4Å
30	M	68.6	Low	67.3	Low	188 Å²	188	133.1 Å²	133.1	93%	0.926	78%	0.775	S	S	*	*			trans	-61.2	94.9	169.4	-159	170.9	-164.5	0	106.3	P28 A32	P28-M30 VanDerWaalsContact C-N 3.34Å; P28-M30 PolarHBondContact O-N 3.11Å; M30-A32 VanDerWaalsContact C-N 3.31Å; M30-A32 PolarHBondContact O-N 3.39Å
31	T	63.7	Low	66	Low	108 Å²	108	135.4 Å²	135.4	66%	0.663	78%	0.776	S	S	*	*			trans	-70.6	93.6	179.3	-59.7	0	0	0	106	Q29 T33	Q29-T31 PolarHBondContact O-N 3.25Å; Q29-T31 PolarHBondContact O-OG1 3.4Å; T31-T33 HydrophobicContact CG2-CG2 3.91Å; T31-T33 PolarHBondContact O-N 2.97Å
32	A	64.2	Low	64.8	Low	99 Å²	99	133.7 Å²	133.7	82%	0.818	77%	0.771	S	S	*	*			trans	-71.6	80.1	171.5	0	0	0	0	108.9	M30 A34	M30-A32 VanDerWaalsContact C-N 3.31Å; M30-A32 PolarHBondContact O-N 3.39Å; A32-A34 PolarHBondContact O-N 3.33Å
33	T	62.5	Low	63.6	Low	126 Å²	126	134.2 Å²	134.2	77%	0.773	77%	0.772	S	S	*	*			trans	-76.9	96.3	162.3	47.3	0	0	0	108.7	T31	T31-T33 HydrophobicContact CG2-CG2 3.91Å; T31-T33 PolarHBondContact O-N 2.97Å
34	A	60.3	Low	62.3	Low	87 Å²	87	136.2 Å²	136.2	72%	0.719	77%	0.771	S	S	*	*			trans	-143.3	87.3	152	0	0	0	0	108.3	A32 P36	A32-A34 PolarHBondContact O-N 3.33Å; A34-P36 WeakPolarHBondContact O-CD 3.1Å
35	Q	58.8	Low	61	Low	175 Å²	175	132.8 Å²	132.8	82%	0.818	77%	0.766	S	S	*	*			trans	-81.6	107.6	156.9	178.9	-174	-76.9	0	107.3
36	P	53.6	Low	60	Low	109 Å²	109	130 Å²	130	71%	0.708	77%	0.766	S	S	*	*			trans	-74.6	128.7	154	28	-28.6	0	0	108.3	A34	A34-P36 WeakPolarHBondContact O-CD 3.1Å
37	P	51.4	Low	58.9	Low	112 Å²	112	126.6 Å²	126.6	73%	0.727	76%	0.76	S	S	*	*			trans	-68.5	148.4	178.3	28	-32.7	0	0	111.9
38	S	53	Low	58.4	Low	115 Å²	115	128.6 Å²	128.6	80%	0.804	77%	0.771	S	S	*	*	S	Bend	trans	-37.2	134	172.8	-169.3	0	0	0	116.3
39	K	51.9	Low	57.4	Low	178 Å²	178	132.2 Å²	132.2	77%	0.774	80%	0.799	S	S	*	*			trans	65.2	100.5	147	-162.8	-179.5	-175.6	179.8	118.5
40	A	51.2	Low	57	Low	100 Å²	100	130 Å²	130	83%	0.826	80%	0.797	S	S	*	*			trans	-141.2	117.2	141.4	0	0	0	0	109.1	A42	A40-A42 PolarHBondContact O-N 3.25Å
41	Q	54.4	Low	56.3	Low	161 Å²	161	126.9 Å²	126.9	75%	0.752	79%	0.791	S	S	*	*			trans	-65.6	123.4	168.9	-64.3	169.4	12.9	0	107.6
42	A	53.2	Low	55.9	Low	78 Å²	78	128 Å²	128	65%	0.645	80%	0.798	S	S	*	*			trans	-118.5	85.2	165.3	0	0	0	0	107.4	A40 H44	A40-A42 PolarHBondContact O-N 3.25Å; A42-H44 PolarHBondContact O-N 3.07Å
43	V	56.8	Low	55.5	Low	122 Å²	122	129.7 Å²	129.7	74%	0.739	80%	0.797	S	S	*	*			trans	-64.9	110	164.8	-81.2	0	0	0	108.2
44	H	57.1	Low	55	Low	162 Å²	162	129.9 Å²	129.9	75%	0.75	80%	0.798	S	S	*	*			trans	-124.8	86.4	163.1	-70.6	-86.2	0	0	108.9	A42 S46	A42-H44 PolarHBondContact O-N 3.07Å; H44-S46 PolarHBondContact O-N 3.47Å
45	I	57.6	Low	54.7	Low	158 Å²	158	132.8 Å²	132.8	81%	0.81	80%	0.803	S	S	*	*	P	Polyproline II helix	trans	-50.3	122.6	154.1	48.1	112.2	0	0	108.9
46	S	57.9	Low	54.4	Low	118 Å²	118	129.8 Å²	129.8	83%	0.825	80%	0.802	S	S	*	*	P	Polyproline II helix	trans	-85.6	118.1	169.6	-61.6	0	0	0	108	H44	H44-S46 PolarHBondContact O-N 3.47Å
47	A	50.8	Low	54.4	Low	85 Å²	85	131.4 Å²	131.4	70%	0.702	81%	0.81	S	S	*	*	P	Polyproline II helix	trans	-80.8	129.7	168.9	0	0	0	0	109
48	P	62.8	Low	54.7	Low	126 Å²	126	133 Å²	133	82%	0.818	82%	0.816	S	S	*	*	P	Polyproline II helix	trans	-73	141.6	172.4	29.1	-31.3	0	0	110.7
49	S	49.5	Very low	54.8	Low	193 Å²	193	134.6 Å²	134.6	100%	1.35	82%	0.817	S	S	*	*			trans	-72.1	0	171.3	-52.2	0	0	0	112.2

Retrieved 49 of 49 residues in 21.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).