A0A087WPQ3_MOUSE Loading...

Solute carrier family 16 (monocarboxylic acid transporters), member 13

AlphaFold DB , UniProt , Accession A0A087WPQ3, Species MOUSE (Mus musculus, Mouse), Gene Slc16a13, Length 41 aa.

						>A0A087WPQ3_MOUSE|A0A087WPQ3|Slc16a13
MACLSRYFSQRRSLAMGLALTGVGISSFAFAPLFQWLINNY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.1	Low	59.6	Low	242 Å²	242	135.7 Å²	135.7	100%	1.192	68%	0.679	S	S	*	*				0	50.9	0	-145.1	140.9	173.2	0	0	111.2
2	A	57.2	Low	59.9	Low	69 Å²	69	140.3 Å²	140.3	57%	0.57	68%	0.682	S	S	*	*			trans	-127.1	-19.6	-176.3	0	0	0	0	0	113.3	R6	A2-R6 PolarHBondContact O-N 3Å
3	C	60.2	Low	60.7	Low	110 Å²	110	135.4 Å²	135.4	74%	0.743	67%	0.671	S	S	*	*	H	α-helix	trans	-69.8	-36.4	-175.6	-52.7	0	0	0	0	112.8	R6 Y7	C3-R6 PolarHBondContact O-N 3.18Å; C3-Y7 PolarHBondContact O-N 3.38Å
4	L	59	Low	61.7	Low	140 Å²	140	132.9 Å²	132.9	73%	0.733	66%	0.661	S	S	*	*	H	α-helix	trans	-71.2	-40.2	178.8	-64.1	173.9	0	0	0	112.3	R6 Y7 F8	L4-R6 VanDerWaalsContact C-N 3.29Å; L4-R6 PolarHBondContact O-N 3.43Å; L4-Y7 PolarHBondContact O-N 3.2Å; L4-F8 PolarHBondContact O-N 3.34Å
5	S	59.7	Low	62.9	Low	81 Å²	81	127.9 Å²	127.9	57%	0.566	65%	0.648	S	S	*	*	H	α-helix	trans	-62.6	-38.8	175.8	-42	0	0	0	0	111.1	S9	S5-S9 WeakPolarHBondContact O-CB 3.14Å; S5-S9 PolarHBondContact O-N 2.77Å
6	R	61.2	Low	63.9	Low	190 Å²	190	127.4 Å²	127.4	72%	0.717	65%	0.645	S	S	*	*	H	α-helix	trans	-69.4	-35.5	175.1	-166.4	170	177.2	-165.2	-1.5	112.1	A2 C3 L4 S9 Q10	A2-R6 PolarHBondContact O-N 3Å; C3-R6 PolarHBondContact O-N 3.18Å; L4-R6 VanDerWaalsContact C-N 3.29Å; L4-R6 PolarHBondContact O-N 3.43Å; R6-S9 PolarHBondContact O-N 2.75Å; R6-Q10 WeakPolarHBondContact O-CB 3.15Å; R6-Q10 PolarHBondContact O-N 2.9Å
7	Y	61.9	Low	64.8	Low	145 Å²	145	121.8 Å²	121.8	57%	0.569	63%	0.626	S	S	*	*	H	α-helix	trans	-69	-41.6	177.8	-148.2	-94.8	0	0	0	112.7	C3 L4 Q10 R11	C3-Y7 PolarHBondContact O-N 3.38Å; L4-Y7 PolarHBondContact O-N 3.2Å; Y7-Q10 PolarHBondContact O-N 3.49Å; Y7-R11 PolarHBondContact O-N 3.05Å
8	F	58.8	Low	65.7	Low	165 Å²	165	121.9 Å²	121.9	72%	0.724	63%	0.627	S	S	*	*	H	α-helix	trans	-69.2	-39	172.3	-95.2	-88.5	0	0	0	112.5	L4 Q10 R12	L4-F8 PolarHBondContact O-N 3.34Å; F8-Q10 VanDerWaalsContact C-N 3.33Å; F8-R12 PolarHBondContact O-N 3.48Å
9	S	58.8	Low	66.5	Low	74 Å²	74	119 Å²	119	52%	0.517	62%	0.624	S	S	.	*	H	α-helix	trans	-68.5	-32.5	175.7	-168.2	0	0	0	0	112	S5 R6 R12 S13	S5-S9 WeakPolarHBondContact O-CB 3.14Å; S5-S9 PolarHBondContact O-N 2.77Å; R6-S9 PolarHBondContact O-N 2.75Å; S9-R12 PolarHBondContact O-N 3.27Å; S9-S13 WeakPolarHBondContact O-CB 3.1Å; S9-S13 PolarHBondContact O-N 3.46Å
10	Q	61.7	Low	67.1	Low	101 Å²	101	119.3 Å²	119.3	47%	0.472	63%	0.625	S	S	.	*	H	α-helix	trans	-67.2	-41.2	178.5	-174.3	154.8	42.5	0	0	112	R6 Y7 F8 R12 L14	R6-Q10 WeakPolarHBondContact O-CB 3.15Å; R6-Q10 PolarHBondContact O-N 2.9Å; Y7-Q10 PolarHBondContact O-N 3.49Å; F8-Q10 VanDerWaalsContact C-N 3.33Å; Q10-R12 VanDerWaalsContact C-N 3.32Å; Q10-R12 PolarHBondContact O-N 3.46Å; Q10-L14 HydrophobicContact CG-CD1 3.69Å; Q10-L14 HydrophobicContact CG-CG 4.2Å; Q10-L14 WeakPolarHBondContact O-CB 3.38Å; Q10-L14 WeakPolarHBondContact O-CD1 3.16Å; Q10-L14 WeakPolarHBondContact O-CG 3.09Å; Q10-L14 PolarHBondContact O-N 2.93Å
11	R	64.9	Low	67.8	Low	176 Å²	176	117.1 Å²	117.1	66%	0.664	62%	0.617	S	S	*	*	H	α-helix	trans	-64.4	-37.9	173.2	-70.3	-174.7	-177.1	-161.7	-0	112.3	Y7 A15	Y7-R11 PolarHBondContact O-N 3.05Å; R11-A15 WeakPolarHBondContact O-CB 3.14Å; R11-A15 PolarHBondContact O-N 2.79Å
12	R	63.4	Low	69.2	Low	190 Å²	190	107.2 Å²	107.2	72%	0.717	58%	0.577	S	S	*	*	H	α-helix	trans	-73.7	-38.8	179.6	-149.2	171.9	-174.6	158.5	0.2	112.3	F8 S9 Q10 M16	F8-R12 PolarHBondContact O-N 3.48Å; S9-R12 PolarHBondContact O-N 3.27Å; Q10-R12 VanDerWaalsContact C-N 3.32Å; Q10-R12 PolarHBondContact O-N 3.46Å; R12-M16 VanDerWaalsContact O-CB 3.31Å; R12-M16 WeakPolarHBondContact O-CB 3.31Å; R12-M16 VanDerWaalsContact O-CG 3.25Å; R12-M16 WeakPolarHBondContact O-CG 3.26Å; R12-M16 PolarHBondContact O-N 2.83Å
13	S	70.4	Confident	70.2	Confident	77 Å²	77	108.5 Å²	108.5	54%	0.538	58%	0.577	S	S	.	*	H	α-helix	trans	-72.2	-39	176.5	-177	0	0	0	0	112	S9 M16 G17	S9-S13 WeakPolarHBondContact O-CB 3.1Å; S9-S13 PolarHBondContact O-N 3.46Å; S13-M16 PolarHBondContact O-N 3.44Å; S13-G17 PolarHBondContact O-N 2.83Å
14	L	74.7	Confident	71.1	Confident	101 Å²	101	104.7 Å²	104.7	53%	0.529	56%	0.557	S	S	.	*	H	α-helix	trans	-66.7	-41.7	171.1	-71.1	167.8	0	0	0	111.4	Q10 G17 L18	Q10-L14 HydrophobicContact CG-CD1 3.69Å; Q10-L14 HydrophobicContact CG-CG 4.2Å; Q10-L14 WeakPolarHBondContact O-CB 3.38Å; Q10-L14 WeakPolarHBondContact O-CD1 3.16Å; Q10-L14 WeakPolarHBondContact O-CG 3.09Å; Q10-L14 PolarHBondContact O-N 2.93Å; L14-G17 PolarHBondContact O-N 3.45Å; L14-L18 VanDerWaalsContact O-CB 3.26Å; L14-L18 WeakPolarHBondContact O-CB 3.34Å; L14-L18 VanDerWaalsContact O-CG 3.26Å; L14-L18 WeakPolarHBondContact O-CG 3.45Å; L14-L18 PolarHBondContact O-N 2.84Å
15	A	80.1	Confident	72.2	Confident	57 Å²	57	103.4 Å²	103.4	47%	0.471	55%	0.549	S	S	.	.	H	α-helix	trans	-64.9	-40.3	174.8	0	0	0	0	0	112.1	R11 L18 A19	R11-A15 WeakPolarHBondContact O-CB 3.14Å; R11-A15 PolarHBondContact O-N 2.79Å; A15-L18 PolarHBondContact O-N 2.79Å; A15-A19 VanDerWaalsContact O-CB 3.29Å; A15-A19 WeakPolarHBondContact O-CB 3.25Å; A15-A19 PolarHBondContact O-N 3.19Å
16	M	77.8	Confident	73.1	Confident	121 Å²	121	103 Å²	103	60%	0.596	55%	0.547	S	S	*	.	H	α-helix	trans	-66.2	-42.7	174	-78.8	-178.3	150.7	0	0	111.6	R12 S13 A19 L20	R12-M16 VanDerWaalsContact O-CB 3.31Å; R12-M16 WeakPolarHBondContact O-CB 3.31Å; R12-M16 VanDerWaalsContact O-CG 3.25Å; R12-M16 WeakPolarHBondContact O-CG 3.26Å; R12-M16 PolarHBondContact O-N 2.83Å; S13-M16 PolarHBondContact O-N 3.44Å; M16-A19 PolarHBondContact O-N 3.4Å; M16-L20 WeakPolarHBondContact O-CB 3.32Å; M16-L20 WeakPolarHBondContact O-CD1 3.29Å; M16-L20 WeakPolarHBondContact O-CG 3.41Å; M16-L20 PolarHBondContact O-N 3.09Å
17	G	79.2	Confident	74.1	Confident	32 Å²	32	98 Å²	98	33%	0.33	54%	0.541	S	S	.	.	H	α-helix	trans	-61.4	-42.6	173.5	0	0	0	0	0	112.3	S13 L14 L20 T21	S13-G17 PolarHBondContact O-N 2.83Å; L14-G17 PolarHBondContact O-N 3.45Å; G17-L20 PolarHBondContact O-N 2.82Å; G17-T21 WeakPolarHBondContact O-CG2 3.26Å; G17-T21 PolarHBondContact O-N 2.78Å; G17-T21 PolarHBondContact O-OG1 3.39Å; G17-T21 VanDerWaalsContact O-OG1 3.09Å
18	L	80.9	Confident	75	Confident	123 Å²	123	99.3 Å²	99.3	64%	0.644	55%	0.55	S	S	*	.	H	α-helix	trans	-67.8	-36.1	175.2	-78.4	166.5	0	0	0	112.8	L14 A15 T21 G22	L14-L18 VanDerWaalsContact O-CB 3.26Å; L14-L18 WeakPolarHBondContact O-CB 3.34Å; L14-L18 VanDerWaalsContact O-CG 3.26Å; L14-L18 WeakPolarHBondContact O-CG 3.45Å; L14-L18 PolarHBondContact O-N 2.84Å; A15-L18 PolarHBondContact O-N 2.79Å; L18-T21 WeakPolarHBondContact CA-OG1 3.37Å; L18-T21 PolarHBondContact O-OG1 2.88Å; L18-G22 WeakPolarHBondContact O-CA 3.44Å; L18-G22 PolarHBondContact O-N 3.38Å
19	A	81.6	Confident	76.1	Confident	67 Å²	67	93.8 Å²	93.8	55%	0.554	53%	0.534	S	S	*	.	H	α-helix	trans	-67.9	-40.8	174	0	0	0	0	0	111.1	A15 M16 G22 V23	A15-A19 VanDerWaalsContact O-CB 3.29Å; A15-A19 WeakPolarHBondContact O-CB 3.25Å; A15-A19 PolarHBondContact O-N 3.19Å; M16-A19 PolarHBondContact O-N 3.4Å; A19-G22 PolarHBondContact O-N 2.97Å; A19-V23 PolarHBondContact O-N 3.32Å
20	L	78.8	Confident	76.8	Confident	124 Å²	124	95.7 Å²	95.7	65%	0.649	53%	0.534	S	S	*	.	H	α-helix	trans	-66.7	-43.5	175.2	-85.2	155.8	0	0	0	112.3	M16 G17 G22 V23 G24	M16-L20 WeakPolarHBondContact O-CB 3.32Å; M16-L20 WeakPolarHBondContact O-CD1 3.29Å; M16-L20 WeakPolarHBondContact O-CG 3.41Å; M16-L20 PolarHBondContact O-N 3.09Å; G17-L20 PolarHBondContact O-N 2.82Å; L20-G22 VanDerWaalsContact C-N 3.34Å; L20-V23 WeakPolarHBondContact O-CG1 3.41Å; L20-G24 PolarHBondContact O-N 2.9Å
21	T	81.9	Confident	77.6	Confident	75 Å²	75	93.6 Å²	93.6	46%	0.46	53%	0.534	S	S	.	.	H	α-helix	trans	-70	-35.6	174.2	57.2	0	0	0	0	110.8	G17 L18 V23 G24 I25	G17-T21 WeakPolarHBondContact O-CG2 3.26Å; G17-T21 PolarHBondContact O-N 2.78Å; G17-T21 PolarHBondContact O-OG1 3.39Å; G17-T21 VanDerWaalsContact O-OG1 3.09Å; L18-T21 WeakPolarHBondContact CA-OG1 3.37Å; L18-T21 PolarHBondContact O-OG1 2.88Å; T21-V23 PolarHBondContact O-N 3.14Å; T21-G24 PolarHBondContact O-N 2.82Å; T21-I25 WeakPolarHBondContact O-CB 3.13Å; T21-I25 WeakPolarHBondContact O-CD1 3.32Å; T21-I25 WeakPolarHBondContact O-CG1 3.29Å; T21-I25 PolarHBondContact O-N 3.25Å
22	G	80.4	Confident	78.2	Confident	34 Å²	34	88.8 Å²	88.8	35%	0.351	53%	0.525	S	S	.	.	H	α-helix	trans	-59.3	-40.7	174.3	0	0	0	0	0	113.3	L18 A19 L20 S26	L18-G22 WeakPolarHBondContact O-CA 3.44Å; L18-G22 PolarHBondContact O-N 3.38Å; A19-G22 PolarHBondContact O-N 2.97Å; L20-G22 VanDerWaalsContact C-N 3.34Å; G22-S26 VanDerWaalsContact O-CB 3.29Å; G22-S26 WeakPolarHBondContact O-CB 3.37Å; G22-S26 PolarHBondContact O-N 3.34Å
23	V	78.7	Confident	79	Confident	96 Å²	96	84.2 Å²	84.2	58%	0.582	52%	0.515	S	S	*	.	H	α-helix	trans	-68	-39.3	176.7	93.2	0	0	0	0	111.8	A19 L20 T21 S27	A19-V23 PolarHBondContact O-N 3.32Å; L20-V23 WeakPolarHBondContact O-CG1 3.41Å; T21-V23 PolarHBondContact O-N 3.14Å; V23-S27 PolarHBondContact O-N 3.47Å; V23-S27 VanDerWaalsContact O-N 3.14Å; V23-S27 PolarHBondContact O-OG 3.44Å
24	G	78.8	Confident	79.3	Confident	30 Å²	30	85.4 Å²	85.4	31%	0.309	51%	0.51	S	S	.	.	H	α-helix	trans	-67.4	-45.8	175.9	0	0	0	0	0	112.5	L20 T21 S26 S27 F28	L20-G24 PolarHBondContact O-N 2.9Å; T21-G24 PolarHBondContact O-N 2.82Å; G24-S26 VanDerWaalsContact C-N 3.3Å; G24-S26 PolarHBondContact O-N 3.36Å; G24-S27 PolarHBondContact O-N 3.38Å; G24-F28 WeakPolarHBondContact O-CD2 3.36Å; G24-F28 PolarHBondContact O-N 3.29Å
25	I	82.1	Confident	79.5	Confident	112 Å²	112	87.4 Å²	87.4	57%	0.574	52%	0.517	S	S	*	.	H	α-helix	trans	-62	-40.1	177	-67.5	162.3	0	0	0	110.2	T21 S27 F28 A29	T21-I25 WeakPolarHBondContact O-CB 3.13Å; T21-I25 WeakPolarHBondContact O-CD1 3.32Å; T21-I25 WeakPolarHBondContact O-CG1 3.29Å; T21-I25 PolarHBondContact O-N 3.25Å; I25-S27 PolarHBondContact O-N 2.83Å; I25-F28 PolarHBondContact O-N 3.02Å; I25-A29 WeakPolarHBondContact O-CB 3.45Å; I25-A29 PolarHBondContact O-N 3.48Å
26	S	78.6	Confident	79.6	Confident	73 Å²	73	93 Å²	93	51%	0.51	53%	0.526	S	S	.	.	H	α-helix	trans	-62.4	-41.3	175.9	-165.1	0	0	0	0	111.9	G22 G24 A29 F30	G22-S26 VanDerWaalsContact O-CB 3.29Å; G22-S26 WeakPolarHBondContact O-CB 3.37Å; G22-S26 PolarHBondContact O-N 3.34Å; G24-S26 VanDerWaalsContact C-N 3.3Å; G24-S26 PolarHBondContact O-N 3.36Å; S26-A29 PolarHBondContact O-N 2.94Å; S26-F30 WeakPolarHBondContact O-CB 3.39Å; S26-F30 PolarHBondContact O-N 3.43Å
27	S	82.4	Confident	79.8	Confident	85 Å²	85	91.5 Å²	91.5	59%	0.594	52%	0.52	S	S	*	.	H	α-helix	trans	-64.4	-40.3	175.2	-73.4	0	0	0	0	112.6	V23 G24 I25 F30	V23-S27 PolarHBondContact O-N 3.47Å; V23-S27 VanDerWaalsContact O-N 3.14Å; V23-S27 PolarHBondContact O-OG 3.44Å; G24-S27 PolarHBondContact O-N 3.38Å; I25-S27 PolarHBondContact O-N 2.83Å; S27-F30 WeakPolarHBondContact O-CB 3.45Å; S27-F30 PolarHBondContact O-N 2.93Å
28	F	80.4	Confident	79.8	Confident	172 Å²	172	95.3 Å²	95.3	75%	0.754	53%	0.532	S	S	*	.	H	α-helix	trans	-69.7	-35.1	175.8	-88.5	-77.7	0	0	0	112.8	G24 I25 F30 P32	G24-F28 WeakPolarHBondContact O-CD2 3.36Å; G24-F28 PolarHBondContact O-N 3.29Å; I25-F28 PolarHBondContact O-N 3.02Å; F28-F30 VanDerWaalsContact C-N 3.3Å; F28-P32 WeakPolarHBondContact O-CD 3.37Å
29	A	82.5	Confident	79.6	Confident	49 Å²	49	96 Å²	96	41%	0.405	54%	0.536	S	S	.	.	H	α-helix	trans	-71.5	-27.4	174.6	0	0	0	0	0	112.1	I25 S26 A31 P32 L33	I25-A29 WeakPolarHBondContact O-CB 3.45Å; I25-A29 PolarHBondContact O-N 3.48Å; S26-A29 PolarHBondContact O-N 2.94Å; A29-A31 VanDerWaalsContact C-N 3.32Å; A29-A31 PolarHBondContact O-N 3.19Å; A29-P32 VanDerWaalsContact O-CD 3.25Å; A29-P32 WeakPolarHBondContact O-CD 3.4Å; A29-P32 WeakPolarHBondContact O-CG 3.18Å; A29-L33 WeakPolarHBondContact O-CB 3.25Å; A29-L33 PolarHBondContact O-N 2.95Å
30	F	73.1	Confident	79.3	Confident	114 Å²	114	97.7 Å²	97.7	50%	0.5	54%	0.535	S	S	.	.	H	α-helix	trans	-66.3	-32.4	178.5	-140.8	-111.6	0	0	0	113	S26 S27 F28 L33 F34	S26-F30 WeakPolarHBondContact O-CB 3.39Å; S26-F30 PolarHBondContact O-N 3.43Å; S27-F30 WeakPolarHBondContact O-CB 3.45Å; S27-F30 PolarHBondContact O-N 2.93Å; F28-F30 VanDerWaalsContact C-N 3.3Å; F30-L33 PolarHBondContact O-N 3.41Å; F30-F34 AromaticContact CD1-CD2 3.61Å; F30-F34 HydrophobicContact CD1-CD2 3.61Å; F30-F34 AromaticContact CD1-CE2 3.74Å; F30-F34 HydrophobicContact CD1-CE2 3.74Å; F30-F34 AromaticContact CE1-CD2 3.49Å; F30-F34 HydrophobicContact CE1-CD2 3.49Å; F30-F34 VanDerWaalsContact CE1-CD2 3.49Å; F30-F34 AromaticContact CE1-CE2 3.08Å; F30-F34 HydrophobicContact CE1-CE2 3.08Å; F30-F34 HydrophobicContact CE1-CZ 4.1Å; F30-F34 HydrophobicContact CG-CD2 4.38Å; F30-F34 HydrophobicContact CZ-CD2 4.13Å; F30-F34 AromaticContact CZ-CE2 3.55Å; F30-F34 HydrophobicContact CZ-CE2 3.55Å; F30-F34 WeakPolarHBondContact O-CB 3.49Å; F30-F34 PolarHBondContact O-N 3.44Å
31	A	78.4	Confident	78.2	Confident	57 Å²	57	104.1 Å²	104.1	47%	0.471	55%	0.553	S	S	.	*	H	α-helix	trans	-61	-55.4	178.4	0	0	0	0	0	113.7	A29 L33 Q35	A29-A31 VanDerWaalsContact C-N 3.32Å; A29-A31 PolarHBondContact O-N 3.19Å; A31-L33 VanDerWaalsContact C-N 3.32Å; A31-L33 PolarHBondContact O-N 3.2Å; A31-Q35 PolarHBondContact O-N 3.19Å
32	P	78.5	Confident	78	Confident	75 Å²	75	105.6 Å²	105.6	49%	0.487	56%	0.558	S	S	.	*	H	α-helix	trans	-70.1	-27.6	174.5	28.2	-34.4	0	0	0	112.6	F28 A29 Q35 W36	F28-P32 WeakPolarHBondContact O-CD 3.37Å; A29-P32 VanDerWaalsContact O-CD 3.25Å; A29-P32 WeakPolarHBondContact O-CD 3.4Å; A29-P32 WeakPolarHBondContact O-CG 3.18Å; P32-Q35 PolarHBondContact O-N 3.48Å; P32-W36 WeakPolarHBondContact O-CB 3.32Å; P32-W36 PolarHBondContact O-N 2.81Å
33	L	80.8	Confident	77.9	Confident	95 Å²	95	109.4 Å²	109.4	50%	0.497	57%	0.569	S	S	.	*	H	α-helix	trans	-67.7	-38.6	178.8	-155.7	159.9	0	0	0	111.4	A29 F30 A31 W36 L37	A29-L33 WeakPolarHBondContact O-CB 3.25Å; A29-L33 PolarHBondContact O-N 2.95Å; F30-L33 PolarHBondContact O-N 3.41Å; A31-L33 VanDerWaalsContact C-N 3.32Å; A31-L33 PolarHBondContact O-N 3.2Å; L33-W36 PolarHBondContact O-N 3.48Å; L33-L37 WeakPolarHBondContact O-CB 3.39Å; L33-L37 PolarHBondContact O-N 3.4Å
34	F	75.6	Confident	77.8	Confident	102 Å²	102	110.1 Å²	110.1	45%	0.447	57%	0.568	S	S	.	*	H	α-helix	trans	-66.4	-43.1	171.2	-106.4	-100.6	0	0	0	112.4	F30 W36 L37 I38	F30-F34 AromaticContact CD1-CD2 3.61Å; F30-F34 HydrophobicContact CD1-CD2 3.61Å; F30-F34 AromaticContact CD1-CE2 3.74Å; F30-F34 HydrophobicContact CD1-CE2 3.74Å; F30-F34 AromaticContact CE1-CD2 3.49Å; F30-F34 HydrophobicContact CE1-CD2 3.49Å; F30-F34 VanDerWaalsContact CE1-CD2 3.49Å; F30-F34 AromaticContact CE1-CE2 3.08Å; F30-F34 HydrophobicContact CE1-CE2 3.08Å; F30-F34 HydrophobicContact CE1-CZ 4.1Å; F30-F34 HydrophobicContact CG-CD2 4.38Å; F30-F34 HydrophobicContact CZ-CD2 4.13Å; F30-F34 AromaticContact CZ-CE2 3.55Å; F30-F34 HydrophobicContact CZ-CE2 3.55Å; F30-F34 WeakPolarHBondContact O-CB 3.49Å; F30-F34 PolarHBondContact O-N 3.44Å; F34-W36 VanDerWaalsContact C-N 3.28Å; F34-W36 PolarHBondContact O-N 3.28Å; F34-L37 PolarHBondContact O-N 2.95Å; F34-I38 HydrophobicContact CD1-CD1 4.39Å; F34-I38 WeakPolarHBondContact O-CB 3.21Å; F34-I38 WeakPolarHBondContact O-CD1 3.36Å; F34-I38 WeakPolarHBondContact O-CG1 3.02Å; F34-I38 PolarHBondContact O-N 3.3Å
35	Q	79.1	Confident	77.8	Confident	142 Å²	142	114.8 Å²	114.8	66%	0.664	58%	0.583	S	S	*	*	H	α-helix	trans	-61.9	-37.9	174.7	-77	179.4	-106.1	0	0	112.1	A31 P32 N39	A31-Q35 PolarHBondContact O-N 3.19Å; P32-Q35 PolarHBondContact O-N 3.48Å; Q35-N39 VanDerWaalsContact O-CB 3.32Å; Q35-N39 WeakPolarHBondContact O-CB 3.45Å; Q35-N39 PolarHBondContact O-N 3.41Å
36	W	82.8	Confident	77.5	Confident	175 Å²	175	115 Å²	115	66%	0.663	58%	0.584	S	S	*	*	H	α-helix	trans	-67.2	-43.1	176.2	-170.2	82.1	0	0	0	111.8	P32 L33 F34 I38 N39 N40	P32-W36 WeakPolarHBondContact O-CB 3.32Å; P32-W36 PolarHBondContact O-N 2.81Å; L33-W36 PolarHBondContact O-N 3.48Å; F34-W36 VanDerWaalsContact C-N 3.28Å; F34-W36 PolarHBondContact O-N 3.28Å; W36-I38 VanDerWaalsContact C-N 3.33Å; W36-I38 PolarHBondContact O-N 3.46Å; W36-N39 PolarHBondContact O-N 2.99Å; W36-N40 VanDerWaalsContact CE2-ND2 3.32Å; W36-N40 PolarHBondContact NE1-ND2 3.33Å; W36-N40 PolarHBondContact O-N 2.84Å; W36-N40 PolarHBondContact O-ND2 3.27Å
37	L	80.4	Confident	77.4	Confident	89 Å²	89	117.8 Å²	117.8	47%	0.466	59%	0.588	S	S	.	*	H	α-helix	trans	-62.2	-41	176.6	-173.7	64.2	0	0	0	112	L33 F34	L33-L37 WeakPolarHBondContact O-CB 3.39Å; L33-L37 PolarHBondContact O-N 3.4Å; F34-L37 PolarHBondContact O-N 2.95Å
38	I	80.3	Confident	77.1	Confident	113 Å²	113	120.1 Å²	120.1	58%	0.579	59%	0.588	S	S	*	*	H	α-helix	trans	-70.5	-32.4	178.2	-67.4	163.4	0	0	0	111.7	F34 W36	F34-I38 HydrophobicContact CD1-CD1 4.39Å; F34-I38 WeakPolarHBondContact O-CB 3.21Å; F34-I38 WeakPolarHBondContact O-CD1 3.36Å; F34-I38 WeakPolarHBondContact O-CG1 3.02Å; F34-I38 PolarHBondContact O-N 3.3Å; W36-I38 VanDerWaalsContact C-N 3.33Å; W36-I38 PolarHBondContact O-N 3.46Å
39	N	77.4	Confident	76.8	Confident	137 Å²	137	116.2 Å²	116.2	73%	0.733	58%	0.575	S	S	*	*	H	α-helix	trans	-76.7	-23.6	-179.9	-167.4	-102.9	0	0	0	113.5	Q35 W36	Q35-N39 VanDerWaalsContact O-CB 3.32Å; Q35-N39 WeakPolarHBondContact O-CB 3.45Å; Q35-N39 PolarHBondContact O-N 3.41Å; W36-N39 PolarHBondContact O-N 2.99Å
40	N	74.2	Confident	76.4	Confident	102 Å²	102	121.8 Å²	121.8	55%	0.545	59%	0.589	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.4	0.6	178.9	-75.8	-92.1	0	0	0	113.6	W36	W36-N40 VanDerWaalsContact CE2-ND2 3.32Å; W36-N40 PolarHBondContact NE1-ND2 3.33Å; W36-N40 PolarHBondContact O-N 2.84Å; W36-N40 PolarHBondContact O-ND2 3.27Å
41	Y	55.8	Low	76.7	Confident	260 Å²	260	122.5 Å²	122.5	100%	1.02	60%	0.597	S	S	*	*			trans	-115.3	0	178.7	-133.1	-77.9	0	0	0	110.3

Retrieved 41 of 41 residues in 101 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).