A0A087WPK8_MOUSE Loading...

G protein-coupled receptor 35

AlphaFold DB , UniProt , Accession A0A087WPK8, Species MOUSE (Mus musculus, Mouse), Gene Gpr35, Length 39 aa.

						>A0A087WPK8_MOUSE|A0A087WPK8|Gpr35
MNSTTCNSTLTWPASVNNFFIIYSALLLVLGLLLNSVAL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.2	Very low	57.9	Low	244 Å²	244	131.9 Å²	131.9	100%	1.202	77%	0.769	S	S	*	*				0	92.4	0	-103.9	161.3	159.2	107.8
2	N	48.2	Very low	59	Low	164 Å²	164	136.5 Å²	136.5	88%	0.877	76%	0.764	S	S	*	*			trans	-93.1	96.2	171.6	-101.9	12.8	0	107.7	T4	N2-T4 PolarHBondContact O-N 3.07Å
3	S	53.7	Low	60.7	Low	113 Å²	113	131.9 Å²	131.9	79%	0.79	74%	0.744	S	S	*	*			trans	-84.1	91	168.7	-172	0	0	107.4	T5	S3-T5 PolarHBondContact O-N 3.47Å
4	T	58.6	Low	62.2	Low	114 Å²	114	128.2 Å²	128.2	70%	0.699	74%	0.738	S	S	*	*			trans	-70.7	109.3	162.8	42.8	0	0	106.7	N2 C6	N2-T4 PolarHBondContact O-N 3.07Å; T4-C6 VanDerWaalsContact C-N 3.35Å; T4-C6 PolarHBondContact O-N 3.32Å
5	T	59.9	Low	63.6	Low	129 Å²	129	125.5 Å²	125.5	79%	0.791	73%	0.729	S	S	*	*			trans	-52.6	97.4	167.4	34.7	0	0	109.2	S3 N7	S3-T5 PolarHBondContact O-N 3.47Å; T5-N7 PolarHBondContact O-N 3.07Å
6	C	61.9	Low	65	Low	107 Å²	107	121.1 Å²	121.1	72%	0.723	71%	0.705	S	S	*	*			trans	-65.6	88.1	163	-74.6	0	0	107.1	T4 S8	T4-C6 VanDerWaalsContact C-N 3.35Å; T4-C6 PolarHBondContact O-N 3.32Å; C6-S8 PolarHBondContact O-N 3.5Å
7	N	59.2	Low	66.4	Low	134 Å²	134	119 Å²	119	72%	0.717	69%	0.69	S	S	*	*			trans	-72.5	68.7	163.5	-171.8	14.7	0	107.8	T5 T9	T5-N7 PolarHBondContact O-N 3.07Å; N7-T9 PolarHBondContact O-N 3.3Å
8	S	58.7	Low	67.6	Low	79 Å²	79	117.6 Å²	117.6	55%	0.552	68%	0.68	S	S	*	*			trans	-73.1	73.6	175.7	-51.4	0	0	107.7	C6 L10	C6-S8 PolarHBondContact O-N 3.5Å; S8-L10 PolarHBondContact O-N 2.88Å
9	T	62.5	Low	68.8	Low	97 Å²	97	117.6 Å²	117.6	60%	0.595	67%	0.671	S	S	*	*			trans	-61.1	95.9	152.6	43.5	0	0	105	N7 T11	N7-T9 PolarHBondContact O-N 3.3Å; T9-T11 PolarHBondContact O-N 3.35Å; T9-T11 PolarHBondContact O-OG1 3.03Å
10	L	64.6	Low	70	Confident	156 Å²	156	118.2 Å²	118.2	82%	0.817	67%	0.666	S	S	*	*			trans	-67.8	63.7	177.7	-73.7	163.6	0	108.7	S8 W12	S8-L10 PolarHBondContact O-N 2.88Å; L10-W12 PolarHBondContact O-N 3.47Å
11	T	69.3	Low	71.1	Confident	114 Å²	114	116.9 Å²	116.9	70%	0.699	66%	0.656	S	S	*	*			trans	-81.1	112.2	170.2	48.6	0	0	105.8	T9	T9-T11 PolarHBondContact O-N 3.35Å; T9-T11 PolarHBondContact O-OG1 3.03Å
12	W	71.3	Confident	73.8	Confident	187 Å²	187	109.1 Å²	109.1	71%	0.708	62%	0.619	S	S	*	*			trans	-57.7	135.9	173.7	-81.5	57.2	0	108.3	L10 A14 V16	L10-W12 PolarHBondContact O-N 3.47Å; W12-A14 PolarHBondContact O-N 3.31Å; W12-V16 HydrophobicContact CE3-CB 3.99Å; W12-V16 HydrophobicContact CE3-CG1 3.32Å; W12-V16 HydrophobicContact CZ3-CG1 3.4Å; W12-V16 VanDerWaalsContact CZ3-CG1 3.4Å
13	P	80.9	Confident	76.1	Confident	77 Å²	77	107.2 Å²	107.2	50%	0.5	60%	0.6	S	S	.	*			trans	-55.1	136.6	177.5	-20.5	29.5	0	109.3	S15 V16 N17	P13-S15 PolarHBondContact O-N 3.31Å; P13-V16 HydrophobicContact CB-CG2 4.04Å; P13-V16 HydrophobicContact CG-CG2 4Å; P13-V16 WeakPolarHBondContact O-CA 3.3Å; P13-V16 WeakPolarHBondContact O-CB 3.33Å; P13-V16 PolarHBondContact O-N 2.98Å; P13-N17 PolarHBondContact O-N 3.49Å; P13-N17 VanDerWaalsContact O-N 3.11Å
14	A	82.1	Confident	78.1	Confident	80 Å²	80	104.2 Å²	104.2	66%	0.661	58%	0.579	S	S	*	*	H	α-helix	trans	-54.4	-30.9	-177.1	0	0	0	112.6	W12 N17 N18	W12-A14 PolarHBondContact O-N 3.31Å; A14-N17 PolarHBondContact O-N 3.31Å; A14-N18 WeakPolarHBondContact O-CB 3.39Å; A14-N18 PolarHBondContact O-N 3.49Å
15	S	82.5	Confident	79.9	Confident	87 Å²	87	101.3 Å²	101.3	61%	0.608	57%	0.567	S	S	*	*	H	α-helix	trans	-61.4	-42.3	173.1	53	0	0	113	P13 N18 F19	P13-S15 PolarHBondContact O-N 3.31Å; S15-N18 PolarHBondContact O-N 2.89Å; S15-F19 WeakPolarHBondContact O-CB 3.33Å; S15-F19 PolarHBondContact O-N 3.31Å
16	V	86.3	Confident	81.7	Confident	55 Å²	55	100.4 Å²	100.4	33%	0.333	56%	0.557	S	S	.	*	H	α-helix	trans	-71.3	-40	178.8	-170.5	0	0	110.3	W12 P13 N18 F19 F20	W12-V16 HydrophobicContact CE3-CB 3.99Å; W12-V16 HydrophobicContact CE3-CG1 3.32Å; W12-V16 HydrophobicContact CZ3-CG1 3.4Å; W12-V16 VanDerWaalsContact CZ3-CG1 3.4Å; P13-V16 HydrophobicContact CB-CG2 4.04Å; P13-V16 HydrophobicContact CG-CG2 4Å; P13-V16 WeakPolarHBondContact O-CA 3.3Å; P13-V16 WeakPolarHBondContact O-CB 3.33Å; P13-V16 PolarHBondContact O-N 2.98Å; V16-N18 PolarHBondContact O-N 2.96Å; V16-F19 PolarHBondContact O-N 3.47Å; V16-F20 WeakPolarHBondContact O-CB 3.25Å; V16-F20 PolarHBondContact O-N 2.93Å
17	N	88.3	Confident	83.4	Confident	86 Å²	86	100.8 Å²	100.8	46%	0.46	55%	0.551	S	S	.	*	H	α-helix	trans	-60.7	-45.2	174.2	-177	64	0	111.6	P13 A14 F20 I21	P13-N17 PolarHBondContact O-N 3.49Å; P13-N17 VanDerWaalsContact O-N 3.11Å; A14-N17 PolarHBondContact O-N 3.31Å; N17-F20 PolarHBondContact O-N 3.32Å; N17-I21 WeakPolarHBondContact ND2-CD1 3.3Å; N17-I21 VanDerWaalsContact O-CG1 3.28Å; N17-I21 WeakPolarHBondContact O-CG1 3.49Å; N17-I21 PolarHBondContact O-N 3.31Å
18	N	88.1	Confident	85.2	Confident	93 Å²	93	99.7 Å²	99.7	50%	0.497	55%	0.545	S	S	.	.	H	α-helix	trans	-64.3	-44.6	178.5	-170.6	41.6	0	112	A14 S15 V16 F20 I21 I22	A14-N18 WeakPolarHBondContact O-CB 3.39Å; A14-N18 PolarHBondContact O-N 3.49Å; S15-N18 PolarHBondContact O-N 2.89Å; V16-N18 PolarHBondContact O-N 2.96Å; N18-F20 PolarHBondContact O-N 3.49Å; N18-I21 PolarHBondContact O-N 3.48Å; N18-I22 VanDerWaalsContact O-CG1 3.31Å; N18-I22 WeakPolarHBondContact O-CG1 3.37Å; N18-I22 PolarHBondContact O-N 3.45Å
19	F	91.3	Very high	87.1	Confident	118 Å²	118	99.7 Å²	99.7	52%	0.518	54%	0.541	S	S	.	.	H	α-helix	trans	-58.5	-48.3	174.6	-175.3	-87.2	0	111	S15 V16 I21 I22 Y23	S15-F19 WeakPolarHBondContact O-CB 3.33Å; S15-F19 PolarHBondContact O-N 3.31Å; V16-F19 PolarHBondContact O-N 3.47Å; F19-I21 PolarHBondContact O-N 2.93Å; F19-I22 PolarHBondContact O-N 3.38Å; F19-Y23 AromaticContact CD1-CD2 3.62Å; F19-Y23 HydrophobicContact CD1-CD2 3.62Å; F19-Y23 AromaticContact CD1-CE2 3.85Å; F19-Y23 HydrophobicContact CD1-CE2 3.85Å; F19-Y23 HydrophobicContact CD1-CG 4.31Å; F19-Y23 AromaticContact CD2-CD2 3.97Å; F19-Y23 HydrophobicContact CD2-CD2 3.97Å; F19-Y23 AromaticContact CD2-CE2 3.52Å; F19-Y23 HydrophobicContact CD2-CE2 3.52Å; F19-Y23 HydrophobicContact CE1-CD1 4.37Å; F19-Y23 AromaticContact CE1-CD2 3.47Å; F19-Y23 HydrophobicContact CE1-CD2 3.47Å; F19-Y23 VanDerWaalsContact CE1-CD2 3.47Å; F19-Y23 HydrophobicContact CE1-CE1 4.27Å; F19-Y23 AromaticContact CE1-CE2 3.38Å; F19-Y23 HydrophobicContact CE1-CE2 3.38Å; F19-Y23 AromaticContact CE1-CG 3.97Å; F19-Y23 HydrophobicContact CE1-CG 3.97Å; F19-Y23 AromaticContact CE1-CZ 3.77Å; F19-Y23 AromaticContact CE2-CD2 3.86Å; F19-Y23 HydrophobicContact CE2-CD2 3.86Å; F19-Y23 AromaticContact CE2-CE2 3.04Å; F19-Y23 HydrophobicContact CE2-CE2 3.04Å; F19-Y23 AromaticContact CE2-CZ 3.55Å; F19-Y23 AromaticContact CG-CD2 3.89Å; F19-Y23 HydrophobicContact CG-CD2 3.89Å; F19-Y23 AromaticContact CG-CE2 3.92Å; F19-Y23 HydrophobicContact CG-CE2 3.92Å; F19-Y23 AromaticContact CZ-CD2 3.62Å; F19-Y23 HydrophobicContact CZ-CD2 3.62Å; F19-Y23 AromaticContact CZ-CE1 3.99Å; F19-Y23 HydrophobicContact CZ-CE1 3.99Å; F19-Y23 AromaticContact CZ-CE2 2.97Å; F19-Y23 HydrophobicContact CZ-CE2 2.97Å; F19-Y23 HydrophobicContact CZ-CG 4.34Å; F19-Y23 AromaticContact CZ-CZ 3.15Å; F19-Y23 VanDerWaalsContact CZ-OH 3.3Å; F19-Y23 WeakPolarHBondContact CZ-OH 3.46Å; F19-Y23 VanDerWaalsContact O-CD2 3.23Å; F19-Y23 WeakPolarHBondContact O-CD2 3.31Å; F19-Y23 PolarHBondContact O-N 3.37Å
20	F	92.8	Very high	88.7	Confident	130 Å²	130	99.5 Å²	99.5	57%	0.57	54%	0.536	S	S	*	.	H	α-helix	trans	-57.2	-48.2	178.6	-175.3	-95.9	0	111.8	V16 N17 N18 I22 Y23 S24	V16-F20 WeakPolarHBondContact O-CB 3.25Å; V16-F20 PolarHBondContact O-N 2.93Å; N17-F20 PolarHBondContact O-N 3.32Å; N18-F20 PolarHBondContact O-N 3.49Å; F20-I22 PolarHBondContact O-N 3.49Å; F20-Y23 PolarHBondContact O-N 2.95Å; F20-S24 WeakPolarHBondContact O-CB 3.49Å; F20-S24 PolarHBondContact O-N 2.99Å; F20-S24 PolarHBondContact O-OG 2.93Å; F20-S24 VanDerWaalsContact O-OG 3.06Å
21	I	93.7	Very high	90.3	Very high	90 Å²	90	93.9 Å²	93.9	46%	0.462	52%	0.515	S	S	.	.	H	α-helix	trans	-59.3	-47.8	178.9	-69.3	166.2	0	111.4	N17 N18 F19 Y23 S24 A25	N17-I21 WeakPolarHBondContact ND2-CD1 3.3Å; N17-I21 VanDerWaalsContact O-CG1 3.28Å; N17-I21 WeakPolarHBondContact O-CG1 3.49Å; N17-I21 PolarHBondContact O-N 3.31Å; N18-I21 PolarHBondContact O-N 3.48Å; F19-I21 PolarHBondContact O-N 2.93Å; I21-Y23 PolarHBondContact O-N 2.84Å; I21-S24 PolarHBondContact O-N 3.29Å; I21-A25 WeakPolarHBondContact O-CB 3.48Å; I21-A25 PolarHBondContact O-N 3.04Å
22	I	96.1	Very high	91.5	Very high	82 Å²	82	93.2 Å²	93.2	42%	0.421	51%	0.507	S	S	.	.	H	α-helix	trans	-61.8	-46.4	-179.6	-67.7	166.9	0	110.5	N18 F19 F20 A25 L26	N18-I22 VanDerWaalsContact O-CG1 3.31Å; N18-I22 WeakPolarHBondContact O-CG1 3.37Å; N18-I22 PolarHBondContact O-N 3.45Å; F19-I22 PolarHBondContact O-N 3.38Å; F20-I22 PolarHBondContact O-N 3.49Å; I22-A25 PolarHBondContact O-N 3.02Å; I22-L26 HydrophobicContact CG2-CD1 4.1Å; I22-L26 WeakPolarHBondContact O-CG 3.38Å; I22-L26 PolarHBondContact O-N 2.92Å
23	Y	96	Very high	92.7	Very high	123 Å²	123	89.4 Å²	89.4	48%	0.482	50%	0.5	S	S	.	.	H	α-helix	trans	-64.2	-42.6	179.1	-88.2	-101.5	0	112.2	F19 F20 I21 A25 L26 L27	F19-Y23 AromaticContact CD1-CD2 3.62Å; F19-Y23 HydrophobicContact CD1-CD2 3.62Å; F19-Y23 AromaticContact CD1-CE2 3.85Å; F19-Y23 HydrophobicContact CD1-CE2 3.85Å; F19-Y23 HydrophobicContact CD1-CG 4.31Å; F19-Y23 AromaticContact CD2-CD2 3.97Å; F19-Y23 HydrophobicContact CD2-CD2 3.97Å; F19-Y23 AromaticContact CD2-CE2 3.52Å; F19-Y23 HydrophobicContact CD2-CE2 3.52Å; F19-Y23 HydrophobicContact CE1-CD1 4.37Å; F19-Y23 AromaticContact CE1-CD2 3.47Å; F19-Y23 HydrophobicContact CE1-CD2 3.47Å; F19-Y23 VanDerWaalsContact CE1-CD2 3.47Å; F19-Y23 HydrophobicContact CE1-CE1 4.27Å; F19-Y23 AromaticContact CE1-CE2 3.38Å; F19-Y23 HydrophobicContact CE1-CE2 3.38Å; F19-Y23 AromaticContact CE1-CG 3.97Å; F19-Y23 HydrophobicContact CE1-CG 3.97Å; F19-Y23 AromaticContact CE1-CZ 3.77Å; F19-Y23 AromaticContact CE2-CD2 3.86Å; F19-Y23 HydrophobicContact CE2-CD2 3.86Å; F19-Y23 AromaticContact CE2-CE2 3.04Å; F19-Y23 HydrophobicContact CE2-CE2 3.04Å; F19-Y23 AromaticContact CE2-CZ 3.55Å; F19-Y23 AromaticContact CG-CD2 3.89Å; F19-Y23 HydrophobicContact CG-CD2 3.89Å; F19-Y23 AromaticContact CG-CE2 3.92Å; F19-Y23 HydrophobicContact CG-CE2 3.92Å; F19-Y23 AromaticContact CZ-CD2 3.62Å; F19-Y23 HydrophobicContact CZ-CD2 3.62Å; F19-Y23 AromaticContact CZ-CE1 3.99Å; F19-Y23 HydrophobicContact CZ-CE1 3.99Å; F19-Y23 AromaticContact CZ-CE2 2.97Å; F19-Y23 HydrophobicContact CZ-CE2 2.97Å; F19-Y23 HydrophobicContact CZ-CG 4.34Å; F19-Y23 AromaticContact CZ-CZ 3.15Å; F19-Y23 VanDerWaalsContact CZ-OH 3.3Å; F19-Y23 WeakPolarHBondContact CZ-OH 3.46Å; F19-Y23 VanDerWaalsContact O-CD2 3.23Å; F19-Y23 WeakPolarHBondContact O-CD2 3.31Å; F19-Y23 PolarHBondContact O-N 3.37Å; F20-Y23 PolarHBondContact O-N 2.95Å; I21-Y23 PolarHBondContact O-N 2.84Å; Y23-A25 VanDerWaalsContact C-N 3.34Å; Y23-A25 PolarHBondContact O-N 3.46Å; Y23-L26 PolarHBondContact O-N 3.49Å; Y23-L27 WeakPolarHBondContact O-CG 3.34Å; Y23-L27 PolarHBondContact O-N 3.34Å
24	S	96.3	Very high	93.4	Very high	50 Å²	50	91 Å²	91	35%	0.35	50%	0.503	S	S	.	.	H	α-helix	trans	-60.2	-43	175.1	-66.5	0	0	112	F20 I21 L27 L28	F20-S24 WeakPolarHBondContact O-CB 3.49Å; F20-S24 PolarHBondContact O-N 2.99Å; F20-S24 PolarHBondContact O-OG 2.93Å; F20-S24 VanDerWaalsContact O-OG 3.06Å; I21-S24 PolarHBondContact O-N 3.29Å; S24-L27 PolarHBondContact O-N 3.47Å; S24-L28 WeakPolarHBondContact O-CB 3.43Å; S24-L28 PolarHBondContact O-N 3.31Å
25	A	97	Very high	93.9	Very high	53 Å²	53	92.6 Å²	92.6	44%	0.438	50%	0.501	S	S	.	.	H	α-helix	trans	-64	-43.5	177.4	0	0	0	112	I21 I22 Y23 L28 V29	I21-A25 WeakPolarHBondContact O-CB 3.48Å; I21-A25 PolarHBondContact O-N 3.04Å; I22-A25 PolarHBondContact O-N 3.02Å; Y23-A25 VanDerWaalsContact C-N 3.34Å; Y23-A25 PolarHBondContact O-N 3.46Å; A25-L28 PolarHBondContact O-N 2.97Å; A25-V29 WeakPolarHBondContact O-CG2 3.3Å; A25-V29 PolarHBondContact O-N 3.46Å
26	L	97.6	Very high	94.2	Very high	110 Å²	110	92.6 Å²	92.6	58%	0.576	50%	0.501	S	S	*	.	H	α-helix	trans	-62.4	-44.4	177.1	-72.5	173.1	0	112.1	I22 Y23 L28 V29 L30	I22-L26 HydrophobicContact CG2-CD1 4.1Å; I22-L26 WeakPolarHBondContact O-CG 3.38Å; I22-L26 PolarHBondContact O-N 2.92Å; Y23-L26 PolarHBondContact O-N 3.49Å; L26-L28 VanDerWaalsContact C-N 3.31Å; L26-L28 PolarHBondContact O-N 3.5Å; L26-V29 PolarHBondContact O-N 3.37Å; L26-L30 WeakPolarHBondContact O-CB 3.23Å; L26-L30 PolarHBondContact O-N 2.89Å
27	L	97.3	Very high	94.2	Very high	116 Å²	116	95.9 Å²	95.9	61%	0.607	52%	0.521	S	S	*	.	H	α-helix	trans	-63.3	-38.3	177	-73.4	175	0	111.9	Y23 S24 L30 G31	Y23-L27 WeakPolarHBondContact O-CG 3.34Å; Y23-L27 PolarHBondContact O-N 3.34Å; S24-L27 PolarHBondContact O-N 3.47Å; L27-L30 PolarHBondContact O-N 2.96Å; L27-G31 PolarHBondContact O-N 3Å
28	L	97.4	Very high	93.9	Very high	111 Å²	111	95.8 Å²	95.8	58%	0.581	53%	0.532	S	S	*	.	H	α-helix	trans	-65.2	-46.8	176.4	-176.3	135.7	0	111.4	S24 A25 L26 L30 G31 L32	S24-L28 WeakPolarHBondContact O-CB 3.43Å; S24-L28 PolarHBondContact O-N 3.31Å; A25-L28 PolarHBondContact O-N 2.97Å; L26-L28 VanDerWaalsContact C-N 3.31Å; L26-L28 PolarHBondContact O-N 3.5Å; L28-L30 PolarHBondContact O-N 3.42Å; L28-G31 PolarHBondContact O-N 3.44Å; L28-L32 HydrophobicContact CD2-CD1 3.74Å; L28-L32 HydrophobicContact CG-CD1 4.44Å; L28-L32 WeakPolarHBondContact O-CG 3.43Å; L28-L32 PolarHBondContact O-N 3.4Å
29	V	97.3	Very high	93.2	Very high	79 Å²	79	101 Å²	101	48%	0.479	56%	0.559	S	S	.	*	H	α-helix	trans	-60.9	-46.2	176.2	172.2	0	0	110.7	A25 L26 G31 L32 L33	A25-V29 WeakPolarHBondContact O-CG2 3.3Å; A25-V29 PolarHBondContact O-N 3.46Å; L26-V29 PolarHBondContact O-N 3.37Å; V29-G31 PolarHBondContact O-N 2.99Å; V29-L32 PolarHBondContact O-N 3.49Å; V29-L33 HydrophobicContact CG1-CD1 3.95Å; V29-L33 HydrophobicContact CG1-CG 4.45Å; V29-L33 VanDerWaalsContact O-CG 3.3Å; V29-L33 WeakPolarHBondContact O-CG 3.28Å; V29-L33 PolarHBondContact O-N 3.36Å
30	L	97.2	Very high	93.3	Very high	93 Å²	93	100.2 Å²	100.2	49%	0.487	56%	0.561	S	S	.	*	H	α-helix	trans	-61.1	-44.5	177.6	-178.1	61.8	0	111.6	L26 L27 L28 L32 L33 L34	L26-L30 WeakPolarHBondContact O-CB 3.23Å; L26-L30 PolarHBondContact O-N 2.89Å; L27-L30 PolarHBondContact O-N 2.96Å; L28-L30 PolarHBondContact O-N 3.42Å; L30-L32 PolarHBondContact O-N 3.34Å; L30-L33 PolarHBondContact O-N 2.84Å; L30-L34 HydrophobicContact CD1-CD1 4.23Å; L30-L34 HydrophobicContact CD1-CG 4.27Å; L30-L34 HydrophobicContact CG-CD1 4.03Å; L30-L34 HydrophobicContact CG-CG 4.47Å; L30-L34 WeakPolarHBondContact O-CB 3.38Å; L30-L34 VanDerWaalsContact O-CG 3.3Å; L30-L34 WeakPolarHBondContact O-CG 3.47Å; L30-L34 PolarHBondContact O-N 2.69Å
31	G	96.6	Very high	93.3	Very high	37 Å²	37	98.6 Å²	98.6	38%	0.381	56%	0.561	S	S	.	*	H	α-helix	trans	-61.3	-42.2	177.1	0	0	0	112.6	L27 L28 V29 L34 N35	L27-G31 PolarHBondContact O-N 3Å; L28-G31 PolarHBondContact O-N 3.44Å; V29-G31 PolarHBondContact O-N 2.99Å; G31-L34 PolarHBondContact O-N 2.84Å; G31-N35 VanDerWaalsContact O-CB 3.25Å; G31-N35 WeakPolarHBondContact O-CB 3.33Å; G31-N35 PolarHBondContact O-N 2.89Å
32	L	95.8	Very high	93.3	Very high	101 Å²	101	99.1 Å²	99.1	53%	0.529	57%	0.566	S	S	.	*	H	α-helix	trans	-63	-45.9	175.3	-72.2	173.3	0	111.6	L28 V29 L30 L34 N35 S36	L28-L32 HydrophobicContact CD2-CD1 3.74Å; L28-L32 HydrophobicContact CG-CD1 4.44Å; L28-L32 WeakPolarHBondContact O-CG 3.43Å; L28-L32 PolarHBondContact O-N 3.4Å; V29-L32 PolarHBondContact O-N 3.49Å; L30-L32 PolarHBondContact O-N 3.34Å; L32-L34 PolarHBondContact O-N 3.06Å; L32-N35 PolarHBondContact O-N 3.31Å; L32-S36 WeakPolarHBondContact O-CB 3.5Å; L32-S36 PolarHBondContact O-N 3.11Å; L32-S36 PolarHBondContact O-OG 2.83Å; L32-S36 VanDerWaalsContact O-OG 3.07Å
33	L	95.4	Very high	93.1	Very high	106 Å²	106	100.1 Å²	100.1	56%	0.555	58%	0.575	S	S	*	*	H	α-helix	trans	-60	-47.7	177.8	-71.4	168.2	0	111.5	V29 L30 N35 S36 V37	V29-L33 HydrophobicContact CG1-CD1 3.95Å; V29-L33 HydrophobicContact CG1-CG 4.45Å; V29-L33 VanDerWaalsContact O-CG 3.3Å; V29-L33 WeakPolarHBondContact O-CG 3.28Å; V29-L33 PolarHBondContact O-N 3.36Å; L30-L33 PolarHBondContact O-N 2.84Å; L33-N35 VanDerWaalsContact C-N 3.33Å; L33-N35 PolarHBondContact O-N 3.03Å; L33-S36 PolarHBondContact O-N 3.39Å; L33-V37 WeakPolarHBondContact O-CG2 3.49Å; L33-V37 PolarHBondContact O-N 3.44Å
34	L	95.9	Very high	92.9	Very high	110 Å²	110	98.7 Å²	98.7	58%	0.576	58%	0.581	S	S	*	*	H	α-helix	trans	-63.3	-40.3	178.5	-69.5	173.1	0	111.7	L30 G31 L32 V37 A38	L30-L34 HydrophobicContact CD1-CD1 4.23Å; L30-L34 HydrophobicContact CD1-CG 4.27Å; L30-L34 HydrophobicContact CG-CD1 4.03Å; L30-L34 HydrophobicContact CG-CG 4.47Å; L30-L34 WeakPolarHBondContact O-CB 3.38Å; L30-L34 VanDerWaalsContact O-CG 3.3Å; L30-L34 WeakPolarHBondContact O-CG 3.47Å; L30-L34 PolarHBondContact O-N 2.69Å; G31-L34 PolarHBondContact O-N 2.84Å; L32-L34 PolarHBondContact O-N 3.06Å; L34-V37 PolarHBondContact O-N 2.83Å; L34-A38 WeakPolarHBondContact O-CB 3.4Å; L34-A38 PolarHBondContact O-N 3.24Å
35	N	93.1	Very high	92.7	Very high	114 Å²	114	101.9 Å²	101.9	61%	0.61	60%	0.596	S	S	*	*	H	α-helix	trans	-67.4	-38	177.7	-168.2	38.8	0	112.1	G31 L32 L33 V37 A38 L39	G31-N35 VanDerWaalsContact O-CB 3.25Å; G31-N35 WeakPolarHBondContact O-CB 3.33Å; G31-N35 PolarHBondContact O-N 2.89Å; L32-N35 PolarHBondContact O-N 3.31Å; L33-N35 VanDerWaalsContact C-N 3.33Å; L33-N35 PolarHBondContact O-N 3.03Å; N35-V37 VanDerWaalsContact C-N 3.3Å; N35-V37 PolarHBondContact O-N 2.86Å; N35-A38 PolarHBondContact O-N 3.3Å; N35-L39 PolarHBondContact O-N 2.84Å
36	S	88	Confident	92.4	Very high	87 Å²	87	105.4 Å²	105.4	61%	0.608	61%	0.608	S	S	*	*	H	α-helix	trans	-67.3	-28.9	174.5	-63.6	0	0	113.4	L32 L33	L32-S36 WeakPolarHBondContact O-CB 3.5Å; L32-S36 PolarHBondContact O-N 3.11Å; L32-S36 PolarHBondContact O-OG 2.83Å; L32-S36 VanDerWaalsContact O-OG 3.07Å; L33-S36 PolarHBondContact O-N 3.39Å
37	V	86.5	Confident	92	Very high	124 Å²	124	105.1 Å²	105.1	75%	0.752	61%	0.61	S	S	*	*	H	α-helix	trans	-78.9	-30.5	175.2	172.8	0	0	111.8	L33 L34 N35 L39	L33-V37 WeakPolarHBondContact O-CG2 3.49Å; L33-V37 PolarHBondContact O-N 3.44Å; L34-V37 PolarHBondContact O-N 2.83Å; N35-V37 VanDerWaalsContact C-N 3.3Å; N35-V37 PolarHBondContact O-N 2.86Å; V37-L39 VanDerWaalsContact C-N 3.31Å
38	A	82.8	Confident	91.5	Very high	85 Å²	85	104.2 Å²	104.2	70%	0.702	61%	0.61	S	S	*	*	H	α-helix	trans	-75	-20.5	179.4	0	0	0	113.6	L34 N35	L34-A38 WeakPolarHBondContact O-CB 3.4Å; L34-A38 PolarHBondContact O-N 3.24Å; N35-A38 PolarHBondContact O-N 3.3Å
39	L	72.4	Confident	91	Very high	203 Å²	203	103.5 Å²	103.5	100%	1.063	61%	0.613	S	S	*	*			trans	-81.9	0	176	-176.1	63.5	0	111.5	N35 V37	N35-L39 PolarHBondContact O-N 2.84Å; V37-L39 VanDerWaalsContact C-N 3.31Å

Retrieved 39 of 39 residues in 123.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).