A0A087WPI9_MOUSE Loading...

Contactin 2

AlphaFold DB , UniProt , Accession A0A087WPI9, Species MOUSE (Mus musculus, Mouse), Gene Cntn2, Length 102 aa.

						>A0A087WPI9_MOUSE|A0A087WPI9|Cntn2
MGAPARKRASLLLLLLATMALVSSPGWSFSQGTPATFGPVFEEQPVGLLFPEESAEDQVTLACRARASPPATYRWKMNGTEMNLEPGSRHQLMGGNLVIMSP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.3	Very low	55.7	Low	248 Å²	248	120.5 Å²	120.5	100%	1.222	67%	0.671	S	S	*	*				0	119	0	-91.8	75.6	169.4	0	0	109.3
2	G	53.9	Low	56.3	Low	81 Å²	81	119.1 Å²	119.1	84%	0.835	66%	0.66	S	S	*	*			trans	153.4	60	175.7	0	0	0	0	0	113.9
3	A	52.7	Low	56.9	Low	80 Å²	80	119.2 Å²	119.2	66%	0.661	66%	0.658	S	S	*	*			trans	-73.5	151.6	174	0	0	0	0	0	110.9	A5	A3-A5 PolarHBondContact O-N 3.35Å
4	P	51	Low	57.4	Low	73 Å²	73	119 Å²	119	47%	0.474	66%	0.655	S	S	.	*			trans	-81.9	108.1	-151.5	31.8	-34.4	0	0	0	113	R6 K7	P4-R6 PolarHBondContact O-N 3.14Å; P4-K7 HydrophobicContact CG-CD 4.11Å; P4-K7 HydrophobicContact CG-CG 4.39Å; P4-K7 PolarHBondContact O-N 3.42Å
5	A	55.1	Low	57.8	Low	79 Å²	79	118.3 Å²	118.3	65%	0.653	65%	0.649	S	S	*	*	H	α-helix	trans	-60.3	-26.1	174.4	0	0	0	0	0	113.5	A3 K7 R8 A9	A3-A5 PolarHBondContact O-N 3.35Å; A5-K7 PolarHBondContact O-N 2.97Å; A5-R8 PolarHBondContact O-N 3.44Å; A5-A9 PolarHBondContact O-N 3.11Å; A5-A9 VanDerWaalsContact O-N 3.15Å
6	R	55.1	Low	57.9	Low	218 Å²	218	118.3 Å²	118.3	82%	0.823	65%	0.647	S	S	*	*	H	α-helix	trans	-68.7	-32.4	-176	-146.6	172.2	-174.6	178.8	1.2	113.8	P4 S10	P4-R6 PolarHBondContact O-N 3.14Å; R6-S10 PolarHBondContact O-N 3.44Å; R6-S10 PolarHBondContact O-OG 2.84Å
7	K	53.3	Low	58	Low	148 Å²	148	114.6 Å²	114.6	64%	0.643	64%	0.636	S	S	*	*	H	α-helix	trans	-79.6	-37.5	178.9	-66.7	-174.9	-179.9	-176.3	0	111.9	P4 A5 S10 L11	P4-K7 HydrophobicContact CG-CD 4.11Å; P4-K7 HydrophobicContact CG-CG 4.39Å; P4-K7 PolarHBondContact O-N 3.42Å; A5-K7 PolarHBondContact O-N 2.97Å; K7-S10 PolarHBondContact O-N 2.88Å; K7-L11 VanDerWaalsContact O-CD1 3.29Å; K7-L11 WeakPolarHBondContact O-CD1 3.45Å; K7-L11 PolarHBondContact O-N 2.67Å
8	R	55.7	Low	58.1	Low	180 Å²	180	112.8 Å²	112.8	68%	0.679	63%	0.628	S	S	*	*	H	α-helix	trans	-66.4	-42.3	177.1	-67.5	-177.6	177.6	-174.1	-1.9	111.7	A5 L11 L12	A5-R8 PolarHBondContact O-N 3.44Å; R8-L11 PolarHBondContact O-N 3.4Å; R8-L12 WeakPolarHBondContact O-CB 3.22Å; R8-L12 WeakPolarHBondContact O-CD1 3.11Å; R8-L12 VanDerWaalsContact O-CG 3.3Å; R8-L12 WeakPolarHBondContact O-CG 3.44Å; R8-L12 PolarHBondContact O-N 3.38Å
9	A	60.3	Low	58.1	Low	47 Å²	47	114.8 Å²	114.8	39%	0.388	64%	0.635	S	S	.	*	H	α-helix	trans	-63.1	-41.5	173.8	0	0	0	0	0	112	A5 L12 L13	A5-A9 PolarHBondContact O-N 3.11Å; A5-A9 VanDerWaalsContact O-N 3.15Å; A9-L12 PolarHBondContact O-N 3Å; A9-L13 WeakPolarHBondContact O-CB 3.36Å; A9-L13 WeakPolarHBondContact O-CD1 3.45Å; A9-L13 WeakPolarHBondContact O-CG 3.41Å; A9-L13 PolarHBondContact O-N 3Å
10	S	64.6	Low	57.9	Low	61 Å²	61	112.5 Å²	112.5	43%	0.427	63%	0.631	S	S	.	*	H	α-helix	trans	-66	-41.3	176.9	-61.5	0	0	0	0	112.8	R6 K7 L13 L14	R6-S10 PolarHBondContact O-N 3.44Å; R6-S10 PolarHBondContact O-OG 2.84Å; K7-S10 PolarHBondContact O-N 2.88Å; S10-L13 PolarHBondContact O-N 3.45Å; S10-L14 WeakPolarHBondContact O-CB 3.49Å; S10-L14 WeakPolarHBondContact O-CD1 3.41Å; S10-L14 VanDerWaalsContact O-CG 3.23Å; S10-L14 WeakPolarHBondContact O-CG 3.25Å; S10-L14 PolarHBondContact O-N 2.86Å
11	L	64.3	Low	57.7	Low	110 Å²	110	113.9 Å²	113.9	58%	0.576	64%	0.636	S	S	*	*	H	α-helix	trans	-65	-40.7	173.7	-96.6	104.8	0	0	0	112.2	K7 R8 L14 L15	K7-L11 VanDerWaalsContact O-CD1 3.29Å; K7-L11 WeakPolarHBondContact O-CD1 3.45Å; K7-L11 PolarHBondContact O-N 2.67Å; R8-L11 PolarHBondContact O-N 3.4Å; L11-L14 PolarHBondContact O-N 2.94Å; L11-L15 WeakPolarHBondContact O-CB 3.47Å; L11-L15 VanDerWaalsContact O-CG 3.24Å; L11-L15 WeakPolarHBondContact O-CG 3.43Å; L11-L15 PolarHBondContact O-N 2.86Å
12	L	63.9	Low	58.2	Low	104 Å²	104	108 Å²	108	55%	0.545	62%	0.615	S	S	.	*	H	α-helix	trans	-64.4	-41.9	175.6	-76.5	161	0	0	0	111.8	R8 A9 L15 L16	R8-L12 WeakPolarHBondContact O-CB 3.22Å; R8-L12 WeakPolarHBondContact O-CD1 3.11Å; R8-L12 VanDerWaalsContact O-CG 3.3Å; R8-L12 WeakPolarHBondContact O-CG 3.44Å; R8-L12 PolarHBondContact O-N 3.38Å; A9-L12 PolarHBondContact O-N 3Å; L12-L15 PolarHBondContact O-N 2.7Å; L12-L16 WeakPolarHBondContact O-CB 3.42Å; L12-L16 WeakPolarHBondContact O-CD1 3.21Å; L12-L16 VanDerWaalsContact O-CG 3.25Å; L12-L16 WeakPolarHBondContact O-CG 3.23Å; L12-L16 PolarHBondContact O-N 3.2Å
13	L	63.4	Low	58.4	Low	120 Å²	120	108.2 Å²	108.2	63%	0.628	60%	0.603	S	S	*	*	H	α-helix	trans	-62.7	-41.4	174.6	-80.7	155.6	0	0	0	112.1	A9 S10 A17	A9-L13 WeakPolarHBondContact O-CB 3.36Å; A9-L13 WeakPolarHBondContact O-CD1 3.45Å; A9-L13 WeakPolarHBondContact O-CG 3.41Å; A9-L13 PolarHBondContact O-N 3Å; S10-L13 PolarHBondContact O-N 3.45Å; L13-A17 WeakPolarHBondContact O-CB 3.49Å; L13-A17 PolarHBondContact O-N 2.82Å
14	L	64.1	Low	58.8	Low	117 Å²	117	108.9 Å²	108.9	61%	0.613	60%	0.603	S	S	*	*	H	α-helix	trans	-67.4	-42.1	176.5	-73.4	162.5	0	0	0	112	S10 L11 A17 T18	S10-L14 WeakPolarHBondContact O-CB 3.49Å; S10-L14 WeakPolarHBondContact O-CD1 3.41Å; S10-L14 VanDerWaalsContact O-CG 3.23Å; S10-L14 WeakPolarHBondContact O-CG 3.25Å; S10-L14 PolarHBondContact O-N 2.86Å; L11-L14 PolarHBondContact O-N 2.94Å; L14-A17 PolarHBondContact O-N 2.94Å; L14-T18 WeakPolarHBondContact O-CG2 3.31Å; L14-T18 PolarHBondContact O-N 3.39Å; L14-T18 PolarHBondContact O-OG1 3.19Å
15	L	62.8	Low	59.2	Low	108 Å²	108	111.8 Å²	111.8	57%	0.565	62%	0.622	S	S	*	*	H	α-helix	trans	-64.7	-41.6	177	-72	168.2	0	0	0	112.1	L11 L12 T18 M19	L11-L15 WeakPolarHBondContact O-CB 3.47Å; L11-L15 VanDerWaalsContact O-CG 3.24Å; L11-L15 WeakPolarHBondContact O-CG 3.43Å; L11-L15 PolarHBondContact O-N 2.86Å; L12-L15 PolarHBondContact O-N 2.7Å; L15-T18 WeakPolarHBondContact CA-OG1 3.35Å; L15-T18 PolarHBondContact O-N 3.43Å; L15-T18 PolarHBondContact O-OG1 3.28Å; L15-M19 PolarHBondContact O-N 2.79Å
16	L	59.9	Low	59.5	Low	119 Å²	119	110.5 Å²	110.5	62%	0.623	62%	0.616	S	S	*	*	H	α-helix	trans	-64.9	-39.1	174.7	-71	167.1	0	0	0	111.9	L12 T18 M19 A20	L12-L16 WeakPolarHBondContact O-CB 3.42Å; L12-L16 WeakPolarHBondContact O-CD1 3.21Å; L12-L16 VanDerWaalsContact O-CG 3.25Å; L12-L16 WeakPolarHBondContact O-CG 3.23Å; L12-L16 PolarHBondContact O-N 3.2Å; L16-T18 VanDerWaalsContact C-N 3.34Å; L16-T18 PolarHBondContact O-N 3.49Å; L16-M19 PolarHBondContact O-N 3.08Å; L16-A20 PolarHBondContact O-N 2.96Å
17	A	60.4	Low	59.6	Low	55 Å²	55	111.1 Å²	111.1	46%	0.455	62%	0.619	S	S	.	*	H	α-helix	trans	-64.7	-36	175.5	0	0	0	0	0	112.5	L13 L14 A20	L13-A17 WeakPolarHBondContact O-CB 3.49Å; L13-A17 PolarHBondContact O-N 2.82Å; L14-A17 PolarHBondContact O-N 2.94Å; A17-A20 PolarHBondContact O-N 2.83Å
18	T	59.1	Low	60.1	Low	82 Å²	82	109.2 Å²	109.2	50%	0.503	62%	0.624	S	S	.	*	H	α-helix	trans	-69.9	-30.7	175.5	55.1	0	0	0	0	113.4	L14 L15 L16 A20 L21	L14-T18 WeakPolarHBondContact O-CG2 3.31Å; L14-T18 PolarHBondContact O-N 3.39Å; L14-T18 PolarHBondContact O-OG1 3.19Å; L15-T18 WeakPolarHBondContact CA-OG1 3.35Å; L15-T18 PolarHBondContact O-N 3.43Å; L15-T18 PolarHBondContact O-OG1 3.28Å; L16-T18 VanDerWaalsContact C-N 3.34Å; L16-T18 PolarHBondContact O-N 3.49Å; T18-A20 VanDerWaalsContact C-N 3.31Å; T18-A20 PolarHBondContact O-N 3.48Å; T18-L21 PolarHBondContact O-N 3Å
19	M	57.7	Low	60.6	Low	151 Å²	151	108.8 Å²	108.8	74%	0.744	63%	0.628	S	S	*	*	H	α-helix	trans	-71.8	-26.9	179	-150.3	169.1	-143.6	0	0	112.5	L15 L16	L15-M19 PolarHBondContact O-N 2.79Å; L16-M19 PolarHBondContact O-N 3.08Å
20	A	55	Low	60.8	Low	69 Å²	69	112 Å²	112	57%	0.57	65%	0.648	S	S	*	*	H	α-helix	trans	-77.6	-17.3	174.7	0	0	0	0	0	114	L16 A17 T18 S23	L16-A20 PolarHBondContact O-N 2.96Å; A17-A20 PolarHBondContact O-N 2.83Å; T18-A20 VanDerWaalsContact C-N 3.31Å; T18-A20 PolarHBondContact O-N 3.48Å; A20-S23 PolarHBondContact O-OG 2.9Å
21	L	53.8	Low	60.7	Low	141 Å²	141	117.7 Å²	117.7	74%	0.738	67%	0.667	S	S	*	*	H	α-helix	trans	-82.7	-16.5	176.6	-85.5	149.1	0	0	0	113.1	T18	T18-L21 PolarHBondContact O-N 3Å
22	V	56.7	Low	60.8	Low	126 Å²	126	115.2 Å²	115.2	76%	0.764	67%	0.669	S	S	*	*	S	Bend	trans	-93.5	-5.9	-178.3	179.8	0	0	0	0	112.5	S24	V22-S24 PolarHBondContact O-N 2.88Å
23	S	56.6	Low	61.1	Low	84 Å²	84	116.6 Å²	116.6	59%	0.587	68%	0.682	S	S	*	*			trans	-89.8	74.6	169.8	60.5	0	0	0	0	110.1	A20 P25	A20-S23 PolarHBondContact O-OG 2.9Å; S23-P25 WeakPolarHBondContact O-CD 3.36Å
24	S	62	Low	61.5	Low	95 Å²	95	116 Å²	116	66%	0.664	68%	0.684	S	S	*	*			trans	-83.6	100.7	158	-55	0	0	0	0	107.5	V22 G26	V22-S24 PolarHBondContact O-N 2.88Å; S24-G26 PolarHBondContact O-N 2.93Å
25	P	59.3	Low	62.4	Low	133 Å²	133	113.9 Å²	113.9	86%	0.864	68%	0.684	S	S	*	*			trans	-76.1	56.2	160	35.5	-34.7	0	0	0	107.7	S23	S23-P25 WeakPolarHBondContact O-CD 3.36Å
26	G	61	Low	63.9	Low	53 Å²	53	114.4 Å²	114.4	55%	0.546	69%	0.692	S	S	.	*			trans	-116.2	24.5	-172.2	0	0	0	0	0	111.5	S24 S28	S24-G26 PolarHBondContact O-N 2.93Å; G26-S28 PolarHBondContact O-N 2.86Å
27	W	58	Low	65.6	Low	230 Å²	230	112.9 Å²	112.9	87%	0.871	68%	0.68	S	S	*	*			trans	-86.7	78.4	160.4	-69.3	2.1	0	0	0	106.8	F29	W27-F29 PolarHBondContact O-N 2.88Å
28	S	64.4	Low	67.3	Low	109 Å²	109	112.5 Å²	112.5	76%	0.762	68%	0.682	S	S	*	*			trans	-64.5	87.8	154.1	-64.9	0	0	0	0	105.9	G26 S30	G26-S28 PolarHBondContact O-N 2.86Å; S28-S30 PolarHBondContact O-N 3.31Å
29	F	65.1	Low	69.2	Low	171 Å²	171	112.9 Å²	112.9	75%	0.75	69%	0.686	S	S	*	*			trans	-55.8	102.3	153.6	-104.9	-98	0	0	0	104.3	W27 Q31	W27-F29 PolarHBondContact O-N 2.88Å; F29-Q31 PolarHBondContact O-N 3.09Å
30	S	63.8	Low	71.1	Confident	115 Å²	115	109.4 Å²	109.4	80%	0.804	67%	0.673	S	S	*	*			trans	-62	85	159.7	-56.6	0	0	0	0	105	S28 G32	S28-S30 PolarHBondContact O-N 3.31Å; S30-G32 PolarHBondContact O-N 2.81Å
31	Q	63.8	Low	73.1	Confident	179 Å²	179	111.9 Å²	111.9	84%	0.836	67%	0.671	S	S	*	*			trans	-70.4	85.7	171.9	-163.7	164.5	14.7	0	0	104.3	F29 T33	F29-Q31 PolarHBondContact O-N 3.09Å; Q31-T33 PolarHBondContact O-N 3.35Å
32	G	65.1	Low	75.2	Confident	59 Å²	59	108.9 Å²	108.9	61%	0.608	65%	0.653	S	S	*	*	P	Polyproline II helix	trans	-49.5	129.9	173.5	0	0	0	0	0	107.3	S30	S30-G32 PolarHBondContact O-N 2.81Å
33	T	71	Confident	77.2	Confident	133 Å²	133	106.9 Å²	106.9	82%	0.816	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-48.5	127.9	173.6	30.4	0	0	0	0	108.5	Q31 A35	Q31-T33 PolarHBondContact O-N 3.35Å; T33-A35 PolarHBondContact O-N 2.76Å; T33-A35 VanDerWaalsContact O-N 3.1Å
34	P	72.8	Confident	79.1	Confident	106 Å²	106	109 Å²	109	69%	0.688	64%	0.637	S	S	*	*	P	Polyproline II helix	trans	-51.2	123.7	177.1	-24.2	31.5	0	0	0	108.8	T36	P34-T36 PolarHBondContact O-N 3.31Å; P34-T36 VanDerWaalsContact O-N 3.08Å
35	A	82.1	Confident	80.8	Confident	73 Å²	73	107.5 Å²	107.5	60%	0.603	62%	0.624	S	S	*	*	P	Polyproline II helix	trans	-57.2	120.9	179.9	0	0	0	0	0	108.6	T33 F37 S68	T33-A35 PolarHBondContact O-N 2.76Å; T33-A35 VanDerWaalsContact O-N 3.1Å; A35-F37 WeakPolarHBondContact O-CD1 3.36Å; A35-S68 WeakPolarHBondContact O-CB 3.41Å; A35-S68 PolarHBondContact O-OG 3.42Å
36	T	94.8	Very high	82.6	Confident	119 Å²	119	106.4 Å²	106.4	73%	0.73	62%	0.615	S	S	*	*	P	Polyproline II helix	trans	-88.1	125.4	172.8	-53.5	0	0	0	0	107.9	P34 S68	P34-T36 PolarHBondContact O-N 3.31Å; P34-T36 VanDerWaalsContact O-N 3.08Å; T36-S68 WeakPolarHBondContact CA-O 3.47Å; T36-S68 VanDerWaalsContact CG2-O 3.27Å; T36-S68 WeakPolarHBondContact CG2-O 3.37Å
37	F	95.4	Very high	84.2	Confident	87 Å²	87	108 Å²	108	38%	0.382	63%	0.631	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-152.4	148.9	179.1	64.4	-84.5	0	0	0	110.3	A35 V40 R66 S68	A35-F37 WeakPolarHBondContact O-CD1 3.36Å; F37-V40 HydrophobicContact CD2-CG2 4.41Å; F37-R66 HydrophobicContact CE2-CB 3.93Å; F37-R66 WeakPolarHBondContact CE2-O 3.43Å; F37-R66 HydrophobicContact CZ-CB 4.16Å; F37-S68 PolarHBondContact N-O 2.83Å; F37-S68 VanDerWaalsContact N-O 3.09Å; F37-S68 PolarHBondContact O-N 2.72Å; F37-S68 VanDerWaalsContact O-N 3.09Å
38	G	96.8	Very high	85.8	Confident	48 Å²	48	100.9 Å²	100.9	50%	0.495	61%	0.609	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-69.7	169.6	179.8	0	0	0	0	0	113.1	V40	G38-V40 PolarHBondContact O-N 2.85Å
39	P	97.9	Very high	87.2	Confident	89 Å²	89	103.8 Å²	103.8	58%	0.578	62%	0.616	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-60	126.5	-179.9	-23.4	34.4	0	0	0	113.1	A65 R66 A67 A71	P39-A65 HydrophobicContact CB-CB 4.09Å; P39-R66 CarbonylContact C-O 3.38Å; P39-R66 WeakPolarHBondContact CA-O 3.07Å; P39-A67 HydrophobicContact CB-CB 4.31Å; P39-A67 HydrophobicContact CG-CB 4.1Å; P39-A71 HydrophobicContact CB-CB 4.17Å; P39-A71 HydrophobicContact CG-CB 4.03Å
40	V	97.5	Very high	88.6	Confident	79 Å²	79	98.9 Å²	98.9	48%	0.479	59%	0.594	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.7	120.1	172.4	-177.3	0	0	0	0	107.9	F37 G38 E42 A65 R66	F37-V40 HydrophobicContact CD2-CG2 4.41Å; G38-V40 PolarHBondContact O-N 2.85Å; V40-E42 PolarHBondContact O-N 3.26Å; V40-A65 CarbonylContact O-C 3.58Å; V40-A65 VanDerWaalsContact O-CA 3.22Å; V40-A65 WeakPolarHBondContact O-CA 3.45Å; V40-R66 PolarHBondContact N-O 3.31Å; V40-R66 PolarHBondContact O-N 3.31Å
41	F	97.8	Very high	90	Very high	120 Å²	120	96.4 Å²	96.4	53%	0.526	58%	0.575	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-62.3	128.1	177.7	-67.4	-69.7	0	0	0	110.9	Q44 A65	F41-Q44 HydrophobicContact CB-CG 3.79Å; F41-Q44 HydrophobicContact CD1-CG 4.29Å; F41-Q44 HydrophobicContact CG-CG 3.98Å; F41-A65 HydrophobicContact CD1-CB 4.25Å
42	E	97.4	Very high	91.1	Very high	78 Å²	78	97.2 Å²	97.2	36%	0.364	58%	0.579	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.4	-30.7	165.2	-67.8	-169.8	137.2	0	0	111.3	V40 R64 R66	V40-E42 PolarHBondContact O-N 3.26Å; E42-R64 PolarHBondContact N-O 2.88Å; E42-R64 IonicContact OE2-CZ 3.45Å; E42-R64 IonicContact OE2-NE 3.43Å; E42-R64 PolarHBondContact OE2-NE 2.85Å; E42-R64 IonicContact OE2-NH2 3.39Å; E42-R66 HydrophobicContact CG-CG 3.82Å; E42-R66 WeakPolarHBondContact OE1-CD 3.47Å; E42-R66 VanDerWaalsContact OE1-CG 3.25Å; E42-R66 WeakPolarHBondContact OE1-CG 3.01Å; E42-R66 IonicContact OE1-CZ 3.54Å; E42-R66 IonicContact OE1-NE 2.76Å; E42-R66 PolarHBondContact OE1-NE 3.17Å; E42-R66 VanDerWaalsContact OE1-NE 3.1Å; E42-R66 IonicContact OE1-NH1 3.1Å; E42-R66 PolarHBondContact OE1-NH1 3.29Å
43	E	98	Very high	92.3	Very high	85 Å²	85	102.3 Å²	102.3	40%	0.397	59%	0.587	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-140.2	131.3	179	-171.2	169.5	-170.3	0	0	108.7	A62 C63 R64	E43-A62 HydrophobicContact CG-CB 4.09Å; E43-A62 WeakPolarHBondContact OE1-CB 3.34Å; E43-C63 WeakPolarHBondContact O-CA 3.08Å; E43-R64 HydrophobicContact CB-CB 3.92Å; E43-R64 PolarHBondContact N-O 3.44Å; E43-R64 VanDerWaalsContact N-O 3.09Å; E43-R64 PolarHBondContact O-N 3.06Å
44	Q	97.9	Very high	93.2	Very high	129 Å²	129	97.5 Å²	97.5	60%	0.603	56%	0.559	S	S	*	*			trans	-118.2	150.6	-179	-66.4	-174.5	-111.9	0	0	109.5	F41 V46 A62	F41-Q44 HydrophobicContact CB-CG 3.79Å; F41-Q44 HydrophobicContact CD1-CG 4.29Å; F41-Q44 HydrophobicContact CG-CG 3.98Å; Q44-V46 PolarHBondContact O-N 3.1Å; Q44-A62 CarbonylContact C-O 3.49Å
45	P	97.4	Very high	94.2	Very high	63 Å²	63	97.4 Å²	97.4	41%	0.409	57%	0.567	S	S	.	*			trans	-60.1	134.2	173.3	20.3	-29.4	0	0	0	110.6	A62 W75	P45-A62 WeakPolarHBondContact CA-O 3.45Å; P45-A62 VanDerWaalsContact N-O 3.13Å; P45-W75 HydrophobicContact CB-CH2 3.74Å; P45-W75 HydrophobicContact CB-CZ3 3.9Å; P45-W75 HydrophobicContact CG-CH2 3.91Å; P45-W75 HydrophobicContact CG-CZ3 3.96Å
46	V	96.4	Very high	94.7	Very high	110 Å²	110	100.2 Å²	100.2	67%	0.667	57%	0.568	S	S	*	*			trans	-109.7	152.9	173.2	-64.9	0	0	0	0	109.9	Q44 L48	Q44-V46 PolarHBondContact O-N 3.1Å; V46-L48 PolarHBondContact O-N 2.68Å
47	G	94.8	Very high	94.6	Very high	85 Å²	85	99.1 Å²	99.1	88%	0.876	56%	0.557	S	S	*	*			trans	-63.9	131.2	170.5	0	0	0	0	0	110
48	L	92.5	Very high	94.6	Very high	81 Å²	81	99 Å²	99	42%	0.424	56%	0.558	S	S	.	*			trans	-136.2	156.6	176.2	62.9	83.5	0	0	0	109.6	V46 V59 L61	V46-L48 PolarHBondContact O-N 2.68Å; L48-V59 HydrophobicContact CD1-CG2 3.48Å; L48-V59 VanDerWaalsContact CD1-CG2 3.48Å; L48-V59 HydrophobicContact CD2-CG2 3.96Å; L48-V59 HydrophobicContact CG-CG2 4.41Å; L48-L61 HydrophobicContact CD2-CD2 3.67Å; L48-L61 HydrophobicContact CG-CD2 4.14Å
49	L	93.2	Very high	94.5	Very high	171 Å²	171	97.7 Å²	97.7	90%	0.895	54%	0.54	S	S	*	.			trans	-111.7	128.5	172.3	-63.7	175.3	0	0	0	107.8
50	F	93.4	Very high	94.4	Very high	67 Å²	67	96.3 Å²	96.3	29%	0.294	53%	0.531	S	S	.	.			trans	-98	118.4	175.5	-169.2	-92	0	0	0	109	E56 V59 P102	F50-E56 HydrophobicContact CE2-CB 4.28Å; F50-E56 HydrophobicContact CZ-CB 4.16Å; F50-E56 WeakPolarHBondContact CZ-O 3.25Å; F50-V59 HydrophobicContact CD2-CB 3.73Å; F50-V59 HydrophobicContact CD2-CG2 3.98Å; F50-V59 HydrophobicContact CE2-CB 4.1Å; F50-P102 HydrophobicContact CD1-CB 4.26Å; F50-P102 HydrophobicContact CD1-CG 3.58Å; F50-P102 HydrophobicContact CD2-CG 4.07Å; F50-P102 HydrophobicContact CE1-CG 3.48Å; F50-P102 VanDerWaalsContact CE1-CG 3.48Å; F50-P102 HydrophobicContact CE2-CG 3.97Å; F50-P102 HydrophobicContact CG-CB 4.42Å; F50-P102 HydrophobicContact CG-CG 3.88Å; F50-P102 HydrophobicContact CZ-CG 3.69Å
51	P	93.4	Very high	94.4	Very high	63 Å²	63	94.4 Å²	94.4	41%	0.409	52%	0.517	S	S	.	.			trans	-67.4	133.1	178.5	-17.9	31.1	0	0	0	111.4	E53 S54	P51-E53 PolarHBondContact O-N 3.09Å; P51-S54 WeakPolarHBondContact O-CB 3.22Å; P51-S54 PolarHBondContact O-N 3.09Å; P51-S54 VanDerWaalsContact O-N 3.11Å
52	E	88	Confident	94.4	Very high	196 Å²	196	89.9 Å²	89.9	92%	0.916	50%	0.502	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	-30.1	178.1	-68.5	-170.2	157.5	0	0	112	S54	E52-S54 VanDerWaalsContact C-N 3.27Å; E52-S54 PolarHBondContact O-N 3.08Å
53	E	90.3	Very high	94.5	Very high	167 Å²	167	86.7 Å²	86.7	78%	0.78	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.4	7.3	175.4	70.8	-84.4	-172.7	0	0	114.6	P51	P51-E53 PolarHBondContact O-N 3.09Å
54	S	90.1	Very high	94.5	Very high	31 Å²	31	88.8 Å²	88.8	22%	0.217	49%	0.492	C	S	.	.			trans	-63.3	140.7	177.4	176.9	0	0	0	0	111.2	P51 E52 E56	P51-S54 WeakPolarHBondContact O-CB 3.22Å; P51-S54 PolarHBondContact O-N 3.09Å; P51-S54 VanDerWaalsContact O-N 3.11Å; E52-S54 VanDerWaalsContact C-N 3.27Å; E52-S54 PolarHBondContact O-N 3.08Å; S54-E56 VanDerWaalsContact C-N 3.3Å; S54-E56 WeakPolarHBondContact OG-CB 2.94Å; S54-E56 PolarHBondContact OG-N 2.85Å; S54-E56 PolarHBondContact OG-OE2 3.1Å
55	A	92.2	Very high	94.5	Very high	105 Å²	105	83.2 Å²	83.2	87%	0.868	47%	0.468	S	S	*	.	S	Bend	trans	-81.2	-11.8	170.4	0	0	0	0	0	112.5
56	E	93.7	Very high	94.5	Very high	131 Å²	131	87.1 Å²	87.1	61%	0.612	48%	0.475	S	S	*	.			trans	-69.3	141.3	171.1	-83.2	76.8	-150.6	0	0	110.5	F50 S54	F50-E56 HydrophobicContact CE2-CB 4.28Å; F50-E56 HydrophobicContact CZ-CB 4.16Å; F50-E56 WeakPolarHBondContact CZ-O 3.25Å; S54-E56 VanDerWaalsContact C-N 3.3Å; S54-E56 WeakPolarHBondContact OG-CB 2.94Å; S54-E56 PolarHBondContact OG-N 2.85Å; S54-E56 PolarHBondContact OG-OE2 3.1Å
57	D	92.7	Very high	94.5	Very high	96 Å²	96	82.9 Å²	82.9	51%	0.513	45%	0.452	S	S	.	.	S	Bend	trans	-103.1	9.1	178.1	68.8	-24.6	0	0	0	112.3	S101	D57-S101 WeakPolarHBondContact O-CA 3.4Å; D57-S101 PolarHBondContact O-N 3.47Å
58	Q	94.3	Very high	94.6	Very high	86 Å²	86	80.4 Å²	80.4	40%	0.402	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152	154.4	-178.3	64.9	173.7	15.9	0	0	112.8	V98 I99 M100	Q58-V98 HydrophobicContact CB-CG1 4.36Å; Q58-I99 CarbonylContact C-O 3.59Å; Q58-I99 VanDerWaalsContact CA-O 3.25Å; Q58-I99 WeakPolarHBondContact CA-O 3.44Å; Q58-M100 HydrophobicContact CB-CE 4.18Å; Q58-M100 HydrophobicContact CB-SD 3.81Å
59	V	95.8	Very high	94.7	Very high	19 Å²	19	81.4 Å²	81.4	12%	0.115	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	142.2	170.8	65.3	0	0	0	0	110.5	L48 F50 V98 I99 P102	L48-V59 HydrophobicContact CD1-CG2 3.48Å; L48-V59 VanDerWaalsContact CD1-CG2 3.48Å; L48-V59 HydrophobicContact CD2-CG2 3.96Å; L48-V59 HydrophobicContact CG-CG2 4.41Å; F50-V59 HydrophobicContact CD2-CB 3.73Å; F50-V59 HydrophobicContact CD2-CG2 3.98Å; F50-V59 HydrophobicContact CE2-CB 4.1Å; V59-V98 WeakPolarHBondContact O-CA 3.27Å; V59-I99 HydrophobicContact CG1-CB 3.76Å; V59-I99 HydrophobicContact CG1-CD1 4.26Å; V59-I99 HydrophobicContact CG1-CG1 4.28Å; V59-I99 PolarHBondContact N-O 3.23Å; V59-I99 PolarHBondContact O-N 2.79Å; V59-P102 HydrophobicContact CB-CG 4.37Å; V59-P102 HydrophobicContact CG1-CB 3.87Å; V59-P102 HydrophobicContact CG1-CG 4.01Å
60	T	96.5	Very high	94.8	Very high	61 Å²	61	78.9 Å²	78.9	37%	0.374	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	124.1	-178.2	-60.4	0	0	0	0	110.7	N96 L97 V98	T60-N96 HydrophobicContact CG2-CB 3.8Å; T60-L97 WeakPolarHBondContact CA-O 3.29Å; T60-V98 HydrophobicContact CG2-CG2 4.39Å
61	L	97.5	Very high	95	Very high	39 Å²	39	76.8 Å²	76.8	20%	0.204	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	108.2	168.5	-64.2	168.2	0	0	0	108.3	L48 W75 N96 L97 I99	L48-L61 HydrophobicContact CD2-CD2 3.67Å; L48-L61 HydrophobicContact CG-CD2 4.14Å; L61-W75 HydrophobicContact CB-CH2 3.54Å; L61-W75 HydrophobicContact CB-CZ2 4.35Å; L61-W75 HydrophobicContact CB-CZ3 3.88Å; L61-W75 HydrophobicContact CD1-CZ3 4.16Å; L61-W75 WeakPolarHBondContact O-CH2 3.44Å; L61-W75 WeakPolarHBondContact O-CZ2 3.5Å; L61-N96 WeakPolarHBondContact O-CA 3.32Å; L61-L97 HydrophobicContact CB-CB 4.28Å; L61-L97 HydrophobicContact CD1-CD2 3.97Å; L61-L97 HydrophobicContact CD1-CG 4.49Å; L61-L97 PolarHBondContact N-O 2.74Å; L61-L97 PolarHBondContact O-N 3.36Å; L61-I99 HydrophobicContact CD1-CD1 4.31Å
62	A	97.9	Very high	95.1	Very high	24 Å²	24	80.2 Å²	80.2	20%	0.198	44%	0.441	C	S	.	.			trans	-74.4	140	-175.2	0	0	0	0	0	112.2	E43 Q44 P45 N96	E43-A62 HydrophobicContact CG-CB 4.09Å; E43-A62 WeakPolarHBondContact OE1-CB 3.34Å; Q44-A62 CarbonylContact C-O 3.49Å; P45-A62 WeakPolarHBondContact CA-O 3.45Å; P45-A62 VanDerWaalsContact N-O 3.13Å; A62-N96 VanDerWaalsContact CA-OD1 3.31Å; A62-N96 WeakPolarHBondContact CA-OD1 3.13Å
63	C	97.9	Very high	95.6	Very high	11 Å²	11	73.3 Å²	73.3	7%	0.074	41%	0.407	C	S	.	.			trans	-153.5	122.2	174	-177.4	0	0	0	0	110	E43 W75 G95 N96	E43-C63 WeakPolarHBondContact O-CA 3.08Å; C63-W75 HydrophobicContact CB-CH2 4.11Å; C63-W75 HydrophobicContact CB-CZ2 3.55Å; C63-G95 CarbonylContact O-C 3.55Å; C63-N96 PolarHBondContact N-OD1 2.86Å; C63-N96 PolarHBondContact O-OD1 3.25Å
64	R	98	Very high	95.9	Very high	129 Å²	129	74 Å²	74	49%	0.487	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.9	130.3	177.4	-169.4	169.6	72.3	-153.9	-12.6	110.4	E42 E43	E42-R64 PolarHBondContact N-O 2.88Å; E42-R64 IonicContact OE2-CZ 3.45Å; E42-R64 IonicContact OE2-NE 3.43Å; E42-R64 PolarHBondContact OE2-NE 2.85Å; E42-R64 IonicContact OE2-NH2 3.39Å; E43-R64 HydrophobicContact CB-CB 3.92Å; E43-R64 PolarHBondContact N-O 3.44Å; E43-R64 VanDerWaalsContact N-O 3.09Å; E43-R64 PolarHBondContact O-N 3.06Å
65	A	98.1	Very high	96.2	Very high	12 Å²	12	73.9 Å²	73.9	10%	0.099	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	131.4	172.9	0	0	0	0	0	110.7	P39 V40 F41 A71 Y73	P39-A65 HydrophobicContact CB-CB 4.09Å; V40-A65 CarbonylContact O-C 3.58Å; V40-A65 VanDerWaalsContact O-CA 3.22Å; V40-A65 WeakPolarHBondContact O-CA 3.45Å; F41-A65 HydrophobicContact CD1-CB 4.25Å; A65-A71 HydrophobicContact CB-CB 4.34Å; A65-Y73 HydrophobicContact CB-CE1 4.31Å; A65-Y73 PolarHBondContact N-OH 2.85Å; A65-Y73 PolarHBondContact O-OH 3.21Å
66	R	96.9	Very high	96.5	Very high	145 Å²	145	75.3 Å²	75.3	55%	0.547	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	133.4	165.5	-76.8	-169.8	-55.5	-140.3	12.1	109.3	F37 P39 V40 E42	F37-R66 HydrophobicContact CE2-CB 3.93Å; F37-R66 WeakPolarHBondContact CE2-O 3.43Å; F37-R66 HydrophobicContact CZ-CB 4.16Å; P39-R66 CarbonylContact C-O 3.38Å; P39-R66 WeakPolarHBondContact CA-O 3.07Å; V40-R66 PolarHBondContact N-O 3.31Å; V40-R66 PolarHBondContact O-N 3.31Å; E42-R66 HydrophobicContact CG-CG 3.82Å; E42-R66 WeakPolarHBondContact OE1-CD 3.47Å; E42-R66 VanDerWaalsContact OE1-CG 3.25Å; E42-R66 WeakPolarHBondContact OE1-CG 3.01Å; E42-R66 IonicContact OE1-CZ 3.54Å; E42-R66 IonicContact OE1-NE 2.76Å; E42-R66 PolarHBondContact OE1-NE 3.17Å; E42-R66 VanDerWaalsContact OE1-NE 3.1Å; E42-R66 IonicContact OE1-NH1 3.1Å; E42-R66 PolarHBondContact OE1-NH1 3.29Å
67	A	97.2	Very high	96.5	Very high	22 Å²	22	74.5 Å²	74.5	18%	0.182	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.6	157.4	172.4	0	0	0	0	0	109.5	P39 P69 A71	P39-A67 HydrophobicContact CB-CB 4.31Å; P39-A67 HydrophobicContact CG-CB 4.1Å; A67-P69 CarbonylContact C-O 3.14Å; A67-P69 WeakPolarHBondContact CB-O 3.42Å; A67-A71 HydrophobicContact CB-CB 3.89Å
68	S	96.4	Very high	96.7	Very high	33 Å²	33	77.3 Å²	77.3	23%	0.231	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.7	108	170.3	175.9	0	0	0	0	108	A35 T36 F37	A35-S68 WeakPolarHBondContact O-CB 3.41Å; A35-S68 PolarHBondContact O-OG 3.42Å; T36-S68 WeakPolarHBondContact CA-O 3.47Å; T36-S68 VanDerWaalsContact CG2-O 3.27Å; T36-S68 WeakPolarHBondContact CG2-O 3.37Å; F37-S68 PolarHBondContact N-O 2.83Å; F37-S68 VanDerWaalsContact N-O 3.09Å; F37-S68 PolarHBondContact O-N 2.72Å; F37-S68 VanDerWaalsContact O-N 3.09Å
69	P	95.8	Very high	96.8	Very high	101 Å²	101	75.9 Å²	75.9	66%	0.656	41%	0.405	S	S	*	.	S	Bend	cis	-64.5	169.6	-0.5	-20.4	33.9	0	0	0	114.9	A67	A67-P69 CarbonylContact C-O 3.14Å; A67-P69 WeakPolarHBondContact CB-O 3.42Å
70	P	95.6	Very high	96.8	Very high	119 Å²	119	79.8 Å²	79.8	77%	0.773	43%	0.429	S	S	*	.	P	Polyproline II helix	trans	-53.9	141	-178.7	-26.7	35.3	0	0	0	113.9
71	A	96.8	Very high	96.8	Very high	22 Å²	22	81.9 Å²	81.9	18%	0.182	44%	0.435	C	S	.	.	P	Polyproline II helix	trans	-71.9	151.1	-178.6	0	0	0	0	0	112.3	P39 A65 A67 Y73	P39-A71 HydrophobicContact CB-CB 4.17Å; P39-A71 HydrophobicContact CG-CB 4.03Å; A65-A71 HydrophobicContact CB-CB 4.34Å; A67-A71 HydrophobicContact CB-CB 3.89Å; A71-Y73 HydrophobicContact CB-CE2 4.23Å
72	T	96.4	Very high	96.7	Very high	136 Å²	136	81.6 Å²	81.6	83%	0.834	43%	0.433	S	S	*	.	P	Polyproline II helix	trans	-101.8	148.8	165.8	57.3	0	0	0	0	109.8
73	Y	96.8	Very high	96.3	Very high	51 Å²	51	85.5 Å²	85.5	20%	0.2	45%	0.45	C	S	.	.			trans	-119.8	143.1	-172.2	-64.1	-98.1	0	0	0	110.7	A65 A71 G95	A65-Y73 HydrophobicContact CB-CE1 4.31Å; A65-Y73 PolarHBondContact N-OH 2.85Å; A65-Y73 PolarHBondContact O-OH 3.21Å; A71-Y73 HydrophobicContact CB-CE2 4.23Å; Y73-G95 VanDerWaalsContact CD1-CA 3.43Å
74	R	96.6	Very high	96.1	Very high	181 Å²	181	86.9 Å²	86.9	68%	0.683	46%	0.457	S	S	*	.			trans	-142.9	143.6	174.5	-67.6	-173.2	-78.2	171.5	-3.3	108.7	E81	R74-E81 WeakPolarHBondContact CD-OE1 3.24Å; R74-E81 IonicContact NH1-OE1 2.68Å; R74-E81 PolarHBondContact NH1-OE1 2.93Å; R74-E81 IonicContact NH1-OE2 3.1Å; R74-E81 PolarHBondContact NH1-OE2 3.43Å
75	W	97.6	Very high	95.7	Very high	28 Å²	28	86.3 Å²	86.3	11%	0.106	46%	0.459	C	S	.	.			trans	-113.5	146.6	178.4	-74.7	83.1	0	0	0	110.9	P45 L61 C63 M82 L84 G95 L97	P45-W75 HydrophobicContact CB-CH2 3.74Å; P45-W75 HydrophobicContact CB-CZ3 3.9Å; P45-W75 HydrophobicContact CG-CH2 3.91Å; P45-W75 HydrophobicContact CG-CZ3 3.96Å; L61-W75 HydrophobicContact CB-CH2 3.54Å; L61-W75 HydrophobicContact CB-CZ2 4.35Å; L61-W75 HydrophobicContact CB-CZ3 3.88Å; L61-W75 HydrophobicContact CD1-CZ3 4.16Å; L61-W75 WeakPolarHBondContact O-CH2 3.44Å; L61-W75 WeakPolarHBondContact O-CZ2 3.5Å; C63-W75 HydrophobicContact CB-CH2 4.11Å; C63-W75 HydrophobicContact CB-CZ2 3.55Å; W75-M82 HydrophobicContact CB-SD 3.91Å; W75-M82 PolarHBondContact O-N 3.47Å; W75-L84 HydrophobicContact CB-CD1 4.41Å; W75-G95 WeakPolarHBondContact CZ2-O 3.32Å; W75-G95 PolarHBondContact NE1-O 3.45Å; W75-L97 HydrophobicContact CB-CD2 4.21Å; W75-L97 HydrophobicContact CD2-CB 3.48Å; W75-L97 VanDerWaalsContact CD2-CB 3.48Å; W75-L97 HydrophobicContact CD2-CD2 3.84Å; W75-L97 HydrophobicContact CD2-CG 4.26Å; W75-L97 HydrophobicContact CE3-CB 3.91Å; W75-L97 HydrophobicContact CE3-CD2 3.69Å; W75-L97 HydrophobicContact CE3-CG 4.47Å; W75-L97 HydrophobicContact CG-CB 3.86Å; W75-L97 HydrophobicContact CG-CD2 4.06Å; W75-L97 HydrophobicContact CG-CG 4.43Å; W75-L97 HydrophobicContact CH2-CB 4.08Å; W75-L97 HydrophobicContact CZ2-CB 3.69Å; W75-L97 HydrophobicContact CZ3-CB 4.19Å; W75-L97 HydrophobicContact CZ3-CD2 4.3Å
76	K	97.3	Very high	95.2	Very high	135 Å²	135	92.1 Å²	92.1	59%	0.587	50%	0.496	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125	138.8	174.8	-66.7	-176	171	-166	0	109.3	T80	K76-T80 CarbonylContact C-O 3.47Å; K76-T80 WeakPolarHBondContact CA-O 3.25Å; K76-T80 WeakPolarHBondContact CB-O 3.44Å
77	M	95.3	Very high	94.7	Very high	114 Å²	114	89.1 Å²	89.1	56%	0.562	51%	0.51	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.8	122.9	169.4	-171.7	177.9	-173.3	0	0	107.9	G79 T80 M82	M77-G79 PolarHBondContact O-N 3.48Å; M77-G79 VanDerWaalsContact O-N 3.14Å; M77-T80 PolarHBondContact N-O 3.5Å; M77-T80 PolarHBondContact O-N 3.32Å; M77-M82 HydrophobicContact CB-CG 3.95Å; M77-M82 HydrophobicContact CB-SD 3.97Å
78	N	95.8	Very high	94.4	Very high	155 Å²	155	89.8 Å²	89.8	83%	0.829	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	52	35.9	-177.9	-59.5	-27	0	0	0	113.7	T80	N78-T80 VanDerWaalsContact C-N 3.3Å; N78-T80 PolarHBondContact O-N 3.02Å
79	G	96.4	Very high	94.3	Very high	57 Å²	57	93.6 Å²	93.6	59%	0.588	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	85.7	-11.9	-178.9	0	0	0	0	0	115.4	M77	M77-G79 PolarHBondContact O-N 3.48Å; M77-G79 VanDerWaalsContact O-N 3.14Å
80	T	96.8	Very high	94.3	Very high	100 Å²	100	91 Å²	91	61%	0.613	50%	0.502	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.7	133.8	179.5	-55.6	0	0	0	0	110.9	K76 M77 N78 M82	K76-T80 CarbonylContact C-O 3.47Å; K76-T80 WeakPolarHBondContact CA-O 3.25Å; K76-T80 WeakPolarHBondContact CB-O 3.44Å; M77-T80 PolarHBondContact N-O 3.5Å; M77-T80 PolarHBondContact O-N 3.32Å; N78-T80 VanDerWaalsContact C-N 3.3Å; N78-T80 PolarHBondContact O-N 3.02Å; T80-M82 PolarHBondContact O-N 3.4Å
81	E	96.2	Very high	94.3	Very high	105 Å²	105	88.5 Å²	88.5	49%	0.491	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64	129.6	176.6	-167.8	162.3	166.9	0	0	111	R74	R74-E81 WeakPolarHBondContact CD-OE1 3.24Å; R74-E81 IonicContact NH1-OE1 2.68Å; R74-E81 PolarHBondContact NH1-OE1 2.93Å; R74-E81 IonicContact NH1-OE2 3.1Å; R74-E81 PolarHBondContact NH1-OE2 3.43Å
82	M	95.1	Very high	94.2	Very high	33 Å²	33	91 Å²	91	16%	0.163	49%	0.49	C	S	.	.	P	Polyproline II helix	trans	-83.5	136.5	-179.4	-63	176.9	72.1	0	0	110.1	W75 M77 T80 L84 H90 L97	W75-M82 HydrophobicContact CB-SD 3.91Å; W75-M82 PolarHBondContact O-N 3.47Å; M77-M82 HydrophobicContact CB-CG 3.95Å; M77-M82 HydrophobicContact CB-SD 3.97Å; T80-M82 PolarHBondContact O-N 3.4Å; M82-L84 HydrophobicContact CB-CD2 4.03Å; M82-L84 HydrophobicContact CB-CG 4.35Å; M82-L84 HydrophobicContact CE-CD2 4.31Å; M82-L84 PolarHBondContact O-N 3.32Å; M82-H90 HydrophobicContact CE-CB 4.04Å; M82-H90 VanDerWaalsContact CE-CD2 3.45Å; M82-H90 WeakPolarHBondContact CE-CD2 3.39Å; M82-L97 HydrophobicContact CE-CD1 4.29Å; M82-L97 HydrophobicContact CE-CD2 4.08Å; M82-L97 HydrophobicContact SD-CD2 3.87Å
83	N	90.4	Very high	94.1	Very high	106 Å²	106	89.1 Å²	89.1	57%	0.567	47%	0.473	S	S	*	.			trans	-85.3	110.2	169.4	-166.9	18.7	0	0	0	109.8	E85	N83-E85 PolarHBondContact ND2-OE1 2.99Å; N83-E85 PolarHBondContact O-N 3.02Å
84	L	93.6	Very high	94	Very high	41 Å²	41	90.3 Å²	90.3	22%	0.215	50%	0.501	C	S	.	.			trans	-102.8	55.5	-175.7	-56.7	178.5	0	0	0	110.5	W75 M82 H90 L92 L97	W75-L84 HydrophobicContact CB-CD1 4.41Å; M82-L84 HydrophobicContact CB-CD2 4.03Å; M82-L84 HydrophobicContact CB-CG 4.35Å; M82-L84 HydrophobicContact CE-CD2 4.31Å; M82-L84 PolarHBondContact O-N 3.32Å; L84-H90 HydrophobicContact CD2-CB 3.51Å; L84-L92 HydrophobicContact CD1-CB 3.75Å; L84-L92 HydrophobicContact CD1-CD1 4.31Å; L84-L92 HydrophobicContact CD1-CG 4.42Å; L84-L97 HydrophobicContact CD2-CD1 3.9Å
85	E	89.8	Confident	94	Very high	116 Å²	116	81.8 Å²	81.8	54%	0.542	47%	0.469	S	S	.	.			trans	-68.4	149.2	179.6	-82.4	173.4	-171.9	0	0	112.6	N83 G87 S88	N83-E85 PolarHBondContact ND2-OE1 2.99Å; N83-E85 PolarHBondContact O-N 3.02Å; E85-G87 PolarHBondContact O-N 3.39Å; E85-S88 VanDerWaalsContact O-CB 3.23Å; E85-S88 WeakPolarHBondContact O-CB 3.23Å; E85-S88 PolarHBondContact O-N 2.96Å; E85-S88 VanDerWaalsContact O-N 3.08Å
86	P	87.1	Confident	94	Very high	135 Å²	135	82.9 Å²	82.9	88%	0.877	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.3	129.8	170.2	-22.7	33.2	0	0	0	111.4
87	G	85	Confident	94	Very high	81 Å²	81	76.7 Å²	76.7	84%	0.835	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	88.6	-4.5	-178.4	0	0	0	0	0	115.1	E85	E85-G87 PolarHBondContact O-N 3.39Å
88	S	91.8	Very high	94	Very high	36 Å²	36	71.5 Å²	71.5	25%	0.252	43%	0.425	S	S	.	.	S	Bend	trans	-69.2	155.4	167	-179.8	0	0	0	0	111.3	E85 H90	E85-S88 VanDerWaalsContact O-CB 3.23Å; E85-S88 WeakPolarHBondContact O-CB 3.23Å; E85-S88 PolarHBondContact O-N 2.96Å; E85-S88 VanDerWaalsContact O-N 3.08Å; S88-H90 PolarHBondContact O-N 2.96Å; S88-H90 PolarHBondContact OG-N 2.94Å
89	R	93.8	Very high	94	Very high	114 Å²	114	65.5 Å²	65.5	43%	0.43	39%	0.393	S	S	.	.	S	Bend	trans	-67	-13.9	168.6	72.9	-178.5	-67.9	-158.4	-10.6	113.1	I99 M100 S101 P102	R89-I99 WeakPolarHBondContact O-CA 3.3Å; R89-M100 HydrophobicContact CB-CB 4.39Å; R89-M100 PolarHBondContact NE-O 3.46Å; R89-M100 PolarHBondContact NH2-O 3.37Å; R89-M100 PolarHBondContact O-N 3.5Å; R89-S101 PolarHBondContact NH2-O 3.22Å; R89-P102 VanDerWaalsContact NH2-C 3.33Å; R89-P102 PolarHBondContact NH2-OXT 3.26Å
90	H	95.6	Very high	93.9	Very high	46 Å²	46	64.9 Å²	64.9	21%	0.213	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	122.2	176.5	-52.4	96.5	0	0	0	109.4	M82 L84 S88 L97 V98	M82-H90 HydrophobicContact CE-CB 4.04Å; M82-H90 VanDerWaalsContact CE-CD2 3.45Å; M82-H90 WeakPolarHBondContact CE-CD2 3.39Å; L84-H90 HydrophobicContact CD2-CB 3.51Å; S88-H90 PolarHBondContact O-N 2.96Å; S88-H90 PolarHBondContact OG-N 2.94Å; H90-L97 HydrophobicContact CB-CD1 4.15Å; H90-V98 WeakPolarHBondContact CA-O 3.4Å
91	Q	95.3	Very high	93.6	Very high	66 Å²	66	64.4 Å²	64.4	31%	0.308	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	143.8	-175.3	-58.5	-177.9	22.1	0	0	111.4	M93 V98	Q91-M93 VanDerWaalsContact OE1-CE 3.23Å; Q91-V98 HydrophobicContact CB-CB 4.39Å; Q91-V98 PolarHBondContact N-O 3.15Å; Q91-V98 PolarHBondContact O-N 3.32Å
92	L	95.9	Very high	93.1	Very high	74 Å²	74	63.4 Å²	63.4	39%	0.387	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	115	174.1	-173.5	61.5	0	0	0	110.4	L84	L84-L92 HydrophobicContact CD1-CB 3.75Å; L84-L92 HydrophobicContact CD1-CD1 4.31Å; L84-L92 HydrophobicContact CD1-CG 4.42Å
93	M	94.8	Very high	93	Very high	98 Å²	98	65 Å²	65	48%	0.483	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.4	101.5	178.6	-64.6	-161.4	-175.9	0	0	111.2	Q91 G95 N96 V98	Q91-M93 VanDerWaalsContact OE1-CE 3.23Å; M93-G95 PolarHBondContact O-N 3.45Å; M93-N96 PolarHBondContact N-O 2.94Å; M93-N96 WeakPolarHBondContact O-CB 3.35Å; M93-N96 PolarHBondContact O-N 2.88Å; M93-V98 HydrophobicContact CB-CG2 4.24Å; M93-V98 HydrophobicContact CG-CG2 4.01Å; M93-V98 HydrophobicContact SD-CG2 4.06Å
94	G	93.4	Very high	93.1	Very high	76 Å²	76	62.8 Å²	62.8	78%	0.784	38%	0.38	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.4	19.7	175.6	0	0	0	0	0	114.9
95	G	96.8	Very high	93.1	Very high	2 Å²	2	64 Å²	64	2%	0.021	39%	0.389	C	S	.	.	T	Hydrogen-bonded Turn	trans	109.2	-25.4	-173.7	0	0	0	0	0	114	C63 Y73 W75 M93	C63-G95 CarbonylContact O-C 3.55Å; Y73-G95 VanDerWaalsContact CD1-CA 3.43Å; W75-G95 WeakPolarHBondContact CZ2-O 3.32Å; W75-G95 PolarHBondContact NE1-O 3.45Å; M93-G95 PolarHBondContact O-N 3.45Å
96	N	97.4	Very high	93.2	Very high	50 Å²	50	60.9 Å²	60.9	27%	0.267	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.7	141.1	178	-58.4	-23.3	0	0	0	111.3	T60 L61 A62 C63 M93	T60-N96 HydrophobicContact CG2-CB 3.8Å; L61-N96 WeakPolarHBondContact O-CA 3.32Å; A62-N96 VanDerWaalsContact CA-OD1 3.31Å; A62-N96 WeakPolarHBondContact CA-OD1 3.13Å; C63-N96 PolarHBondContact N-OD1 2.86Å; C63-N96 PolarHBondContact O-OD1 3.25Å; M93-N96 PolarHBondContact N-O 2.94Å; M93-N96 WeakPolarHBondContact O-CB 3.35Å; M93-N96 PolarHBondContact O-N 2.88Å
97	L	97.5	Very high	93.6	Very high	5 Å²	5	56.3 Å²	56.3	3%	0.026	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	117.5	168.3	170.7	62.3	0	0	0	108.8	T60 L61 W75 M82 L84 H90 I99	T60-L97 WeakPolarHBondContact CA-O 3.29Å; L61-L97 HydrophobicContact CB-CB 4.28Å; L61-L97 HydrophobicContact CD1-CD2 3.97Å; L61-L97 HydrophobicContact CD1-CG 4.49Å; L61-L97 PolarHBondContact N-O 2.74Å; L61-L97 PolarHBondContact O-N 3.36Å; W75-L97 HydrophobicContact CB-CD2 4.21Å; W75-L97 HydrophobicContact CD2-CB 3.48Å; W75-L97 VanDerWaalsContact CD2-CB 3.48Å; W75-L97 HydrophobicContact CD2-CD2 3.84Å; W75-L97 HydrophobicContact CD2-CG 4.26Å; W75-L97 HydrophobicContact CE3-CB 3.91Å; W75-L97 HydrophobicContact CE3-CD2 3.69Å; W75-L97 HydrophobicContact CE3-CG 4.47Å; W75-L97 HydrophobicContact CG-CB 3.86Å; W75-L97 HydrophobicContact CG-CD2 4.06Å; W75-L97 HydrophobicContact CG-CG 4.43Å; W75-L97 HydrophobicContact CH2-CB 4.08Å; W75-L97 HydrophobicContact CZ2-CB 3.69Å; W75-L97 HydrophobicContact CZ3-CB 4.19Å; W75-L97 HydrophobicContact CZ3-CD2 4.3Å; M82-L97 HydrophobicContact CE-CD1 4.29Å; M82-L97 HydrophobicContact CE-CD2 4.08Å; M82-L97 HydrophobicContact SD-CD2 3.87Å; L84-L97 HydrophobicContact CD2-CD1 3.9Å; H90-L97 HydrophobicContact CB-CD1 4.15Å; L97-I99 HydrophobicContact CD2-CD1 4.46Å; L97-I99 HydrophobicContact CD2-CG1 4.49Å; L97-I99 HydrophobicContact CG-CG1 4.11Å
98	V	96.3	Very high	94.2	Very high	5 Å²	5	54.7 Å²	54.7	3%	0.03	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	127.5	174	-175.3	0	0	0	0	108.3	Q58 V59 T60 H90 Q91 M93 M100	Q58-V98 HydrophobicContact CB-CG1 4.36Å; V59-V98 WeakPolarHBondContact O-CA 3.27Å; T60-V98 HydrophobicContact CG2-CG2 4.39Å; H90-V98 WeakPolarHBondContact CA-O 3.4Å; Q91-V98 HydrophobicContact CB-CB 4.39Å; Q91-V98 PolarHBondContact N-O 3.15Å; Q91-V98 PolarHBondContact O-N 3.32Å; M93-V98 HydrophobicContact CB-CG2 4.24Å; M93-V98 HydrophobicContact CG-CG2 4.01Å; M93-V98 HydrophobicContact SD-CG2 4.06Å; V98-M100 HydrophobicContact CG1-SD 4.01Å
99	I	95.5	Very high	94.4	Very high	30 Å²	30	56 Å²	56	15%	0.154	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	114.6	177.6	-49.5	178.8	0	0	0	107.5	Q58 V59 L61 R89 L97 P102	Q58-I99 CarbonylContact C-O 3.59Å; Q58-I99 VanDerWaalsContact CA-O 3.25Å; Q58-I99 WeakPolarHBondContact CA-O 3.44Å; V59-I99 HydrophobicContact CG1-CB 3.76Å; V59-I99 HydrophobicContact CG1-CD1 4.26Å; V59-I99 HydrophobicContact CG1-CG1 4.28Å; V59-I99 PolarHBondContact N-O 3.23Å; V59-I99 PolarHBondContact O-N 2.79Å; L61-I99 HydrophobicContact CD1-CD1 4.31Å; R89-I99 WeakPolarHBondContact O-CA 3.3Å; L97-I99 HydrophobicContact CD2-CD1 4.46Å; L97-I99 HydrophobicContact CD2-CG1 4.49Å; L97-I99 HydrophobicContact CG-CG1 4.11Å; I99-P102 HydrophobicContact CG2-CB 4.34Å
100	M	94.1	Very high	94.4	Very high	44 Å²	44	51.5 Å²	51.5	22%	0.217	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.8	141.9	176.4	-55.8	-59	-59.1	0	0	110.5	Q58 R89 V98	Q58-M100 HydrophobicContact CB-CE 4.18Å; Q58-M100 HydrophobicContact CB-SD 3.81Å; R89-M100 HydrophobicContact CB-CB 4.39Å; R89-M100 PolarHBondContact NE-O 3.46Å; R89-M100 PolarHBondContact NH2-O 3.37Å; R89-M100 PolarHBondContact O-N 3.5Å; V98-M100 HydrophobicContact CG1-SD 4.01Å
101	S	90.7	Very high	94.3	Very high	89 Å²	89	52 Å²	52	62%	0.622	32%	0.321	S	S	*	.			trans	42.1	57.1	-177.8	-49.6	0	0	0	0	111.7	D57 R89	D57-S101 WeakPolarHBondContact O-CA 3.4Å; D57-S101 PolarHBondContact O-N 3.47Å; R89-S101 PolarHBondContact NH2-O 3.22Å
102	P	84.1	Confident	94.2	Very high	85 Å²	85	50.7 Å²	50.7	55%	0.552	32%	0.322	S	S	*	.			trans	-49.3	0	-170.6	18.2	-30.7	0	0	0	113.7	F50 V59 R89 I99	F50-P102 HydrophobicContact CD1-CB 4.26Å; F50-P102 HydrophobicContact CD1-CG 3.58Å; F50-P102 HydrophobicContact CD2-CG 4.07Å; F50-P102 HydrophobicContact CE1-CG 3.48Å; F50-P102 VanDerWaalsContact CE1-CG 3.48Å; F50-P102 HydrophobicContact CE2-CG 3.97Å; F50-P102 HydrophobicContact CG-CB 4.42Å; F50-P102 HydrophobicContact CG-CG 3.88Å; F50-P102 HydrophobicContact CZ-CG 3.69Å; V59-P102 HydrophobicContact CB-CG 4.37Å; V59-P102 HydrophobicContact CG1-CB 3.87Å; V59-P102 HydrophobicContact CG1-CG 4.01Å; R89-P102 VanDerWaalsContact NH2-C 3.33Å; R89-P102 PolarHBondContact NH2-OXT 3.26Å; I99-P102 HydrophobicContact CG2-CB 4.34Å

Retrieved 102 of 102 residues in 30.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).