A0A087WPP9_MOUSE Loading...

Origin recognition complex, subunit 2

AlphaFold DB , UniProt , Accession A0A087WPP9, Species MOUSE (Mus musculus, Mouse), Gene Orc2, Length 47 aa.

						>A0A087WPP9_MOUSE|A0A087WPP9|Orc2
MTKLALELAKTSGKKDPLDSNDPEITKNIAQKSKGHSTSEKAPLVNN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.7	Low	68.5	Low	215 Å²	215	123.5 Å²	123.5	100%	1.059	66%	0.66	S	S	*	*				0	-32.9	0	-87	176.2	-103.4	0	113.8	K3 L4	M1-K3 PolarHBondContact O-N 3.24Å; M1-K3 VanDerWaalsContact C-N 3.31Å; M1-L4 PolarHBondContact O-N 3.48Å
2	T	63.8	Low	67.8	Low	123 Å²	123	121.3 Å²	121.3	76%	0.755	66%	0.661	S	S	*	*	H	α-helix	trans	-63.3	-29	-175.2	-22	0	0	0	115.2	L4 A5 L6	T2-L4 PolarHBondContact O-N 3.47Å; T2-A5 PolarHBondContact O-N 3.16Å; T2-L6 PolarHBondContact O-N 3.25Å
3	K	72.6	Confident	67	Low	184 Å²	184	117 Å²	117	80%	0.8	66%	0.662	S	S	*	*	H	α-helix	trans	-65.1	-37.8	-177.6	-64	-175.4	179.2	-177.4	113	M1 E7	M1-K3 PolarHBondContact O-N 3.24Å; M1-K3 VanDerWaalsContact C-N 3.31Å; K3-E7 PolarHBondContact O-N 3.27Å
4	L	72.1	Confident	66.3	Low	117 Å²	117	120.2 Å²	120.2	61%	0.613	67%	0.665	S	S	*	*	H	α-helix	trans	-72.4	-39.7	-179.8	-63.9	173	0	0	111.7	M1 T2 L6 E7 L8	M1-L4 PolarHBondContact O-N 3.48Å; T2-L4 PolarHBondContact O-N 3.47Å; L4-L6 VanDerWaalsContact C-N 3.33Å; L4-L6 PolarHBondContact O-N 3.46Å; L4-E7 PolarHBondContact O-N 3Å; L4-L8 WeakPolarHBondContact O-CG 3.3Å; L4-L8 PolarHBondContact O-N 3Å
5	A	70.7	Confident	65.7	Low	62 Å²	62	125.3 Å²	125.3	51%	0.512	68%	0.678	S	S	.	*	H	α-helix	trans	-64.4	-37.6	177.5	0	0	0	0	112.3	T2 A9	T2-A5 PolarHBondContact O-N 3.16Å; A5-A9 PolarHBondContact O-N 3.46Å; A5-A9 WeakPolarHBondContact O-CB 3.29Å
6	L	74.4	Confident	65.1	Low	104 Å²	104	125.3 Å²	125.3	55%	0.545	68%	0.677	S	S	.	*	H	α-helix	trans	-68.4	-35.8	176.4	-177.4	62.1	0	0	112.3	T2 L4 K10	T2-L6 PolarHBondContact O-N 3.25Å; L4-L6 VanDerWaalsContact C-N 3.33Å; L4-L6 PolarHBondContact O-N 3.46Å; L6-K10 VanDerWaalsContact O-CG 3.3Å; L6-K10 WeakPolarHBondContact O-CG 3.35Å; L6-K10 PolarHBondContact O-N 3.36Å; L6-K10 VanDerWaalsContact O-N 3.16Å
7	E	74.3	Confident	64.6	Low	125 Å²	125	124.7 Å²	124.7	58%	0.584	68%	0.682	S	S	*	*	H	α-helix	trans	-68.7	-42.7	177	-168.3	169	-177.3	0	111.5	K3 L4 A9 K10 T11	K3-E7 PolarHBondContact O-N 3.27Å; L4-E7 PolarHBondContact O-N 3Å; E7-A9 PolarHBondContact O-N 3.27Å; E7-K10 PolarHBondContact O-N 3.26Å; E7-T11 PolarHBondContact O-N 3.28Å; E7-T11 PolarHBondContact O-OG1 3.49Å
8	L	68	Low	64.1	Low	120 Å²	120	124.6 Å²	124.6	63%	0.628	68%	0.68	S	S	*	*	H	α-helix	trans	-66.3	-34.3	174.1	-66.4	173.7	0	0	113	L4 K10 T11 S12	L4-L8 WeakPolarHBondContact O-CG 3.3Å; L4-L8 PolarHBondContact O-N 3Å; L8-K10 VanDerWaalsContact C-N 3.34Å; L8-T11 PolarHBondContact O-OG1 3.44Å; L8-T11 PolarHBondContact O-N 2.99Å; L8-S12 VanDerWaalsContact O-CB 3.29Å; L8-S12 WeakPolarHBondContact O-CB 3.41Å; L8-S12 PolarHBondContact O-N 3.44Å
9	A	68.1	Low	63.7	Low	63 Å²	63	124.7 Å²	124.7	52%	0.521	68%	0.68	S	S	.	*	H	α-helix	trans	-68.1	-34.6	175	0	0	0	0	112.4	A5 E7 T11 G13	A5-A9 PolarHBondContact O-N 3.46Å; A5-A9 WeakPolarHBondContact O-CB 3.29Å; E7-A9 PolarHBondContact O-N 3.27Å; A9-T11 VanDerWaalsContact C-N 3.34Å; A9-G13 PolarHBondContact O-N 3.03Å
10	K	69.9	Low	63.4	Low	149 Å²	149	120.8 Å²	120.8	65%	0.648	66%	0.661	S	S	*	*	H	α-helix	trans	-69	-31.6	176.7	-74.8	171.7	-179.5	-178.7	112.5	L6 E7 L8	L6-K10 VanDerWaalsContact O-CG 3.3Å; L6-K10 WeakPolarHBondContact O-CG 3.35Å; L6-K10 PolarHBondContact O-N 3.36Å; L6-K10 VanDerWaalsContact O-N 3.16Å; E7-K10 PolarHBondContact O-N 3.26Å; L8-K10 VanDerWaalsContact C-N 3.34Å
11	T	63	Low	63	Low	97 Å²	97	121.8 Å²	121.8	60%	0.595	67%	0.666	S	S	*	*	H	α-helix	trans	-84.3	-32.1	177.6	56.9	0	0	0	112.6	E7 L8 A9 G13	E7-T11 PolarHBondContact O-N 3.28Å; E7-T11 PolarHBondContact O-OG1 3.49Å; L8-T11 PolarHBondContact O-OG1 3.44Å; L8-T11 PolarHBondContact O-N 2.99Å; A9-T11 VanDerWaalsContact C-N 3.34Å; T11-G13 VanDerWaalsContact C-N 3.29Å; T11-G13 PolarHBondContact O-N 3.47Å
12	S	59.7	Low	63.1	Low	96 Å²	96	115.2 Å²	115.2	67%	0.671	64%	0.635	S	S	*	*	H	α-helix	trans	-72	-15.1	178.1	178.4	0	0	0	114.7	L8	L8-S12 VanDerWaalsContact O-CB 3.29Å; L8-S12 WeakPolarHBondContact O-CB 3.41Å; L8-S12 PolarHBondContact O-N 3.44Å
13	G	57.9	Low	62.8	Low	66 Å²	66	113.4 Å²	113.4	68%	0.68	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.2	-15.5	-177.5	0	0	0	0	114.8	A9 T11 K15	A9-G13 PolarHBondContact O-N 3.03Å; T11-G13 VanDerWaalsContact C-N 3.29Å; T11-G13 PolarHBondContact O-N 3.47Å; G13-K15 PolarHBondContact O-N 3.28Å
14	K	56.7	Low	62.2	Low	162 Å²	162	111.1 Å²	111.1	70%	0.704	62%	0.618	S	S	*	*			trans	-89.9	84.8	170.2	-63.7	-164.2	-179.1	-173.6	108.1	D16	K14-D16 PolarHBondContact O-N 2.98Å
15	K	57.2	Low	61.5	Low	196 Å²	196	108.4 Å²	108.4	85%	0.852	60%	0.603	S	S	*	*			trans	-65.2	93.9	145.5	-74.8	-176.4	-178.9	177.7	104.3	G13	G13-K15 PolarHBondContact O-N 3.28Å
16	D	57.2	Low	60.9	Low	125 Å²	125	109.4 Å²	109.4	67%	0.668	60%	0.603	S	S	*	*			trans	-46.8	128.5	156.4	-69.6	-39.6	0	0	105.2	K14 L18	K14-D16 PolarHBondContact O-N 2.98Å; D16-L18 VanDerWaalsContact C-N 3.29Å; D16-L18 PolarHBondContact O-N 2.73Å
17	P	55.2	Low	60.1	Low	116 Å²	116	111 Å²	111	75%	0.753	61%	0.606	S	S	*	*			trans	-52.7	112.9	165.2	-9.4	21.8	0	0	103	D19	P17-D19 VanDerWaalsContact C-N 3.27Å; P17-D19 PolarHBondContact O-N 2.81Å
18	L	56.7	Low	59.2	Low	123 Å²	123	110.3 Å²	110.3	64%	0.644	61%	0.606	S	S	*	*			trans	-48.1	105.4	175.5	-179.5	68.4	0	0	104.3	D16 S20 I25	D16-L18 VanDerWaalsContact C-N 3.29Å; D16-L18 PolarHBondContact O-N 2.73Å; L18-S20 WeakPolarHBondContact CD2-OG 3.19Å; L18-S20 WeakPolarHBondContact CG-OG 3.38Å; L18-S20 PolarHBondContact O-N 2.69Å; L18-I25 HydrophobicContact CD1-CD1 4.22Å
19	D	56.1	Low	58.8	Low	127 Å²	127	110.3 Å²	110.3	68%	0.679	61%	0.605	S	S	*	*			trans	-71.6	73.4	173.2	-174.9	5.1	0	0	104.4	P17 N21	P17-D19 VanDerWaalsContact C-N 3.27Å; P17-D19 PolarHBondContact O-N 2.81Å; D19-N21 PolarHBondContact OD1-ND2 3.05Å; D19-N21 PolarHBondContact O-N 2.96Å
20	S	57.8	Low	58.3	Low	45 Å²	45	110.9 Å²	110.9	32%	0.315	61%	0.61	S	S	.	*			trans	-82.7	38.2	-171.7	-130.2	0	0	0	109	L18 D22	L18-S20 WeakPolarHBondContact CD2-OG 3.19Å; L18-S20 WeakPolarHBondContact CG-OG 3.38Å; L18-S20 PolarHBondContact O-N 2.69Å; S20-D22 PolarHBondContact O-N 3.37Å
21	N	55.6	Low	57.8	Low	143 Å²	143	111.5 Å²	111.5	77%	0.765	62%	0.615	S	S	*	*			trans	-75.4	9.5	158.5	-84.7	-58.6	0	0	111.8	D19 P23	D19-N21 PolarHBondContact OD1-ND2 3.05Å; D19-N21 PolarHBondContact O-N 2.96Å; N21-P23 WeakPolarHBondContact O-CD 3.13Å
22	D	58.1	Low	57.8	Low	76 Å²	76	115.9 Å²	115.9	41%	0.406	63%	0.626	S	S	.	*			trans	-79.8	104.7	168.9	-153.9	-22	0	0	109.3	S20 E24 I25	S20-D22 PolarHBondContact O-N 3.37Å; D22-E24 PolarHBondContact O-N 3.3Å; D22-I25 HydrophobicContact CB-CD1 3.89Å; D22-I25 HydrophobicContact CB-CG1 4.07Å; D22-I25 PolarHBondContact O-N 3.39Å; D22-I25 VanDerWaalsContact O-N 3.09Å
23	P	57.8	Low	57.8	Low	86 Å²	86	116.5 Å²	116.5	56%	0.558	63%	0.63	S	S	*	*	H	α-helix	trans	-63.7	-10.2	-177.3	28.1	-35.1	0	0	112.4	N21 K27	N21-P23 WeakPolarHBondContact O-CD 3.13Å; P23-K27 WeakPolarHBondContact O-CD 3.44Å; P23-K27 WeakPolarHBondContact O-CE 3.31Å; P23-K27 VanDerWaalsContact O-CG 3.31Å; P23-K27 WeakPolarHBondContact O-CG 3.39Å
24	E	59.1	Low	58	Low	136 Å²	136	122.3 Å²	122.3	64%	0.636	64%	0.637	S	S	*	*	H	α-helix	trans	-76.2	-33.7	176	-144.7	168.8	-160.7	0	112.5	D22	D22-E24 PolarHBondContact O-N 3.3Å
25	I	57.8	Low	58.4	Low	60 Å²	60	118.1 Å²	118.1	31%	0.308	64%	0.64	S	S	.	*	H	α-helix	trans	-71.3	-39.5	179.5	-61	174.9	0	0	110.7	L18 D22 K27 N28 I29	L18-I25 HydrophobicContact CD1-CD1 4.22Å; D22-I25 HydrophobicContact CB-CD1 3.89Å; D22-I25 HydrophobicContact CB-CG1 4.07Å; D22-I25 PolarHBondContact O-N 3.39Å; D22-I25 VanDerWaalsContact O-N 3.09Å; I25-K27 VanDerWaalsContact C-N 3.3Å; I25-K27 PolarHBondContact O-N 3.41Å; I25-N28 PolarHBondContact O-N 3.32Å; I25-I29 HydrophobicContact CG2-CD1 4.4Å
26	T	57.6	Low	58.8	Low	82 Å²	82	117.7 Å²	117.7	50%	0.503	64%	0.64	S	S	.	*	H	α-helix	trans	-67.3	-30.8	-176.4	-33.4	0	0	0	112.5	N28 I29	T26-N28 VanDerWaalsContact C-N 3.3Å; T26-N28 PolarHBondContact O-N 3.37Å; T26-I29 PolarHBondContact O-N 3.09Å
27	K	57.9	Low	59.1	Low	139 Å²	139	116.9 Å²	116.9	60%	0.604	65%	0.645	S	S	*	*	H	α-helix	trans	-65.9	-32.3	179.3	-70.7	171	-170.7	179.3	112.6	P23 I25	P23-K27 WeakPolarHBondContact O-CD 3.44Å; P23-K27 WeakPolarHBondContact O-CE 3.31Å; P23-K27 VanDerWaalsContact O-CG 3.31Å; P23-K27 WeakPolarHBondContact O-CG 3.39Å; I25-K27 VanDerWaalsContact C-N 3.3Å; I25-K27 PolarHBondContact O-N 3.41Å
28	N	56.9	Low	59.7	Low	109 Å²	109	117.5 Å²	117.5	58%	0.583	65%	0.646	S	S	*	*	H	α-helix	trans	-82.1	-15.4	-177.3	-69	-11.7	0	0	113.5	I25 T26	I25-N28 PolarHBondContact O-N 3.32Å; T26-N28 VanDerWaalsContact C-N 3.3Å; T26-N28 PolarHBondContact O-N 3.37Å
29	I	58.7	Low	60.1	Low	121 Å²	121	115.7 Å²	115.7	62%	0.621	64%	0.644	S	S	*	*	H	α-helix	trans	-83.1	-36.3	178.3	-60.8	168.7	0	0	110.5	I25 T26 Q31 K32	I25-I29 HydrophobicContact CG2-CD1 4.4Å; T26-I29 PolarHBondContact O-N 3.09Å; I29-Q31 VanDerWaalsContact C-N 3.29Å; I29-Q31 PolarHBondContact O-N 2.98Å; I29-K32 PolarHBondContact O-N 3.29Å
30	A	58.2	Low	60.7	Low	75 Å²	75	118 Å²	118	62%	0.62	65%	0.651	S	S	*	*	H	α-helix	trans	-66.7	-25.4	-178.4	0	0	0	0	114	K32	A30-K32 PolarHBondContact O-N 3.07Å
31	Q	59	Low	61.3	Low	161 Å²	161	124.4 Å²	124.4	75%	0.752	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.6	-0.3	-176.6	-69.1	-167.9	-58.1	0	115.1	I29	I29-Q31 VanDerWaalsContact C-N 3.29Å; I29-Q31 PolarHBondContact O-N 2.98Å
32	K	61.9	Low	62.1	Low	190 Å²	190	121.5 Å²	121.5	83%	0.826	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.8	13.9	-180	-72.7	-170.5	177	179.1	115.3	I29 A30 K34	I29-K32 PolarHBondContact O-N 3.29Å; A30-K32 PolarHBondContact O-N 3.07Å; K32-K34 VanDerWaalsContact C-N 3.27Å; K32-K34 PolarHBondContact O-N 3.18Å
33	S	61	Low	62.2	Low	108 Å²	108	123.4 Å²	123.4	76%	0.755	69%	0.685	S	S	*	*			trans	-89.9	61.4	164.8	68.6	0	0	0	111.3	G35	S33-G35 PolarHBondContact O-N 3.43Å
34	K	62.7	Low	62.7	Low	189 Å²	189	126 Å²	126	82%	0.822	69%	0.693	S	S	*	*			trans	-71.8	107	158.6	-88.6	-175.5	175.5	178.7	106.5	K32 H36	K32-K34 VanDerWaalsContact C-N 3.27Å; K32-K34 PolarHBondContact O-N 3.18Å; K34-H36 PolarHBondContact O-N 3.14Å
35	G	64.9	Low	62.7	Low	74 Å²	74	125.1 Å²	125.1	76%	0.763	70%	0.697	S	S	*	*			trans	-43.1	125.9	-174.9	0	0	0	0	113.4	S33 S37	S33-G35 PolarHBondContact O-N 3.43Å; G35-S37 VanDerWaalsContact C-N 3.34Å; G35-S37 PolarHBondContact O-N 2.93Å
36	H	64.8	Low	63.2	Low	186 Å²	186	128.2 Å²	128.2	86%	0.861	72%	0.715	S	S	*	*			trans	-72.6	92.8	163.9	-69.2	-61.9	0	0	108.1	K34 T38	K34-H36 PolarHBondContact O-N 3.14Å; H36-T38 PolarHBondContact O-N 3.12Å
37	S	64	Low	63.1	Low	109 Å²	109	135.3 Å²	135.3	76%	0.762	75%	0.749	S	S	*	*			trans	-88.3	92.2	160	-173.4	0	0	0	107.6	G35 S39	G35-S37 VanDerWaalsContact C-N 3.34Å; G35-S37 PolarHBondContact O-N 2.93Å; S37-S39 PolarHBondContact O-N 3.46Å; S37-S39 VanDerWaalsContact O-N 3.12Å
38	T	67.1	Low	63.4	Low	128 Å²	128	135.1 Å²	135.1	79%	0.785	76%	0.756	S	S	*	*			trans	-78.9	81.6	162.9	52.7	0	0	0	107.3	H36 E40	H36-T38 PolarHBondContact O-N 3.12Å; T38-E40 PolarHBondContact O-N 3.05Å
39	S	65.1	Low	63.7	Low	85 Å²	85	136.5 Å²	136.5	59%	0.594	77%	0.766	S	S	*	*			trans	-73.6	83.5	163.4	-170.7	0	0	0	107.4	S37 K41	S37-S39 PolarHBondContact O-N 3.46Å; S37-S39 VanDerWaalsContact O-N 3.12Å; S39-K41 PolarHBondContact O-N 3.33Å; S39-K41 VanDerWaalsContact O-N 3.14Å
40	E	69.6	Low	64	Low	177 Å²	177	137.3 Å²	137.3	83%	0.827	77%	0.774	S	S	*	*			trans	-66.1	106.6	163.8	-169.9	175.6	172.8	0	107	T38 A42	T38-E40 PolarHBondContact O-N 3.05Å; E40-A42 PolarHBondContact O-N 3.17Å
41	K	70.3	Confident	64.3	Low	178 Å²	178	141 Å²	141	77%	0.774	78%	0.783	S	S	*	*			trans	-78.9	112.3	165.7	-69.8	-71.6	-176.2	-176.2	106.3	S39	S39-K41 PolarHBondContact O-N 3.33Å; S39-K41 VanDerWaalsContact O-N 3.14Å
42	A	71.7	Confident	64.7	Low	82 Å²	82	139.8 Å²	139.8	68%	0.678	79%	0.785	S	S	*	*			trans	-55.6	140.1	172.2	0	0	0	0	110.3	E40 L44	E40-A42 PolarHBondContact O-N 3.17Å; A42-L44 PolarHBondContact O-N 3.24Å
43	P	60.7	Low	64.9	Low	116 Å²	116	136.4 Å²	136.4	75%	0.753	78%	0.782	S	S	*	*			trans	-68.4	116.2	172.4	26.6	-30	0	0	108.8	V45	P43-V45 PolarHBondContact O-N 3.46Å; P43-V45 VanDerWaalsContact O-N 3.07Å
44	L	68.2	Low	65.1	Low	140 Å²	140	138.4 Å²	138.4	73%	0.733	78%	0.784	S	S	*	*			trans	-70.6	99.9	170	-179.3	68.9	0	0	108	A42 N46	A42-L44 PolarHBondContact O-N 3.24Å; L44-N46 VanDerWaalsContact CD2-OD1 3.29Å; L44-N46 WeakPolarHBondContact CD2-OD1 3.22Å; L44-N46 WeakPolarHBondContact CG-OD1 3.29Å; L44-N46 PolarHBondContact O-N 3.46Å
45	V	58	Low	65.3	Low	118 Å²	118	134.5 Å²	134.5	72%	0.715	78%	0.781	S	S	*	*			trans	-75.8	105.2	166.8	-177.4	0	0	0	106.9	P43	P43-V45 PolarHBondContact O-N 3.46Å; P43-V45 VanDerWaalsContact O-N 3.07Å
46	N	68.4	Low	65.3	Low	126 Å²	126	139.6 Å²	139.6	67%	0.674	78%	0.782	S	S	*	*			trans	-86.5	121.7	166.8	-64.9	-32.1	0	0	107.4	L44	L44-N46 VanDerWaalsContact CD2-OD1 3.29Å; L44-N46 WeakPolarHBondContact CD2-OD1 3.22Å; L44-N46 WeakPolarHBondContact CG-OD1 3.29Å; L44-N46 PolarHBondContact O-N 3.46Å
47	N	56.4	Low	65.4	Low	230 Å²	230	135.4 Å²	135.4	100%	1.23	78%	0.775	S	S	*	*			trans	-71.8	0	169.6	-80.1	-27.5	0	0	111.4

Retrieved 47 of 47 residues in 71.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).