A0A087WPR6_MOUSE Loading...

ARP3 actin-related protein 3

AlphaFold DB , UniProt , Accession A0A087WPR6, Species MOUSE (Mus musculus, Mouse), Gene Actr3, Length 41 aa.

						>A0A087WPR6_MOUSE|A0A087WPR6|Actr3
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSLANSPWYS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.5	Low	84.9	Confident	235 Å²	235	108.7 Å²	108.7	100%	1.158	63%	0.632	S	S	*	*				0	113.1	0	-84	170.5	166.4	0	0	107.7	G3	M1-G3 PolarHBondContact O-N 2.91Å
2	A	55.1	Low	85.8	Confident	111 Å²	111	107.8 Å²	107.8	92%	0.917	64%	0.635	S	S	*	*			trans	-67.1	92.9	148.8	0	0	0	0	0	104.4	R4	A2-R4 PolarHBondContact O-N 2.97Å
3	G	74.6	Confident	86.3	Confident	51 Å²	51	101.9 Å²	101.9	53%	0.526	61%	0.61	S	S	.	*	P	Polyproline II helix	trans	-53.7	134.3	-179.5	0	0	0	0	0	108.3	M1 L5	M1-G3 PolarHBondContact O-N 2.91Å; G3-L5 PolarHBondContact O-N 2.95Å
4	R	85.3	Confident	86.7	Confident	215 Å²	215	101.6 Å²	101.6	81%	0.811	61%	0.61	S	S	*	*	P	Polyproline II helix	trans	-51	116.6	-178.9	177.6	174.7	177	-92.7	4.5	108.7	A2	A2-R4 PolarHBondContact O-N 2.97Å
5	L	91.2	Very high	87	Confident	144 Å²	144	97.1 Å²	97.1	75%	0.754	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-59.4	149.3	172.8	-64.8	176.5	0	0	0	109	G3 A7	G3-L5 PolarHBondContact O-N 2.95Å; L5-A7 PolarHBondContact O-N 3.19Å
6	P	94.3	Very high	87.5	Confident	70 Å²	70	100 Å²	100	46%	0.455	59%	0.59	S	S	.	*	P	Polyproline II helix	trans	-58.8	141.6	179	26.9	-35.1	0	0	0	110	Y21	P6-Y21 HydrophobicContact CG-CD1 4.15Å; P6-Y21 HydrophobicContact CG-CG 4.29Å
7	A	95.4	Very high	88	Confident	35 Å²	35	95.5 Å²	95.5	29%	0.289	56%	0.564	S	S	.	*	P	Polyproline II helix	trans	-68.1	142	-178.4	0	0	0	0	0	110.7	L5 Y21 A22	L5-A7 PolarHBondContact O-N 3.19Å; A7-Y21 CarbonylContact O-C 3.53Å; A7-Y21 WeakPolarHBondContact O-CA 3.45Å; A7-A22 HydrophobicContact CB-CB 4.24Å; A7-A22 PolarHBondContact O-N 3.38Å
8	C	96.5	Very high	88.6	Confident	95 Å²	95	95.2 Å²	95.2	64%	0.642	55%	0.554	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-70	134.8	167	-54.1	0	0	0	0	109.4	G20 Y21	C8-G20 CarbonylContact C-O 3.59Å; C8-G20 WeakPolarHBondContact CA-O 3.24Å; C8-Y21 VanDerWaalsContact SG-CE1 3.59Å
9	V	97.4	Very high	89.1	Confident	78 Å²	78	92.8 Å²	92.8	47%	0.473	54%	0.539	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	127.1	174.3	-178.1	0	0	0	0	107.9	L19 G20 A22	V9-L19 WeakPolarHBondContact O-CA 3.32Å; V9-G20 PolarHBondContact N-O 3.04Å; V9-G20 PolarHBondContact O-N 2.94Å; V9-G20 VanDerWaalsContact O-N 3.11Å; V9-A22 HydrophobicContact CG2-CB 4.16Å
10	V	97.6	Very high	89.5	Confident	88 Å²	88	88.9 Å²	88.9	53%	0.533	52%	0.519	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	116.2	-178	-177.2	0	0	0	0	108.8	T17 L19	V10-T17 HydrophobicContact CG1-CG2 4.23Å; V10-L19 HydrophobicContact CB-CD2 4.02Å; V10-L19 HydrophobicContact CG1-CD2 3.68Å; V10-L19 HydrophobicContact CG2-CD2 3.68Å
11	D	96.4	Very high	89.9	Confident	74 Å²	74	90 Å²	90	40%	0.396	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.6	110.3	173.7	173.1	27.7	0	0	0	108.9	T17 K18	D11-T17 CarbonylContact O-C 3.59Å; D11-T17 WeakPolarHBondContact O-CA 3.3Å; D11-T17 VanDerWaalsContact O-CA 3.32Å; D11-K18 HydrophobicContact CB-CB 4.27Å; D11-K18 PolarHBondContact N-O 2.79Å; D11-K18 PolarHBondContact O-N 2.98Å; D11-K18 IonicContact OD2-NZ 2.79Å; D11-K18 PolarHBondContact OD2-NZ 3.1Å
12	C	94.8	Very high	92	Very high	98 Å²	98	81.3 Å²	81.3	66%	0.662	48%	0.48	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.5	94.6	-177.6	-66.4	0	0	0	0	110.6
13	G	92.8	Very high	93.9	Very high	31 Å²	31	79.9 Å²	79.9	32%	0.32	48%	0.477	S	S	.	.			trans	-81.8	171.3	167.6	0	0	0	0	0	112.6	Y16 S33	G13-Y16 VanDerWaalsContact N-O 3.1Å; G13-Y16 PolarHBondContact N-O 2.93Å; G13-Y16 WeakPolarHBondContact CA-O 3.31Å; G13-Y16 VanDerWaalsContact CA-O 3.3Å; G13-S33 VanDerWaalsContact O-CB 3.31Å; G13-S33 WeakPolarHBondContact O-CB 3.5Å; G13-S33 PolarHBondContact O-OG 3.34Å
14	T	91.6	Very high	94.9	Very high	98 Å²	98	81.3 Å²	81.3	60%	0.601	47%	0.472	S	S	*	.	S	Bend	trans	-78.3	-29.6	173.4	53.5	0	0	0	0	112.6	N36	T14-N36 PolarHBondContact O-ND2 3.05Å
15	G	91.6	Very high	95.5	Very high	33 Å²	33	78 Å²	78	34%	0.34	48%	0.476	S	S	.	.	S	Bend	trans	-96.6	-40.4	176.4	0	0	0	0	0	114.1	S33	G15-S33 PolarHBondContact O-N 3.19Å
16	Y	94.9	Very high	95.8	Very high	144 Å²	144	78.2 Å²	78.2	57%	0.565	47%	0.473	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-141.9	141.9	-176.6	-64.3	-85.9	0	0	0	112.1	G13 I30 I31 P32 S33	G13-Y16 VanDerWaalsContact N-O 3.1Å; G13-Y16 PolarHBondContact N-O 2.93Å; G13-Y16 WeakPolarHBondContact CA-O 3.31Å; G13-Y16 VanDerWaalsContact CA-O 3.3Å; Y16-I30 HydrophobicContact CD1-CG2 3.9Å; Y16-I30 HydrophobicContact CG-CG2 4.08Å; Y16-I31 WeakPolarHBondContact CA-O 3.27Å; Y16-I31 CarbonylContact C-O 3.52Å; Y16-I31 VanDerWaalsContact CA-O 3.27Å; Y16-P32 HydrophobicContact CE1-CG 4.38Å; Y16-S33 VanDerWaalsContact CA-OG 3.26Å; Y16-S33 WeakPolarHBondContact CA-OG 3.26Å; Y16-S33 PolarHBondContact N-OG 2.81Å; Y16-S33 PolarHBondContact O-OG 2.91Å
17	T	96.5	Very high	95.9	Very high	23 Å²	23	77.7 Å²	77.7	14%	0.141	47%	0.47	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	126.1	171	-62	0	0	0	0	107.9	V10 D11 L19 I30 I31 S33	V10-T17 HydrophobicContact CG1-CG2 4.23Å; D11-T17 CarbonylContact O-C 3.59Å; D11-T17 WeakPolarHBondContact O-CA 3.3Å; D11-T17 VanDerWaalsContact O-CA 3.32Å; T17-L19 HydrophobicContact CG2-CD2 3.93Å; T17-L19 HydrophobicContact CG2-CG 4.23Å; T17-I30 WeakPolarHBondContact O-CA 3.47Å; T17-I31 PolarHBondContact N-O 3.39Å; T17-I31 PolarHBondContact O-N 2.95Å; T17-S33 PolarHBondContact N-OG 3.33Å; T17-S33 PolarHBondContact OG1-OG 2.83Å
18	K	97.6	Very high	96.1	Very high	91 Å²	91	81.1 Å²	81.1	40%	0.396	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	133.4	177.4	-48.9	178.3	-158.7	119.8	0	109.1	D11 P27 F29 I30	D11-K18 HydrophobicContact CB-CB 4.27Å; D11-K18 PolarHBondContact N-O 2.79Å; D11-K18 PolarHBondContact O-N 2.98Å; D11-K18 IonicContact OD2-NZ 2.79Å; D11-K18 PolarHBondContact OD2-NZ 3.1Å; K18-P27 HydrophobicContact CB-CB 4.03Å; K18-P27 HydrophobicContact CB-CG 4.49Å; K18-F29 WeakPolarHBondContact CA-O 3.46Å; K18-I30 HydrophobicContact CG-CG1 4.37Å
19	L	97.9	Very high	96.1	Very high	50 Å²	50	82.8 Å²	82.8	26%	0.262	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	143.2	-176.4	-57.6	174.4	0	0	0	110.3	V9 V10 T17 P27 Q28 F29 I31	V9-L19 WeakPolarHBondContact O-CA 3.32Å; V10-L19 HydrophobicContact CB-CD2 4.02Å; V10-L19 HydrophobicContact CG1-CD2 3.68Å; V10-L19 HydrophobicContact CG2-CD2 3.68Å; T17-L19 HydrophobicContact CG2-CD2 3.93Å; T17-L19 HydrophobicContact CG2-CG 4.23Å; L19-P27 CarbonylContact O-C 3.52Å; L19-P27 WeakPolarHBondContact O-CA 3.46Å; L19-Q28 PolarHBondContact O-N 3.11Å; L19-F29 PolarHBondContact O-N 2.85Å; L19-F29 PolarHBondContact N-O 2.99Å; L19-F29 HydrophobicContact CB-CB 4.29Å; L19-I31 HydrophobicContact CD1-CD1 4.3Å
20	G	97.9	Very high	96.1	Very high	13 Å²	13	83.8 Å²	83.8	13%	0.134	48%	0.478	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-174.2	-170.6	173.6	0	0	0	0	0	112.2	C8 V9	C8-G20 CarbonylContact C-O 3.59Å; C8-G20 WeakPolarHBondContact CA-O 3.24Å; V9-G20 PolarHBondContact N-O 3.04Å; V9-G20 PolarHBondContact O-N 2.94Å; V9-G20 VanDerWaalsContact O-N 3.11Å
21	Y	97.8	Very high	96	Very high	114 Å²	114	83.4 Å²	83.4	45%	0.447	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	148	173.7	-66.9	-75.6	0	0	0	111	P6 A7 C8 G23 N24	P6-Y21 HydrophobicContact CG-CD1 4.15Å; P6-Y21 HydrophobicContact CG-CG 4.29Å; A7-Y21 CarbonylContact O-C 3.53Å; A7-Y21 WeakPolarHBondContact O-CA 3.45Å; C8-Y21 VanDerWaalsContact SG-CE1 3.59Å; Y21-G23 PolarHBondContact O-N 2.91Å; Y21-N24 WeakPolarHBondContact O-CB 3.5Å; Y21-N24 PolarHBondContact O-N 3.32Å
22	A	95.3	Very high	95.9	Very high	51 Å²	51	84.4 Å²	84.4	42%	0.421	48%	0.483	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.2	131.5	174.8	0	0	0	0	0	110.6	A7 V9	A7-A22 HydrophobicContact CB-CB 4.24Å; A7-A22 PolarHBondContact O-N 3.38Å; V9-A22 HydrophobicContact CG2-CB 4.16Å
23	G	95.1	Very high	95.7	Very high	82 Å²	82	80.6 Å²	80.6	85%	0.845	46%	0.457	S	S	*	.	T	Hydrogen-bonded Turn	trans	100.8	-15.1	-175.3	0	0	0	0	0	114.3	Y21	Y21-G23 PolarHBondContact O-N 2.91Å
24	N	95.9	Very high	95.4	Very high	81 Å²	81	85.8 Å²	85.8	43%	0.433	48%	0.477	S	S	.	.			trans	-72.6	145.6	169.3	-66.9	-0.6	0	0	0	110.4	Y21 E26 Q28	Y21-N24 WeakPolarHBondContact O-CB 3.5Å; Y21-N24 PolarHBondContact O-N 3.32Å; N24-E26 VanDerWaalsContact C-N 3.34Å; N24-E26 WeakPolarHBondContact CB-O 3.43Å; N24-Q28 PolarHBondContact ND2-OE1 2.78Å
25	T	96.9	Very high	94.6	Very high	144 Å²	144	83.4 Å²	83.4	88%	0.883	47%	0.467	S	S	*	.	S	Bend	trans	-78.2	-21.5	174	49.7	0	0	0	0	112.9
26	E	97.3	Very high	93.5	Very high	149 Å²	149	87.3 Å²	87.3	70%	0.696	48%	0.481	S	S	*	.	S	Bend	trans	-139.5	154.8	-174.4	-65.9	-177.6	147.9	0	0	111	N24	N24-E26 VanDerWaalsContact C-N 3.34Å; N24-E26 WeakPolarHBondContact CB-O 3.43Å
27	P	97.2	Very high	92.3	Very high	60 Å²	60	82 Å²	82	39%	0.39	46%	0.464	S	S	.	.			trans	-65	142.5	173.2	28.8	-34.8	0	0	0	110.6	K18 L19 I30	K18-P27 HydrophobicContact CB-CB 4.03Å; K18-P27 HydrophobicContact CB-CG 4.49Å; L19-P27 CarbonylContact O-C 3.52Å; L19-P27 WeakPolarHBondContact O-CA 3.46Å; P27-I30 HydrophobicContact CG-CG1 3.84Å; P27-I30 HydrophobicContact CG-CD1 3.9Å; P27-I30 HydrophobicContact CB-CG1 4.26Å
28	Q	98.2	Very high	91.1	Very high	106 Å²	106	86.2 Å²	86.2	50%	0.495	49%	0.492	S	S	.	.	S	Bend	trans	-82.1	-27.7	177.7	-145.4	151.5	2.3	0	0	111.4	L19 N24	L19-Q28 PolarHBondContact O-N 3.11Å; N24-Q28 PolarHBondContact ND2-OE1 2.78Å
29	F	97.4	Very high	89.7	Confident	130 Å²	130	93 Å²	93	57%	0.57	52%	0.515	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-137.6	143.3	172.5	-55	-78.7	0	0	0	111.2	K18 L19 I31	K18-F29 WeakPolarHBondContact CA-O 3.46Å; L19-F29 PolarHBondContact O-N 2.85Å; L19-F29 PolarHBondContact N-O 2.99Å; L19-F29 HydrophobicContact CB-CB 4.29Å; F29-I31 HydrophobicContact CB-CG2 4.49Å
30	I	97.1	Very high	88.1	Confident	100 Å²	100	99.7 Å²	99.7	51%	0.513	54%	0.538	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	113.6	167.2	-55.3	179	0	0	0	105.8	Y16 T17 K18 P27	Y16-I30 HydrophobicContact CD1-CG2 3.9Å; Y16-I30 HydrophobicContact CG-CG2 4.08Å; T17-I30 WeakPolarHBondContact O-CA 3.47Å; K18-I30 HydrophobicContact CG-CG1 4.37Å; P27-I30 HydrophobicContact CG-CG1 3.84Å; P27-I30 HydrophobicContact CG-CD1 3.9Å; P27-I30 HydrophobicContact CB-CG1 4.26Å
31	I	96.3	Very high	86.4	Confident	79 Å²	79	107.4 Å²	107.4	41%	0.405	59%	0.59	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.6	148.1	-177.4	62.7	173.7	0	0	0	110.2	Y16 T17 L19 F29 S33	Y16-I31 WeakPolarHBondContact CA-O 3.27Å; Y16-I31 CarbonylContact C-O 3.52Å; Y16-I31 VanDerWaalsContact CA-O 3.27Å; T17-I31 PolarHBondContact N-O 3.39Å; T17-I31 PolarHBondContact O-N 2.95Å; L19-I31 HydrophobicContact CD1-CD1 4.3Å; F29-I31 HydrophobicContact CB-CG2 4.49Å; I31-S33 PolarHBondContact O-N 3.4Å
32	P	94.4	Very high	85.8	Confident	96 Å²	96	107.1 Å²	107.1	62%	0.623	60%	0.597	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-58.3	132.8	174	-22.7	33.4	0	0	0	111.2	Y16	Y16-P32 HydrophobicContact CE1-CG 4.38Å
33	S	90.9	Very high	85.3	Confident	18 Å²	18	110 Å²	110	13%	0.126	61%	0.606	C	S	.	*			trans	-83.1	135.9	171.8	-56.5	0	0	0	0	109.5	G13 G15 Y16 T17 I31 A35	G13-S33 VanDerWaalsContact O-CB 3.31Å; G13-S33 WeakPolarHBondContact O-CB 3.5Å; G13-S33 PolarHBondContact O-OG 3.34Å; G15-S33 PolarHBondContact O-N 3.19Å; Y16-S33 VanDerWaalsContact CA-OG 3.26Å; Y16-S33 WeakPolarHBondContact CA-OG 3.26Å; Y16-S33 PolarHBondContact N-OG 2.81Å; Y16-S33 PolarHBondContact O-OG 2.91Å; T17-S33 PolarHBondContact N-OG 3.33Å; T17-S33 PolarHBondContact OG1-OG 2.83Å; I31-S33 PolarHBondContact O-N 3.4Å; S33-A35 PolarHBondContact O-N 2.81Å
34	L	84.8	Confident	84.8	Confident	139 Å²	139	111.6 Å²	111.6	73%	0.728	59%	0.593	S	S	*	*	G	3₁₀ helix	trans	-82.2	5.7	178.6	-63.7	177.6	0	0	0	113.6	N36 S37	L34-N36 PolarHBondContact O-N 2.78Å; L34-S37 VanDerWaalsContact O-CB 3.24Å; L34-S37 WeakPolarHBondContact O-CB 3.33Å; L34-S37 PolarHBondContact O-N 3.47Å; L34-S37 PolarHBondContact O-OG 2.99Å
35	A	74.8	Confident	84.1	Confident	48 Å²	48	113.4 Å²	113.4	40%	0.397	60%	0.603	S	S	.	*	G	3₁₀ helix	trans	-60.6	-27.4	-177.5	0	0	0	0	0	113.3	S33	S33-A35 PolarHBondContact O-N 2.81Å
36	N	68.9	Low	83.3	Confident	116 Å²	116	111.4 Å²	111.4	62%	0.62	59%	0.585	S	S	*	*	G	3₁₀ helix	trans	-102	17.7	175.7	-63.5	-36.4	0	0	0	112.9	T14 L34	T14-N36 PolarHBondContact O-ND2 3.05Å; L34-N36 PolarHBondContact O-N 2.78Å
37	S	69.7	Low	82.4	Confident	32 Å²	32	108.9 Å²	108.9	22%	0.224	58%	0.578	C	S	.	*			trans	-65.8	146.3	177.6	67	0	0	0	0	110.7	L34 W39 Y40	L34-S37 VanDerWaalsContact O-CB 3.24Å; L34-S37 WeakPolarHBondContact O-CB 3.33Å; L34-S37 PolarHBondContact O-N 3.47Å; L34-S37 PolarHBondContact O-OG 2.99Å; S37-W39 PolarHBondContact O-N 3.35Å; S37-Y40 PolarHBondContact O-N 2.96Å
38	P	71.1	Confident	81.3	Confident	111 Å²	111	112.4 Å²	112.4	72%	0.721	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.5	-9.4	-177.8	25.7	-35.7	0	0	0	114
39	W	68	Low	80	Confident	233 Å²	233	112.9 Å²	112.9	88%	0.883	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.8	-1.3	179.4	-52	110.1	0	0	0	113.4	S37	S37-W39 PolarHBondContact O-N 3.35Å
40	Y	65.9	Low	78.6	Confident	192 Å²	192	111.5 Å²	111.5	75%	0.753	60%	0.601	S	S	*	*			trans	-106.9	31.8	-178.8	-158.5	-98.8	0	0	0	112.2	S37	S37-Y40 PolarHBondContact O-N 2.96Å
41	S	61.4	Low	76.9	Confident	174 Å²	174	112.5 Å²	112.5	100%	1.217	61%	0.609	S	S	*	*			trans	-112.8	0	175.5	-177.5	0	0	0	0	112.6

Retrieved 41 of 41 residues in 18.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).