A0A087WPK5_MOUSE Loading...

Breast cancer 1, early onset

AlphaFold DB , UniProt , Accession A0A087WPK5, Species MOUSE (Mus musculus, Mouse), Gene Brca1, Length 75 aa.

						>A0A087WPK5_MOUSE|A0A087WPK5|Brca1
MDLSAVQIQEVQNVLHAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNEITKSYKWF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.5	Low	76.6	Confident	239 Å²	239	105.5 Å²	105.5	100%	1.177	56%	0.564	S	S	*	*				0	113.1	0	-70.6	179	-77.6	0	106.1	L3	M1-L3 PolarHBondContact O-N 3.16Å
2	D	65.8	Low	78.1	Confident	101 Å²	101	103.7 Å²	103.7	54%	0.54	55%	0.549	S	S	.	.			trans	-74.8	106.3	-171.8	-176.6	2.2	0	0	109.7	S4 A5 V6	D2-S4 PolarHBondContact O-N 2.82Å; D2-S4 WeakPolarHBondContact OD1-CB 3.46Å; D2-S4 PolarHBondContact OD1-N 3.32Å; D2-S4 PolarHBondContact OD1-OG 2.94Å; D2-S4 PolarHBondContact OD2-OG 2.89Å; D2-A5 HydrophobicContact CB-CB 4.05Å; D2-A5 WeakPolarHBondContact O-CB 3.19Å; D2-A5 PolarHBondContact O-N 3.14Å; D2-A5 VanDerWaalsContact O-N 3.09Å; D2-V6 PolarHBondContact O-N 3.26Å
3	L	63	Low	79.3	Confident	128 Å²	128	102.6 Å²	102.6	67%	0.67	54%	0.544	S	S	*	.	H	α-helix	trans	-57.8	-28.3	179.3	-165.9	72	0	0	111.3	M1 V6 Q7	M1-L3 PolarHBondContact O-N 3.16Å; L3-V6 PolarHBondContact O-N 3.31Å; L3-Q7 WeakPolarHBondContact O-CG 3.39Å; L3-Q7 PolarHBondContact O-N 3.05Å
4	S	71.3	Confident	80.3	Confident	52 Å²	52	101.6 Å²	101.6	36%	0.364	54%	0.543	S	S	.	.	H	α-helix	trans	-71.6	-35.1	177.8	77.3	0	0	0	112.4	D2 V6 Q7 I8	D2-S4 PolarHBondContact O-N 2.82Å; D2-S4 WeakPolarHBondContact OD1-CB 3.46Å; D2-S4 PolarHBondContact OD1-N 3.32Å; D2-S4 PolarHBondContact OD1-OG 2.94Å; D2-S4 PolarHBondContact OD2-OG 2.89Å; S4-V6 VanDerWaalsContact C-N 3.35Å; S4-V6 PolarHBondContact O-N 2.83Å; S4-Q7 PolarHBondContact O-N 2.92Å; S4-I8 VanDerWaalsContact O-CG1 3.29Å; S4-I8 WeakPolarHBondContact O-CG1 3.33Å; S4-I8 PolarHBondContact O-N 3.39Å
5	A	73.5	Confident	81.2	Confident	51 Å²	51	101.5 Å²	101.5	42%	0.421	54%	0.542	S	S	.	.	H	α-helix	trans	-67.2	-35.5	175.6	0	0	0	0	112.2	D2 Q9	D2-A5 HydrophobicContact CB-CB 4.05Å; D2-A5 WeakPolarHBondContact O-CB 3.19Å; D2-A5 PolarHBondContact O-N 3.14Å; D2-A5 VanDerWaalsContact O-N 3.09Å; A5-Q9 PolarHBondContact O-N 2.97Å; A5-Q9 VanDerWaalsContact O-N 3.12Å
6	V	73.4	Confident	81.9	Confident	79 Å²	79	102 Å²	102	48%	0.479	54%	0.54	S	S	.	.	H	α-helix	trans	-65.7	-44.8	175.4	179.5	0	0	0	110.8	D2 L3 S4 I8 Q9 E10	D2-V6 PolarHBondContact O-N 3.26Å; L3-V6 PolarHBondContact O-N 3.31Å; S4-V6 VanDerWaalsContact C-N 3.35Å; S4-V6 PolarHBondContact O-N 2.83Å; V6-I8 PolarHBondContact O-N 3.19Å; V6-Q9 PolarHBondContact O-N 3.01Å; V6-E10 PolarHBondContact O-N 3.1Å; V6-E10 VanDerWaalsContact O-N 3.13Å
7	Q	79.2	Confident	82.6	Confident	111 Å²	111	99.1 Å²	99.1	52%	0.519	53%	0.534	S	S	.	.	H	α-helix	trans	-63.9	-38.8	178.2	-71	172.8	-25.5	0	112.4	L3 S4 Q9 E10 V11	L3-Q7 WeakPolarHBondContact O-CG 3.39Å; L3-Q7 PolarHBondContact O-N 3.05Å; S4-Q7 PolarHBondContact O-N 2.92Å; Q7-Q9 VanDerWaalsContact C-N 3.35Å; Q7-E10 PolarHBondContact O-N 3.45Å; Q7-V11 WeakPolarHBondContact O-CG2 3.49Å; Q7-V11 PolarHBondContact O-N 3.42Å
8	I	88.6	Confident	83.2	Confident	97 Å²	97	99.5 Å²	99.5	50%	0.497	53%	0.533	S	S	.	.	H	α-helix	trans	-64.5	-40.6	175.5	-69.1	165.2	0	0	110.9	S4 V6 E10 V11 Q12	S4-I8 VanDerWaalsContact O-CG1 3.29Å; S4-I8 WeakPolarHBondContact O-CG1 3.33Å; S4-I8 PolarHBondContact O-N 3.39Å; V6-I8 PolarHBondContact O-N 3.19Å; I8-E10 PolarHBondContact O-N 3.19Å; I8-V11 PolarHBondContact O-N 2.75Å; I8-Q12 HydrophobicContact CG2-CG 4.43Å; I8-Q12 WeakPolarHBondContact O-CG 3.31Å; I8-Q12 PolarHBondContact O-N 3.49Å
9	Q	90.2	Very high	83.7	Confident	93 Å²	93	99.9 Å²	99.9	44%	0.435	53%	0.532	S	S	.	.	H	α-helix	trans	-64.7	-39.6	179.2	-172.1	61.6	65.2	0	112.3	A5 V6 Q7 Q12 N13	A5-Q9 PolarHBondContact O-N 2.97Å; A5-Q9 VanDerWaalsContact O-N 3.12Å; V6-Q9 PolarHBondContact O-N 3.01Å; Q7-Q9 VanDerWaalsContact C-N 3.35Å; Q9-Q12 PolarHBondContact O-N 2.93Å; Q9-N13 PolarHBondContact NE2-OD1 3.27Å; Q9-N13 PolarHBondContact O-N 3.29Å; Q9-N13 PolarHBondContact O-ND2 3.25Å; Q9-N13 PolarHBondContact O-OD1 3.18Å
10	E	91.4	Very high	84	Confident	121 Å²	121	102.4 Å²	102.4	57%	0.565	54%	0.538	S	S	*	.	H	α-helix	trans	-61.4	-46.6	176.2	-72.4	176	173.2	0	111.5	V6 Q7 I8 Q12 N13 V14	V6-E10 PolarHBondContact O-N 3.1Å; V6-E10 VanDerWaalsContact O-N 3.13Å; Q7-E10 PolarHBondContact O-N 3.45Å; I8-E10 PolarHBondContact O-N 3.19Å; E10-Q12 VanDerWaalsContact C-N 3.34Å; E10-Q12 PolarHBondContact O-N 3.47Å; E10-N13 PolarHBondContact O-N 2.79Å; E10-V14 WeakPolarHBondContact O-CG2 2.94Å; E10-V14 PolarHBondContact O-N 3.07Å
11	V	91.8	Very high	84.4	Confident	88 Å²	88	103.8 Å²	103.8	53%	0.533	54%	0.544	S	S	.	.	H	α-helix	trans	-60.5	-45.1	176.2	174.1	0	0	0	110.7	Q7 I8 N13 V14 L15	Q7-V11 WeakPolarHBondContact O-CG2 3.49Å; Q7-V11 PolarHBondContact O-N 3.42Å; I8-V11 PolarHBondContact O-N 2.75Å; V11-N13 VanDerWaalsContact C-N 3.32Å; V11-N13 PolarHBondContact O-N 3.44Å; V11-V14 PolarHBondContact O-N 3.04Å; V11-L15 HydrophobicContact CG1-CD1 3.99Å; V11-L15 HydrophobicContact CG1-CG 4.35Å; V11-L15 VanDerWaalsContact O-CG 3.3Å; V11-L15 WeakPolarHBondContact O-CG 3.44Å; V11-L15 PolarHBondContact O-N 3.4Å
12	Q	94.1	Very high	86.3	Confident	84 Å²	84	97 Å²	97	39%	0.393	51%	0.512	S	S	.	.	H	α-helix	trans	-59.5	-42.6	176.2	-74.4	176.5	-12.2	0	111.9	I8 Q9 E10 V14 L15 H16	I8-Q12 HydrophobicContact CG2-CG 4.43Å; I8-Q12 WeakPolarHBondContact O-CG 3.31Å; I8-Q12 PolarHBondContact O-N 3.49Å; Q9-Q12 PolarHBondContact O-N 2.93Å; E10-Q12 VanDerWaalsContact C-N 3.34Å; E10-Q12 PolarHBondContact O-N 3.47Å; Q12-V14 VanDerWaalsContact C-N 3.35Å; Q12-V14 PolarHBondContact O-N 3.08Å; Q12-L15 PolarHBondContact O-N 3.36Å; Q12-H16 PolarHBondContact O-N 3.28Å; Q12-H16 PolarHBondContact O-ND1 3.29Å
13	N	93.6	Very high	87.8	Confident	90 Å²	90	95 Å²	95	48%	0.481	50%	0.499	S	S	.	.	H	α-helix	trans	-63.4	-41.9	179.4	-68.2	-16.4	0	0	111.8	Q9 E10 V11 H16 A17	Q9-N13 PolarHBondContact NE2-OD1 3.27Å; Q9-N13 PolarHBondContact O-N 3.29Å; Q9-N13 PolarHBondContact O-ND2 3.25Å; Q9-N13 PolarHBondContact O-OD1 3.18Å; E10-N13 PolarHBondContact O-N 2.79Å; V11-N13 VanDerWaalsContact C-N 3.32Å; V11-N13 PolarHBondContact O-N 3.44Å; N13-H16 PolarHBondContact O-N 3Å; N13-A17 WeakPolarHBondContact O-CB 3.34Å; N13-A17 PolarHBondContact O-N 3.49Å
14	V	93.6	Very high	89.4	Confident	88 Å²	88	88.9 Å²	88.9	53%	0.533	47%	0.467	S	S	.	.	H	α-helix	trans	-62.7	-47	175.5	174	0	0	0	110.5	E10 V11 Q12 H16 A17 M18	E10-V14 WeakPolarHBondContact O-CG2 2.94Å; E10-V14 PolarHBondContact O-N 3.07Å; V11-V14 PolarHBondContact O-N 3.04Å; Q12-V14 VanDerWaalsContact C-N 3.35Å; Q12-V14 PolarHBondContact O-N 3.08Å; V14-H16 VanDerWaalsContact C-N 3.35Å; V14-H16 PolarHBondContact O-N 3.46Å; V14-A17 PolarHBondContact O-N 2.98Å; V14-M18 HydrophobicContact CG1-CG 4.38Å; V14-M18 HydrophobicContact CG1-SD 3.96Å; V14-M18 VanDerWaalsContact O-CG 3.28Å; V14-M18 WeakPolarHBondContact O-CG 3.42Å; V14-M18 PolarHBondContact O-N 3.44Å
15	L	93.8	Very high	90.5	Very high	101 Å²	101	88.7 Å²	88.7	53%	0.529	47%	0.465	S	S	.	.	H	α-helix	trans	-60.6	-42.4	178.2	-69.2	174.7	0	0	112.1	V11 Q12 M18 Q19	V11-L15 HydrophobicContact CG1-CD1 3.99Å; V11-L15 HydrophobicContact CG1-CG 4.35Å; V11-L15 VanDerWaalsContact O-CG 3.3Å; V11-L15 WeakPolarHBondContact O-CG 3.44Å; V11-L15 PolarHBondContact O-N 3.4Å; Q12-L15 PolarHBondContact O-N 3.36Å; L15-M18 PolarHBondContact O-N 2.95Å; L15-Q19 PolarHBondContact O-N 3.47Å
16	H	92.9	Very high	91.5	Very high	109 Å²	109	89.5 Å²	89.5	51%	0.505	46%	0.462	S	S	.	.	H	α-helix	trans	-64.7	-40.8	175.6	-76.4	95.5	0	0	112.3	Q12 N13 V14 M18 Q19 K20	Q12-H16 PolarHBondContact O-N 3.28Å; Q12-H16 PolarHBondContact O-ND1 3.29Å; N13-H16 PolarHBondContact O-N 3Å; V14-H16 VanDerWaalsContact C-N 3.35Å; V14-H16 PolarHBondContact O-N 3.46Å; H16-M18 VanDerWaalsContact C-N 3.33Å; H16-Q19 PolarHBondContact O-N 3.34Å; H16-K20 PolarHBondContact O-N 3.12Å; H16-K20 VanDerWaalsContact O-N 3.14Å
17	A	93.6	Very high	92.6	Very high	53 Å²	53	88.2 Å²	88.2	44%	0.438	46%	0.456	S	S	.	.	H	α-helix	trans	-63.4	-41.5	175.9	0	0	0	0	111.3	N13 V14 K20 I21	N13-A17 WeakPolarHBondContact O-CB 3.34Å; N13-A17 PolarHBondContact O-N 3.49Å; V14-A17 PolarHBondContact O-N 2.98Å; A17-K20 PolarHBondContact O-N 3.28Å; A17-I21 WeakPolarHBondContact O-CG1 3.48Å; A17-I21 PolarHBondContact O-N 3.04Å
18	M	92.6	Very high	93.3	Very high	106 Å²	106	88.8 Å²	88.8	52%	0.522	46%	0.462	S	S	.	.	H	α-helix	trans	-62.8	-43.5	175.2	-70.5	175.8	70.6	0	112.1	V14 L15 H16 K20 I21	V14-M18 HydrophobicContact CG1-CG 4.38Å; V14-M18 HydrophobicContact CG1-SD 3.96Å; V14-M18 VanDerWaalsContact O-CG 3.28Å; V14-M18 WeakPolarHBondContact O-CG 3.42Å; V14-M18 PolarHBondContact O-N 3.44Å; L15-M18 PolarHBondContact O-N 2.95Å; H16-M18 VanDerWaalsContact C-N 3.33Å; M18-K20 VanDerWaalsContact C-N 3.32Å; M18-K20 PolarHBondContact O-N 3.04Å; M18-I21 PolarHBondContact O-N 2.86Å
19	Q	92.8	Very high	93.7	Very high	107 Å²	107	90.1 Å²	90.1	50%	0.5	47%	0.466	S	S	.	.	H	α-helix	trans	-57.5	-45.6	177.1	-178.8	-176.4	-26.5	0	111.4	L15 H16 I21 L22 E23	L15-Q19 PolarHBondContact O-N 3.47Å; H16-Q19 PolarHBondContact O-N 3.34Å; Q19-I21 PolarHBondContact O-N 3.27Å; Q19-L22 WeakPolarHBondContact O-CB 3.31Å; Q19-L22 PolarHBondContact O-N 2.98Å; Q19-E23 PolarHBondContact O-N 3.38Å
20	K	91.3	Very high	94	Very high	150 Å²	150	90.7 Å²	90.7	65%	0.652	47%	0.471	S	S	*	.	H	α-helix	trans	-61.1	-30.2	179.4	-74.4	-172.8	176.9	-174.2	113.8	H16 A17 M18 L22 E23	H16-K20 PolarHBondContact O-N 3.12Å; H16-K20 VanDerWaalsContact O-N 3.14Å; A17-K20 PolarHBondContact O-N 3.28Å; M18-K20 VanDerWaalsContact C-N 3.32Å; M18-K20 PolarHBondContact O-N 3.04Å; K20-L22 PolarHBondContact O-N 3.2Å; K20-E23 PolarHBondContact O-N 3.47Å
21	I	92	Very high	94.2	Very high	132 Å²	132	86.6 Å²	86.6	68%	0.677	45%	0.453	S	S	*	.	H	α-helix	trans	-68.5	-24.4	177	-64.1	164.8	0	0	111.1	A17 M18 Q19	A17-I21 WeakPolarHBondContact O-CG1 3.48Å; A17-I21 PolarHBondContact O-N 3.04Å; M18-I21 PolarHBondContact O-N 2.86Å; Q19-I21 PolarHBondContact O-N 3.27Å
22	L	94.5	Very high	94.4	Very high	97 Å²	97	89.6 Å²	89.6	51%	0.508	46%	0.459	S	S	.	.	T	Hydrogen-bonded Turn	trans	-93	1.7	179.5	-56.3	176.8	0	0	113.1	Q19 K20 L30 I31	Q19-L22 WeakPolarHBondContact O-CB 3.31Å; Q19-L22 PolarHBondContact O-N 2.98Å; K20-L22 PolarHBondContact O-N 3.2Å; L22-L30 HydrophobicContact CB-CD1 3.6Å; L22-L30 HydrophobicContact CD1-CD1 4.41Å; L22-I31 WeakPolarHBondContact O-CD1 3.46Å; L22-I31 VanDerWaalsContact O-CG1 3.22Å; L22-I31 WeakPolarHBondContact O-CG1 3.41Å; L22-I31 PolarHBondContact O-N 3.16Å
23	E	96.3	Very high	94.4	Very high	57 Å²	57	91.4 Å²	91.4	27%	0.266	47%	0.467	S	S	.	.	B	Isolated β-bridge	trans	-87.6	138.7	177.9	-72.5	170.6	-171.8	0	111.1	Q19 K20 P25 E29	Q19-E23 PolarHBondContact O-N 3.38Å; K20-E23 PolarHBondContact O-N 3.47Å; E23-P25 WeakPolarHBondContact O-CD 3.46Å; E23-E29 CarbonylContact C-O 3.57Å; E23-E29 WeakPolarHBondContact CA-O 3.47Å
24	C	96.6	Very high	94.5	Very high	0 Å²	0	91.6 Å²	91.6	0%	0	47%	0.473	C	S	.	.			trans	-72.9	123.5	175.8	176.2	0	0	0	109.3	I26 C27 L28 E29 I31 C44	C24-I26 PolarHBondContact O-N 3.31Å; C24-C27 VanDerWaalsContact CB-SG 3.55Å; C24-C27 PolarHBondContact O-N 2.87Å; C24-L28 VanDerWaalsContact O-CA 3.32Å; C24-L28 WeakPolarHBondContact O-CA 3.47Å; C24-L28 PolarHBondContact O-N 3.35Å; C24-E29 WeakPolarHBondContact CB-O 3.35Å; C24-E29 PolarHBondContact N-O 3.38Å; C24-I31 HydrophobicContact CB-CG1 3.97Å; C24-C44 WeakPolarHBondContact CB-SG 3.22Å; C24-C44 PolarHBondContact SG-N 3.14Å; C24-C44 VanDerWaalsContact SG-SG 3.64Å
25	P	94.4	Very high	94.4	Very high	49 Å²	49	88.7 Å²	88.7	32%	0.318	46%	0.456	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.9	-10.9	-178.6	-18.5	27.3	0	0	114.9	E23 I42 F43 L63	E23-P25 WeakPolarHBondContact O-CD 3.46Å; P25-I42 WeakPolarHBondContact CD-O 3.46Å; P25-F43 HydrophobicContact CB-CD1 4.42Å; P25-F43 HydrophobicContact CB-CE1 3.98Å; P25-F43 HydrophobicContact CG-CD1 4.09Å; P25-F43 HydrophobicContact CG-CE1 3.78Å; P25-L63 HydrophobicContact CB-CD1 4.16Å; P25-L63 HydrophobicContact CB-CD2 4.05Å; P25-L63 HydrophobicContact CB-CG 4.18Å; P25-L63 HydrophobicContact CG-CD1 3.63Å; P25-L63 HydrophobicContact CG-CD2 4.35Å; P25-L63 HydrophobicContact CG-CG 4.2Å
26	I	94.4	Very high	94.3	Very high	67 Å²	67	87.8 Å²	87.8	34%	0.344	46%	0.458	S	S	.	.	T	Hydrogen-bonded Turn	trans	-94.2	-46.7	-178.8	-65	168.3	0	0	111.6	C24 F43 C47 P62	C24-I26 PolarHBondContact O-N 3.31Å; I26-F43 HydrophobicContact CD1-CB 4.26Å; I26-F43 HydrophobicContact CD1-CD1 3.46Å; I26-F43 VanDerWaalsContact CD1-CD1 3.46Å; I26-F43 HydrophobicContact CD1-CE1 4.05Å; I26-F43 HydrophobicContact CD1-CG 4.02Å; I26-F43 HydrophobicContact CG1-CD1 3.7Å; I26-F43 HydrophobicContact CG1-CE1 4.07Å; I26-C47 HydrophobicContact CB-CB 3.91Å; I26-C47 HydrophobicContact CD1-CB 3.73Å; I26-C47 HydrophobicContact CG1-CB 4.41Å; I26-C47 HydrophobicContact CG2-CB 3.86Å; I26-P62 HydrophobicContact CD1-CG 4.31Å; I26-P62 HydrophobicContact CG1-CG 4.15Å
27	C	96.1	Very high	94.1	Very high	52 Å²	52	83.3 Å²	83.3	35%	0.351	44%	0.438	S	S	.	.	T	Hydrogen-bonded Turn	trans	-106.5	-8.3	-175.7	64.8	0	0	0	114	C24 E29	C24-C27 VanDerWaalsContact CB-SG 3.55Å; C24-C27 PolarHBondContact O-N 2.87Å; C27-E29 PolarHBondContact O-N 3.19Å
28	L	95.4	Very high	93.9	Very high	123 Å²	123	88.5 Å²	88.5	64%	0.644	45%	0.451	S	S	*	.	S	Bend	trans	59.6	24.2	-179.3	-49.1	179.4	0	0	113.9	C24	C24-L28 VanDerWaalsContact O-CA 3.32Å; C24-L28 WeakPolarHBondContact O-CA 3.47Å; C24-L28 PolarHBondContact O-N 3.35Å
29	E	96.4	Very high	93.9	Very high	126 Å²	126	84.5 Å²	84.5	59%	0.589	43%	0.433	S	S	*	.	S	Bend	trans	-111.4	162	175	-64.6	-65.5	153.8	0	109.3	E23 C24 C27 I31	E23-E29 CarbonylContact C-O 3.57Å; E23-E29 WeakPolarHBondContact CA-O 3.47Å; C24-E29 WeakPolarHBondContact CB-O 3.35Å; C24-E29 PolarHBondContact N-O 3.38Å; C27-E29 PolarHBondContact O-N 3.19Å; E29-I31 PolarHBondContact O-N 3.4Å
30	L	95.9	Very high	93.8	Very high	104 Å²	104	85.9 Å²	85.9	55%	0.545	44%	0.444	S	S	.	.	B	Isolated β-bridge	trans	-50.7	134.1	172.5	-170	74.2	0	0	111	L22 K32	L22-L30 HydrophobicContact CB-CD1 3.6Å; L22-L30 HydrophobicContact CD1-CD1 4.41Å; L30-K32 PolarHBondContact O-N 3.37Å; L30-K32 VanDerWaalsContact O-N 3.16Å
31	I	96.3	Very high	93.9	Very high	35 Å²	35	81.5 Å²	81.5	18%	0.179	43%	0.425	C	S	.	.			trans	-61.6	119	-177.1	-64.3	158.2	0	0	110.3	L22 C24 E29 P34 I42	L22-I31 WeakPolarHBondContact O-CD1 3.46Å; L22-I31 VanDerWaalsContact O-CG1 3.22Å; L22-I31 WeakPolarHBondContact O-CG1 3.41Å; L22-I31 PolarHBondContact O-N 3.16Å; C24-I31 HydrophobicContact CB-CG1 3.97Å; E29-I31 PolarHBondContact O-N 3.4Å; I31-P34 HydrophobicContact CG2-CB 3.65Å; I31-I42 HydrophobicContact CD1-CB 4.36Å; I31-I42 HydrophobicContact CD1-CG2 3.99Å; I31-I42 HydrophobicContact CG2-CG2 4.08Å
32	K	95.8	Very high	94	Very high	152 Å²	152	78.8 Å²	78.8	66%	0.661	41%	0.412	S	S	*	.	S	Bend	trans	-106.5	129.3	174	-65	178.2	-175.3	176.5	109.7	L30 C44 K45	L30-K32 PolarHBondContact O-N 3.37Å; L30-K32 VanDerWaalsContact O-N 3.16Å; K32-C44 PolarHBondContact N-SG 2.81Å; K32-C44 VanDerWaalsContact N-SG 3.38Å; K32-C44 VanDerWaalsContact O-CA 3.31Å; K32-C44 WeakPolarHBondContact O-CA 3.18Å; K32-C44 WeakPolarHBondContact O-CB 3.12Å; K32-K45 PolarHBondContact O-N 3.38Å
33	E	94.8	Very high	94	Very high	122 Å²	122	74.2 Å²	74.2	57%	0.57	39%	0.388	S	S	*	.	S	Bend	trans	48.9	72.2	-174.7	-64.6	177.9	92.8	0	110.8	V35 K45	E33-V35 PolarHBondContact O-N 3.33Å; E33-K45 HydrophobicContact CB-CB 3.77Å; E33-K45 HydrophobicContact CB-CD 4.08Å; E33-K45 WeakPolarHBondContact O-CB 3.48Å; E33-K45 PolarHBondContact O-N 2.95Å; E33-K45 VanDerWaalsContact OE1-CD 3.31Å; E33-K45 WeakPolarHBondContact OE1-CD 3.44Å; E33-K45 IonicContact OE1-NZ 2.83Å; E33-K45 PolarHBondContact OE1-NZ 3.45Å
34	P	94.1	Very high	94	Very high	94 Å²	94	72 Å²	72	61%	0.61	38%	0.378	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-60	132.1	-173	24.4	-33.9	0	0	111.6	I31 I42	I31-P34 HydrophobicContact CG2-CB 3.65Å; P34-I42 HydrophobicContact CB-CG2 3.6Å
35	V	91.8	Very high	93.8	Very high	27 Å²	27	74.9 Å²	74.9	16%	0.164	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	121.1	171.1	-178.2	0	0	0	108.6	E33 I42 F43 K45 M48	E33-V35 PolarHBondContact O-N 3.33Å; V35-I42 WeakPolarHBondContact O-CA 3.49Å; V35-F43 PolarHBondContact N-O 2.91Å; V35-F43 PolarHBondContact O-N 3.37Å; V35-F43 VanDerWaalsContact O-N 3.14Å; V35-K45 HydrophobicContact CG2-CB 3.91Å; V35-K45 HydrophobicContact CG2-CG 4.37Å; V35-M48 HydrophobicContact CG1-CG 4.43Å
36	S	91.6	Very high	93.8	Very high	82 Å²	82	79.8 Å²	79.8	57%	0.573	41%	0.407	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.5	137.7	174.4	59.1	0	0	0	111.1
37	T	89.8	Confident	93.8	Very high	14 Å²	14	77.1 Å²	77.1	9%	0.086	40%	0.395	C	S	.	.			trans	-88.4	168.5	170.6	56.6	0	0	0	110.8	C39 D40 H41 F43 M48 I68	T37-C39 PolarHBondContact O-N 2.97Å; T37-C39 PolarHBondContact OG1-SG 2.78Å; T37-D40 PolarHBondContact O-N 2.95Å; T37-H41 PolarHBondContact N-O 3.2Å; T37-H41 PolarHBondContact OG1-N 3.42Å; T37-H41 PolarHBondContact OG1-O 3.38Å; T37-F43 HydrophobicContact CG2-CD2 4Å; T37-F43 HydrophobicContact CG2-CE2 3.8Å; T37-M48 HydrophobicContact CG2-CE 3.4Å; T37-M48 VanDerWaalsContact CG2-CE 3.4Å; T37-I68 HydrophobicContact CG2-CD1 3.88Å; T37-I68 HydrophobicContact CG2-CG1 4.12Å
38	K	88.8	Confident	93.6	Very high	162 Å²	162	74.9 Å²	74.9	70%	0.704	38%	0.379	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.3	-14	173.5	-68.3	-171.7	-180	179.4	113.9	D40	K38-D40 VanDerWaalsContact C-N 3.33Å
39	C	92.3	Very high	93.3	Very high	22 Å²	22	71.9 Å²	71.9	15%	0.149	36%	0.363	C	S	.	.	T	Hydrogen-bonded Turn	trans	-99.1	21.2	172.8	61.7	0	0	0	112.1	T37 H41 C61 C64 N66	T37-C39 PolarHBondContact O-N 2.97Å; T37-C39 PolarHBondContact OG1-SG 2.78Å; C39-H41 PolarHBondContact O-N 2.89Å; C39-H41 PolarHBondContact O-ND1 3.25Å; C39-H41 PolarHBondContact SG-ND1 3.23Å; C39-H41 VanDerWaalsContact SG-ND1 3.45Å; C39-C61 VanDerWaalsContact SG-SG 3.64Å; C39-C64 PolarHBondContact SG-SG 3.31Å; C39-N66 HydrophobicContact CB-CB 4.06Å
40	D	91.6	Very high	93	Very high	136 Å²	136	71.5 Å²	71.5	73%	0.727	36%	0.36	S	S	*	.	S	Bend	trans	62	4.8	174.5	-55.2	-45.4	0	0	116.6	T37 K38	T37-D40 PolarHBondContact O-N 2.95Å; K38-D40 VanDerWaalsContact C-N 3.33Å
41	H	93.3	Very high	92.6	Very high	58 Å²	58	68.1 Å²	68.1	27%	0.269	34%	0.342	S	S	.	.			trans	-77.5	139.9	171.7	-65.5	109.1	0	0	111.5	T37 C39 F43 L63	T37-H41 PolarHBondContact N-O 3.2Å; T37-H41 PolarHBondContact OG1-N 3.42Å; T37-H41 PolarHBondContact OG1-O 3.38Å; C39-H41 PolarHBondContact O-N 2.89Å; C39-H41 PolarHBondContact O-ND1 3.25Å; C39-H41 PolarHBondContact SG-ND1 3.23Å; C39-H41 VanDerWaalsContact SG-ND1 3.45Å; H41-F43 HydrophobicContact CB-CE2 3.62Å; H41-F43 HydrophobicContact CB-CZ 3.81Å; H41-L63 HydrophobicContact CB-CD1 4Å; H41-L63 WeakPolarHBondContact CD2-CD1 3.18Å
42	I	93.9	Very high	92.1	Very high	76 Å²	76	66.9 Å²	66.9	39%	0.39	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	137.1	-174.6	-53.8	177.6	0	0	109.8	P25 I31 P34 V35	P25-I42 WeakPolarHBondContact CD-O 3.46Å; I31-I42 HydrophobicContact CD1-CB 4.36Å; I31-I42 HydrophobicContact CD1-CG2 3.99Å; I31-I42 HydrophobicContact CG2-CG2 4.08Å; P34-I42 HydrophobicContact CB-CG2 3.6Å; V35-I42 WeakPolarHBondContact O-CA 3.49Å
43	F	94.6	Very high	91.6	Very high	0 Å²	0	65.6 Å²	65.6	0%	0	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.9	164	177.2	-52.8	-88.2	0	0	110.2	P25 I26 V35 T37 H41 M48 P62 L63	P25-F43 HydrophobicContact CB-CD1 4.42Å; P25-F43 HydrophobicContact CB-CE1 3.98Å; P25-F43 HydrophobicContact CG-CD1 4.09Å; P25-F43 HydrophobicContact CG-CE1 3.78Å; I26-F43 HydrophobicContact CD1-CB 4.26Å; I26-F43 HydrophobicContact CD1-CD1 3.46Å; I26-F43 VanDerWaalsContact CD1-CD1 3.46Å; I26-F43 HydrophobicContact CD1-CE1 4.05Å; I26-F43 HydrophobicContact CD1-CG 4.02Å; I26-F43 HydrophobicContact CG1-CD1 3.7Å; I26-F43 HydrophobicContact CG1-CE1 4.07Å; V35-F43 PolarHBondContact N-O 2.91Å; V35-F43 PolarHBondContact O-N 3.37Å; V35-F43 VanDerWaalsContact O-N 3.14Å; T37-F43 HydrophobicContact CG2-CD2 4Å; T37-F43 HydrophobicContact CG2-CE2 3.8Å; H41-F43 HydrophobicContact CB-CE2 3.62Å; H41-F43 HydrophobicContact CB-CZ 3.81Å; F43-M48 HydrophobicContact CB-CE 4.05Å; F43-M48 HydrophobicContact CD2-CE 3.3Å; F43-M48 HydrophobicContact CE2-CE 4.02Å; F43-M48 HydrophobicContact CG-CE 3.92Å; F43-P62 HydrophobicContact CE1-CG 4.18Å; F43-P62 HydrophobicContact CZ-CG 4.44Å; F43-L63 HydrophobicContact CZ-CD1 4.32Å; F43-L63 HydrophobicContact CZ-CG 4.49Å
44	C	96.2	Very high	90.8	Very high	10 Å²	10	65.6 Å²	65.6	7%	0.068	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.8	142.3	167.5	-57.4	0	0	0	110.5	C24 K32 F46 C47 M48	C24-C44 WeakPolarHBondContact CB-SG 3.22Å; C24-C44 PolarHBondContact SG-N 3.14Å; C24-C44 VanDerWaalsContact SG-SG 3.64Å; K32-C44 PolarHBondContact N-SG 2.81Å; K32-C44 VanDerWaalsContact N-SG 3.38Å; K32-C44 VanDerWaalsContact O-CA 3.31Å; K32-C44 WeakPolarHBondContact O-CA 3.18Å; K32-C44 WeakPolarHBondContact O-CB 3.12Å; C44-F46 VanDerWaalsContact C-N 3.29Å; C44-F46 PolarHBondContact O-N 3.25Å; C44-C47 HydrophobicContact CB-CB 4.06Å; C44-C47 WeakPolarHBondContact O-CB 3.47Å; C44-C47 PolarHBondContact O-N 2.96Å; C44-C47 VanDerWaalsContact O-N 3.08Å; C44-M48 PolarHBondContact O-N 3.34Å
45	K	93.4	Very high	89.5	Confident	61 Å²	61	68 Å²	68	27%	0.265	34%	0.337	S	S	.	.	H	α-helix	trans	-49.5	-47.9	172.7	179.5	178.4	172.2	178.1	112.9	K32 E33 V35 C47 M48 L49 W74	K32-K45 PolarHBondContact O-N 3.38Å; E33-K45 HydrophobicContact CB-CB 3.77Å; E33-K45 HydrophobicContact CB-CD 4.08Å; E33-K45 WeakPolarHBondContact O-CB 3.48Å; E33-K45 PolarHBondContact O-N 2.95Å; E33-K45 VanDerWaalsContact OE1-CD 3.31Å; E33-K45 WeakPolarHBondContact OE1-CD 3.44Å; E33-K45 IonicContact OE1-NZ 2.83Å; E33-K45 PolarHBondContact OE1-NZ 3.45Å; V35-K45 HydrophobicContact CG2-CB 3.91Å; V35-K45 HydrophobicContact CG2-CG 4.37Å; K45-C47 PolarHBondContact O-N 3.45Å; K45-M48 PolarHBondContact O-N 3.3Å; K45-L49 HydrophobicContact CG-CD1 4.26Å; K45-L49 WeakPolarHBondContact O-CG 3.46Å; K45-L49 PolarHBondContact O-N 3.04Å; K45-W74 HydrophobicContact CD-CH2 4.2Å; K45-W74 HydrophobicContact CD-CZ3 3.68Å; K45-W74 HydrophobicContact CG-CH2 4.02Å; K45-W74 HydrophobicContact CG-CZ3 3.88Å
46	F	94.1	Very high	88.2	Confident	152 Å²	152	77.7 Å²	77.7	67%	0.667	38%	0.377	S	S	*	.	H	α-helix	trans	-63.2	-41.9	179	-176.2	-101	0	0	112.8	C44 M48 L49 K50	C44-F46 VanDerWaalsContact C-N 3.29Å; C44-F46 PolarHBondContact O-N 3.25Å; F46-M48 VanDerWaalsContact C-N 3.33Å; F46-M48 PolarHBondContact O-N 3.41Å; F46-L49 PolarHBondContact O-N 3.2Å; F46-K50 PolarHBondContact O-N 3.47Å
47	C	93.8	Very high	87.1	Confident	12 Å²	12	75.7 Å²	75.7	8%	0.081	37%	0.369	C	S	.	.	H	α-helix	trans	-63.3	-40.8	176.8	-65.8	0	0	0	111.5	I26 C44 K45 K50 L51	I26-C47 HydrophobicContact CB-CB 3.91Å; I26-C47 HydrophobicContact CD1-CB 3.73Å; I26-C47 HydrophobicContact CG1-CB 4.41Å; I26-C47 HydrophobicContact CG2-CB 3.86Å; C44-C47 HydrophobicContact CB-CB 4.06Å; C44-C47 WeakPolarHBondContact O-CB 3.47Å; C44-C47 PolarHBondContact O-N 2.96Å; C44-C47 VanDerWaalsContact O-N 3.08Å; K45-C47 PolarHBondContact O-N 3.45Å; C47-K50 PolarHBondContact O-N 2.91Å; C47-L51 WeakPolarHBondContact O-CB 3.42Å; C47-L51 PolarHBondContact O-N 3.39Å
48	M	91.6	Very high	86.2	Confident	5 Å²	5	79.2 Å²	79.2	3%	0.025	39%	0.392	C	S	.	.	H	α-helix	trans	-64	-45.2	176	-173.6	56.7	66.7	0	111.9	V35 T37 F43 C44 K45 F46 K50 L51 L52 I68 Y72	V35-M48 HydrophobicContact CG1-CG 4.43Å; T37-M48 HydrophobicContact CG2-CE 3.4Å; T37-M48 VanDerWaalsContact CG2-CE 3.4Å; F43-M48 HydrophobicContact CB-CE 4.05Å; F43-M48 HydrophobicContact CD2-CE 3.3Å; F43-M48 HydrophobicContact CE2-CE 4.02Å; F43-M48 HydrophobicContact CG-CE 3.92Å; C44-M48 PolarHBondContact O-N 3.34Å; K45-M48 PolarHBondContact O-N 3.3Å; F46-M48 VanDerWaalsContact C-N 3.33Å; F46-M48 PolarHBondContact O-N 3.41Å; M48-K50 VanDerWaalsContact C-N 3.34Å; M48-K50 PolarHBondContact O-N 3.05Å; M48-L51 PolarHBondContact O-N 3.49Å; M48-L51 HydrophobicContact SD-CD2 4.4Å; M48-L52 HydrophobicContact CG-CD1 3.72Å; M48-L52 WeakPolarHBondContact O-CD1 3.32Å; M48-L52 WeakPolarHBondContact O-CG 3.38Å; M48-L52 PolarHBondContact O-N 2.97Å; M48-L52 HydrophobicContact SD-CD1 3.73Å; M48-L52 HydrophobicContact SD-CG 4.29Å; M48-I68 HydrophobicContact CE-CD1 4.23Å; M48-I68 HydrophobicContact SD-CD1 4.22Å; M48-I68 HydrophobicContact SD-CG2 3.93Å; M48-Y72 HydrophobicContact CG-CE1 4.36Å
49	L	90.3	Very high	86.1	Confident	59 Å²	59	71.9 Å²	71.9	31%	0.309	36%	0.361	S	S	.	.	H	α-helix	trans	-59.8	-44.2	175.9	-71.1	171.1	0	0	111.6	K45 F46 L51 L52 N53	K45-L49 HydrophobicContact CG-CD1 4.26Å; K45-L49 WeakPolarHBondContact O-CG 3.46Å; K45-L49 PolarHBondContact O-N 3.04Å; F46-L49 PolarHBondContact O-N 3.2Å; L49-L51 PolarHBondContact O-N 2.74Å; L49-L52 PolarHBondContact O-N 3.44Å; L49-N53 WeakPolarHBondContact O-CB 3.3Å; L49-N53 PolarHBondContact O-N 2.93Å; L49-N53 PolarHBondContact O-ND2 3.48Å
50	K	89.8	Confident	86	Confident	118 Å²	118	76 Å²	76	51%	0.513	38%	0.379	S	S	.	.	H	α-helix	trans	-60.5	-45.9	176.2	-170.7	175.9	-178.9	179.8	111.4	F46 C47 M48 L52 N53 Q54	F46-K50 PolarHBondContact O-N 3.47Å; C47-K50 PolarHBondContact O-N 2.91Å; M48-K50 VanDerWaalsContact C-N 3.34Å; M48-K50 PolarHBondContact O-N 3.05Å; K50-L52 VanDerWaalsContact C-N 3.28Å; K50-L52 PolarHBondContact O-N 3.38Å; K50-N53 PolarHBondContact O-N 3.25Å; K50-Q54 HydrophobicContact CG-CG 4.4Å; K50-Q54 WeakPolarHBondContact O-CB 3.42Å; K50-Q54 WeakPolarHBondContact O-CG 3.28Å; K50-Q54 PolarHBondContact O-N 3.46Å; K50-Q54 VanDerWaalsContact O-N 3.12Å
51	L	87.6	Confident	86	Confident	33 Å²	33	69.7 Å²	69.7	17%	0.173	35%	0.345	C	S	.	.	H	α-helix	trans	-60.1	-36.8	178.4	-176.2	67.7	0	0	112.7	C47 M48 L49 S59 P62 I68	C47-L51 WeakPolarHBondContact O-CB 3.42Å; C47-L51 PolarHBondContact O-N 3.39Å; M48-L51 PolarHBondContact O-N 3.49Å; M48-L51 HydrophobicContact SD-CD2 4.4Å; L49-L51 PolarHBondContact O-N 2.74Å; L51-S59 PolarHBondContact O-OG 3.49Å; L51-P62 HydrophobicContact CD2-CG 4.29Å; L51-I68 HydrophobicContact CD2-CD1 3.73Å
52	L	85.9	Confident	85.9	Confident	10 Å²	10	70.2 Å²	70.2	5%	0.052	35%	0.353	C	S	.	.	H	α-helix	trans	-83.3	-20.9	-178.1	-66.5	162.3	0	0	113.2	M48 L49 K50 S59 I68 Y72	M48-L52 HydrophobicContact CG-CD1 3.72Å; M48-L52 WeakPolarHBondContact O-CD1 3.32Å; M48-L52 WeakPolarHBondContact O-CG 3.38Å; M48-L52 PolarHBondContact O-N 2.97Å; M48-L52 HydrophobicContact SD-CD1 3.73Å; M48-L52 HydrophobicContact SD-CG 4.29Å; L49-L52 PolarHBondContact O-N 3.44Å; K50-L52 VanDerWaalsContact C-N 3.28Å; K50-L52 PolarHBondContact O-N 3.38Å; L52-S59 VanDerWaalsContact CD2-CB 3.49Å; L52-I68 HydrophobicContact CD1-CG2 4.34Å; L52-I68 HydrophobicContact CD2-CB 4.42Å; L52-I68 HydrophobicContact CD2-CG2 3.82Å; L52-Y72 HydrophobicContact CD1-CE1 3.36Å; L52-Y72 WeakPolarHBondContact CD1-OH 3.47Å
53	N	85.2	Confident	85.8	Confident	124 Å²	124	71.1 Å²	71.1	66%	0.663	36%	0.358	S	S	*	.	H	α-helix	trans	-91.2	-14.5	176.9	-70.1	-19.5	0	0	113.4	L49 K50	L49-N53 WeakPolarHBondContact O-CB 3.3Å; L49-N53 PolarHBondContact O-N 2.93Å; L49-N53 PolarHBondContact O-ND2 3.48Å; K50-N53 PolarHBondContact O-N 3.25Å
54	Q	77.1	Confident	85.7	Confident	122 Å²	122	73.3 Å²	73.3	57%	0.57	37%	0.373	S	S	*	.	S	Bend	trans	-77.1	-23	-174.2	-88.1	174.5	-12.8	0	115.4	K50	K50-Q54 HydrophobicContact CG-CG 4.4Å; K50-Q54 WeakPolarHBondContact O-CB 3.42Å; K50-Q54 WeakPolarHBondContact O-CG 3.28Å; K50-Q54 PolarHBondContact O-N 3.46Å; K50-Q54 VanDerWaalsContact O-N 3.12Å
55	K	66.3	Low	85.5	Confident	144 Å²	144	80.6 Å²	80.6	63%	0.626	40%	0.404	S	S	*	.			trans	-128.7	142	-173.8	-66.6	-171.3	178.7	-178.6	112.2	G57	K55-G57 PolarHBondContact O-N 3.13Å
56	K	65.4	Low	85.4	Confident	232 Å²	232	82 Å²	82	100%	1.009	41%	0.414	S	S	*	.	S	Bend	trans	-78.1	22.4	169.3	-67.1	-170.9	177.5	-178.3	113.1
57	G	67.8	Low	85	Confident	40 Å²	40	80.6 Å²	80.6	41%	0.412	41%	0.41	S	S	.	.	S	Bend	trans	-147.7	-177.9	-174.7	0	0	0	0	111.6	K55 S59	K55-G57 PolarHBondContact O-N 3.13Å; G57-S59 PolarHBondContact O-N 3.23Å
58	P	71.3	Confident	84.7	Confident	87 Å²	87	80.7 Å²	80.7	57%	0.565	41%	0.409	S	S	*	.			trans	-59.9	125.1	-177	24.4	-33	0	0	110.8	E67	P58-E67 HydrophobicContact CB-CG 4.03Å; P58-E67 WeakPolarHBondContact CB-OE1 3.29Å
59	S	86.1	Confident	83.8	Confident	8 Å²	8	83.2 Å²	83.2	6%	0.056	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76	142.5	172.3	-68.7	0	0	0	109.2	L51 L52 G57 I68	L51-S59 PolarHBondContact O-OG 3.49Å; L52-S59 VanDerWaalsContact CD2-CB 3.49Å; G57-S59 PolarHBondContact O-N 3.23Å; S59-I68 PolarHBondContact O-N 2.98Å
60	Q	90.3	Very high	82.5	Confident	110 Å²	110	87.1 Å²	87.1	51%	0.514	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	147.1	-179.1	-69.1	175.1	-42.7	0	110.2	P62 N66	Q60-P62 WeakPolarHBondContact O-CD 3.44Å; Q60-N66 CarbonylContact C-O 3.6Å; Q60-N66 WeakPolarHBondContact CA-O 3.33Å
61	C	91.4	Very high	81.1	Confident	2 Å²	2	85.7 Å²	85.7	1%	0.014	44%	0.444	C	S	.	.			trans	-62.3	126.6	174	-178.4	0	0	0	110.5	C39 L63 K65 N66 I68	C39-C61 VanDerWaalsContact SG-SG 3.64Å; C61-L63 PolarHBondContact O-N 3.39Å; C61-K65 WeakPolarHBondContact O-CA 3.45Å; C61-K65 PolarHBondContact O-N 3.12Å; C61-N66 PolarHBondContact N-O 3.36Å; C61-I68 HydrophobicContact CB-CD1 4.03Å; C61-I68 HydrophobicContact CB-CG1 4.2Å
62	P	90.9	Very high	79.4	Confident	69 Å²	69	87.2 Å²	87.2	45%	0.448	45%	0.448	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.3	-24.4	177.4	-25.3	34.8	0	0	114.3	I26 F43 L51 Q60	I26-P62 HydrophobicContact CD1-CG 4.31Å; I26-P62 HydrophobicContact CG1-CG 4.15Å; F43-P62 HydrophobicContact CE1-CG 4.18Å; F43-P62 HydrophobicContact CZ-CG 4.44Å; L51-P62 HydrophobicContact CD2-CG 4.29Å; Q60-P62 WeakPolarHBondContact O-CD 3.44Å
63	L	92.1	Very high	77.7	Confident	95 Å²	95	95.4 Å²	95.4	50%	0.497	48%	0.483	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89	-48.2	-175.9	-69.4	175.6	0	0	113	P25 H41 F43 C61	P25-L63 HydrophobicContact CB-CD1 4.16Å; P25-L63 HydrophobicContact CB-CD2 4.05Å; P25-L63 HydrophobicContact CB-CG 4.18Å; P25-L63 HydrophobicContact CG-CD1 3.63Å; P25-L63 HydrophobicContact CG-CD2 4.35Å; P25-L63 HydrophobicContact CG-CG 4.2Å; H41-L63 HydrophobicContact CB-CD1 4Å; H41-L63 WeakPolarHBondContact CD2-CD1 3.18Å; F43-L63 HydrophobicContact CZ-CD1 4.32Å; F43-L63 HydrophobicContact CZ-CG 4.49Å; C61-L63 PolarHBondContact O-N 3.39Å
64	C	94.1	Very high	76.2	Confident	46 Å²	46	96.2 Å²	96.2	31%	0.311	48%	0.477	S	S	.	.	T	Hydrogen-bonded Turn	trans	-119	0.1	-174.8	66.6	0	0	0	115	C39 N66	C39-C64 PolarHBondContact SG-SG 3.31Å; C64-N66 PolarHBondContact O-N 3.34Å; C64-N66 VanDerWaalsContact O-N 3.07Å
65	K	91.1	Very high	74.6	Confident	163 Å²	163	102.6 Å²	102.6	71%	0.709	50%	0.503	S	S	*	.			trans	64.7	3.2	179.8	-51.8	175.5	-177.5	175	115.8	C61	C61-K65 WeakPolarHBondContact O-CA 3.45Å; C61-K65 PolarHBondContact O-N 3.12Å
66	N	90.5	Very high	75	Confident	90 Å²	90	100.5 Å²	100.5	48%	0.481	50%	0.497	S	S	.	.			trans	-60.1	148.7	171.6	-70.1	-4.9	0	0	111.3	C39 Q60 C61 C64 I68	C39-N66 HydrophobicContact CB-CB 4.06Å; Q60-N66 CarbonylContact C-O 3.6Å; Q60-N66 WeakPolarHBondContact CA-O 3.33Å; C61-N66 PolarHBondContact N-O 3.36Å; C64-N66 PolarHBondContact O-N 3.34Å; C64-N66 VanDerWaalsContact O-N 3.07Å; N66-I68 PolarHBondContact O-N 2.63Å
67	E	87.6	Confident	75.5	Confident	123 Å²	123	93.6 Å²	93.6	58%	0.575	47%	0.47	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.8	133.1	179.6	-170.2	177.5	-177.6	0	111.9	P58 T69	P58-E67 HydrophobicContact CB-CG 4.03Å; P58-E67 WeakPolarHBondContact CB-OE1 3.29Å; E67-T69 HydrophobicContact CG-CG2 4.31Å
68	I	85.6	Confident	75.9	Confident	14 Å²	14	96.6 Å²	96.6	7%	0.072	47%	0.474	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	108.6	172.2	-61.4	176.9	0	0	107.4	T37 M48 L51 L52 S59 C61 N66	T37-I68 HydrophobicContact CG2-CD1 3.88Å; T37-I68 HydrophobicContact CG2-CG1 4.12Å; M48-I68 HydrophobicContact CE-CD1 4.23Å; M48-I68 HydrophobicContact SD-CD1 4.22Å; M48-I68 HydrophobicContact SD-CG2 3.93Å; L51-I68 HydrophobicContact CD2-CD1 3.73Å; L52-I68 HydrophobicContact CD1-CG2 4.34Å; L52-I68 HydrophobicContact CD2-CB 4.42Å; L52-I68 HydrophobicContact CD2-CG2 3.82Å; S59-I68 PolarHBondContact O-N 2.98Å; C61-I68 HydrophobicContact CB-CD1 4.03Å; C61-I68 HydrophobicContact CB-CG1 4.2Å; N66-I68 PolarHBondContact O-N 2.63Å
69	T	72.7	Confident	76.2	Confident	58 Å²	58	97.1 Å²	97.1	36%	0.356	47%	0.468	S	S	.	.			trans	-91.6	151.2	173	50.8	0	0	0	110.1	E67 S71	E67-T69 HydrophobicContact CG-CG2 4.31Å; T69-S71 PolarHBondContact O-N 3.02Å
70	K	64.6	Low	75.6	Confident	142 Å²	142	102.7 Å²	102.7	62%	0.617	49%	0.494	S	S	*	.	S	Bend	trans	-68.5	25.9	178.8	-65.2	-173.4	178.2	-178.6	114.5	Y72	K70-Y72 HydrophobicContact CB-CD2 4.49Å; K70-Y72 HydrophobicContact CB-CE2 3.76Å; K70-Y72 HydrophobicContact CG-CE2 4.22Å; K70-Y72 WeakPolarHBondContact O-CD2 3.33Å; K70-Y72 WeakPolarHBondContact O-CE2 3.4Å; K70-Y72 PolarHBondContact O-N 3.03Å
71	S	59.2	Low	74.6	Confident	87 Å²	87	102.2 Å²	102.2	61%	0.608	49%	0.493	S	S	*	.			trans	-82.9	70.4	173.1	-80.4	0	0	0	109.9	T69 K73	T69-S71 PolarHBondContact O-N 3.02Å; S71-K73 PolarHBondContact O-N 3.2Å
72	Y	53.1	Low	73.4	Confident	65 Å²	65	109.4 Å²	109.4	26%	0.255	53%	0.527	S	S	.	.			trans	-73.9	113.5	168.9	-37.7	-86.6	0	0	107.6	M48 L52 K70 W74	M48-Y72 HydrophobicContact CG-CE1 4.36Å; L52-Y72 HydrophobicContact CD1-CE1 3.36Å; L52-Y72 WeakPolarHBondContact CD1-OH 3.47Å; K70-Y72 HydrophobicContact CB-CD2 4.49Å; K70-Y72 HydrophobicContact CB-CE2 3.76Å; K70-Y72 HydrophobicContact CG-CE2 4.22Å; K70-Y72 WeakPolarHBondContact O-CD2 3.33Å; K70-Y72 WeakPolarHBondContact O-CE2 3.4Å; K70-Y72 PolarHBondContact O-N 3.03Å; Y72-W74 VanDerWaalsContact C-N 3.33Å; Y72-W74 VanDerWaalsContact CB-NE1 3.3Å; Y72-W74 HydrophobicContact CD1-CZ2 4.27Å; Y72-W74 HydrophobicContact CD2-CZ2 4.32Å; Y72-W74 AromaticContact CD2-NE1 3.94Å; Y72-W74 AromaticContact CG-CE2 3.99Å; Y72-W74 AromaticContact CG-CZ2 3.99Å; Y72-W74 HydrophobicContact CG-CZ2 3.99Å; Y72-W74 AromaticContact CG-NE1 3.84Å; Y72-W74 PolarHBondContact O-N 3.19Å
73	K	48.8	Very low	72	Confident	182 Å²	182	112.5 Å²	112.5	79%	0.791	53%	0.533	S	S	*	.			trans	-83.1	92.2	153.9	-75.8	-163.6	175.9	-173	106.2	S71 F75	S71-K73 PolarHBondContact O-N 3.2Å; K73-F75 VanDerWaalsContact C-N 3.34Å; K73-F75 PolarHBondContact O-N 3.09Å; K73-F75 VanDerWaalsContact O-N 3.16Å
74	W	54.5	Low	70.3	Confident	142 Å²	142	113.9 Å²	113.9	54%	0.538	54%	0.536	S	S	.	.			trans	-67.9	99.7	160.7	-51.2	95.4	0	0	104.8	K45 Y72	K45-W74 HydrophobicContact CD-CH2 4.2Å; K45-W74 HydrophobicContact CD-CZ3 3.68Å; K45-W74 HydrophobicContact CG-CH2 4.02Å; K45-W74 HydrophobicContact CG-CZ3 3.88Å; Y72-W74 VanDerWaalsContact C-N 3.33Å; Y72-W74 VanDerWaalsContact CB-NE1 3.3Å; Y72-W74 HydrophobicContact CD1-CZ2 4.27Å; Y72-W74 HydrophobicContact CD2-CZ2 4.32Å; Y72-W74 AromaticContact CD2-NE1 3.94Å; Y72-W74 AromaticContact CG-CE2 3.99Å; Y72-W74 AromaticContact CG-CZ2 3.99Å; Y72-W74 HydrophobicContact CG-CZ2 3.99Å; Y72-W74 AromaticContact CG-NE1 3.84Å; Y72-W74 PolarHBondContact O-N 3.19Å
75	F	42.5	Very low	68.2	Low	255 Å²	255	120.1 Å²	120.1	100%	1.118	56%	0.556	S	S	*	*			trans	-60.6	0	170	-73.7	-88.2	0	0	109.7	K73	K73-F75 VanDerWaalsContact C-N 3.34Å; K73-F75 PolarHBondContact O-N 3.09Å; K73-F75 VanDerWaalsContact O-N 3.16Å

Retrieved 75 of 75 residues in 144.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).