A0A087WPT0_MOUSE Loading...

Leucine rich repeat (in FLII) interacting protein 1

AlphaFold DB , UniProt , Accession A0A087WPT0, Species MOUSE (Mus musculus, Mouse), Gene Lrrfip1, Length 98 aa.

						>A0A087WPT0_MOUSE|A0A087WPT0|Lrrfip1
MTSPEGAQNKEIDCLSPEAQRLAEARLAAKRAARAEAREIRMKELERQQKETNGYDGDYCGSQSLSRRSGRPSEYGSHLNSSSRASSRASSARASPVV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.8	Very low	52.8	Low	237 Å²	237	138.8 Å²	138.8	100%	1.167	79%	0.786	S	S	*	*				0	106.3	0	-69.4	-56.4	-163.9	0	0	107.2
2	T	55.4	Low	53	Low	130 Å²	130	140.2 Å²	140.2	80%	0.798	79%	0.787	S	S	*	*			trans	-76	130.4	-178.5	168.4	0	0	0	0	109.1
3	S	51	Low	53.3	Low	119 Å²	119	140.8 Å²	140.8	83%	0.832	79%	0.787	S	S	*	*			trans	-99.3	118.4	170.4	-62.5	0	0	0	0	108.1
4	P	69.9	Low	53.2	Low	111 Å²	111	137.9 Å²	137.9	72%	0.721	78%	0.779	S	S	*	*			trans	-111.6	112.1	167.8	33.8	-20.1	0	0	0	108.7
5	E	49.5	Very low	54	Low	182 Å²	182	136.7 Å²	136.7	85%	0.85	77%	0.769	S	S	*	*			trans	-165	68.1	150.9	-113.2	-178.2	-165.3	0	0	111.5	A7	E5-A7 HydrophobicContact CG-CB 4.26Å; E5-A7 PolarHBondContact O-N 3.16Å; E5-A7 VanDerWaalsContact O-N 3.16Å
6	G	51.1	Low	55.5	Low	86 Å²	86	132 Å²	132	89%	0.887	75%	0.748	S	S	*	*			trans	-78.6	61.9	151.7	0	0	0	0	0	109.2	Q8	G6-Q8 PolarHBondContact O-N 3.31Å
7	A	53.8	Low	57.2	Low	64 Å²	64	130.5 Å²	130.5	53%	0.529	75%	0.745	S	S	.	*			trans	-74.9	95.1	179.2	0	0	0	0	0	109.9	E5	E5-A7 HydrophobicContact CG-CB 4.26Å; E5-A7 PolarHBondContact O-N 3.16Å; E5-A7 VanDerWaalsContact O-N 3.16Å
8	Q	53.1	Low	58.8	Low	125 Å²	125	131.7 Å²	131.7	58%	0.584	74%	0.743	S	S	*	*			trans	53.2	76.4	134.4	-50.4	-163.2	76.3	0	0	116.2	G6 K10	G6-Q8 PolarHBondContact O-N 3.31Å; Q8-K10 HydrophobicContact CB-CD 4.39Å; Q8-K10 HydrophobicContact CB-CG 4.26Å; Q8-K10 PolarHBondContact O-N 2.81Å
9	N	51.6	Low	60.4	Low	166 Å²	166	126.8 Å²	126.8	89%	0.888	72%	0.72	S	S	*	*			trans	-65.3	66.5	150.6	-77.9	-69.5	0	0	0	110.2
10	K	53.8	Low	61.9	Low	144 Å²	144	127 Å²	127	63%	0.626	72%	0.715	S	S	*	*			trans	-114.3	-1.4	176.1	-68.4	-176	-174.9	165.9	0	112.9	Q8 I12	Q8-K10 HydrophobicContact CB-CD 4.39Å; Q8-K10 HydrophobicContact CB-CG 4.26Å; Q8-K10 PolarHBondContact O-N 2.81Å; K10-I12 VanDerWaalsContact C-N 3.31Å; K10-I12 PolarHBondContact O-N 3.01Å
11	E	50.5	Low	63.2	Low	163 Å²	163	130.2 Å²	130.2	76%	0.762	72%	0.716	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.6	7.1	-171.7	-56.5	-164.2	-178.1	0	0	114.6	C14	E11-C14 PolarHBondContact O-SG 3.37Å; E11-C14 VanDerWaalsContact O-SG 3.37Å
12	I	54.8	Low	65.7	Low	155 Å²	155	123.3 Å²	123.3	80%	0.795	68%	0.683	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84	-17.8	173.7	-50.3	-177.2	0	0	0	111.3	K10	K10-I12 VanDerWaalsContact C-N 3.31Å; K10-I12 PolarHBondContact O-N 3.01Å
13	D	56.4	Low	67.6	Low	149 Å²	149	119.8 Å²	119.8	80%	0.797	67%	0.667	S	S	*	*	S	Bend	trans	-94.5	-0.6	-175.6	-81.5	-26.8	0	0	0	115.1	L15	D13-L15 VanDerWaalsContact C-N 3.34Å; D13-L15 PolarHBondContact O-N 3.37Å
14	C	51.6	Low	69.7	Low	99 Å²	99	120.4 Å²	120.4	67%	0.669	66%	0.657	S	S	*	*			trans	-92.2	30.3	-171.8	59.6	0	0	0	0	115.1	E11 S16	E11-C14 PolarHBondContact O-SG 3.37Å; E11-C14 VanDerWaalsContact O-SG 3.37Å; C14-S16 PolarHBondContact O-N 2.81Å
15	L	65.2	Low	71	Confident	120 Å²	120	117.9 Å²	117.9	63%	0.628	65%	0.645	S	S	*	*	S	Bend	trans	-63.1	119.7	154.5	-72	175	0	0	0	106.5	D13 A19	D13-L15 VanDerWaalsContact C-N 3.34Å; D13-L15 PolarHBondContact O-N 3.37Å; L15-A19 HydrophobicContact CB-CB 4.28Å; L15-A19 HydrophobicContact CD2-CB 4.42Å
16	S	79.3	Confident	73.2	Confident	62 Å²	62	117.1 Å²	117.1	43%	0.434	63%	0.634	S	S	.	*			trans	-41.1	137.8	171.3	167.2	0	0	0	0	109.1	C14 E18 A19 Q20	C14-S16 PolarHBondContact O-N 2.81Å; S16-E18 CarbonylContact O-C 3.59Å; S16-E18 PolarHBondContact O-N 3.27Å; S16-E18 PolarHBondContact OG-N 3.2Å; S16-A19 WeakPolarHBondContact O-CA 3.37Å; S16-A19 WeakPolarHBondContact O-CB 3.37Å; S16-A19 PolarHBondContact O-N 2.9Å; S16-Q20 PolarHBondContact O-N 2.97Å
17	P	84.5	Confident	75.4	Confident	107 Å²	107	116.9 Å²	116.9	70%	0.695	61%	0.612	S	S	*	*	H	α-helix	trans	-52.1	-27.4	179.9	20.8	-33.7	0	0	0	112.3	R21	P17-R21 WeakPolarHBondContact O-CB 3.45Å; P17-R21 PolarHBondContact O-N 2.95Å; P17-R21 VanDerWaalsContact O-N 3.08Å
18	E	86	Confident	77.5	Confident	152 Å²	152	116.3 Å²	116.3	71%	0.71	61%	0.608	S	S	*	*	H	α-helix	trans	-65.3	-43	172.4	-167.8	180	-175.3	0	0	113.4	S16 R21 L22	S16-E18 CarbonylContact O-C 3.59Å; S16-E18 PolarHBondContact O-N 3.27Å; S16-E18 PolarHBondContact OG-N 3.2Å; E18-R21 PolarHBondContact O-N 3.38Å; E18-L22 WeakPolarHBondContact O-CB 3.43Å; E18-L22 PolarHBondContact O-N 3.39Å
19	A	88.5	Confident	79.6	Confident	38 Å²	38	113.3 Å²	113.3	31%	0.314	60%	0.604	S	S	.	*	H	α-helix	trans	-65.7	-38.6	177.6	0	0	0	0	0	111.8	L15 S16 L22 A23	L15-A19 HydrophobicContact CB-CB 4.28Å; L15-A19 HydrophobicContact CD2-CB 4.42Å; S16-A19 WeakPolarHBondContact O-CA 3.37Å; S16-A19 WeakPolarHBondContact O-CB 3.37Å; S16-A19 PolarHBondContact O-N 2.9Å; A19-L22 PolarHBondContact O-N 3.42Å; A19-A23 WeakPolarHBondContact O-CB 3.36Å; A19-A23 PolarHBondContact O-N 2.93Å
20	Q	90.1	Very high	81.9	Confident	130 Å²	130	113 Å²	113	61%	0.607	60%	0.595	S	S	*	*	H	α-helix	trans	-64.6	-47.4	174.7	-173.7	174.9	3.6	0	0	111.4	S16 L22 A23 E24	S16-Q20 PolarHBondContact O-N 2.97Å; Q20-L22 VanDerWaalsContact C-N 3.31Å; Q20-L22 PolarHBondContact O-N 3.4Å; Q20-A23 PolarHBondContact O-N 3.4Å; Q20-E24 PolarHBondContact O-N 3.19Å
21	R	89.8	Confident	84	Confident	196 Å²	196	114.1 Å²	114.1	74%	0.74	60%	0.595	S	S	*	*	H	α-helix	trans	-61.1	-39.1	176.5	-172	178.4	175.8	-171.6	-1.4	112.1	P17 E18 E24 A25	P17-R21 WeakPolarHBondContact O-CB 3.45Å; P17-R21 PolarHBondContact O-N 2.95Å; P17-R21 VanDerWaalsContact O-N 3.08Å; E18-R21 PolarHBondContact O-N 3.38Å; R21-E24 PolarHBondContact O-N 2.75Å; R21-A25 WeakPolarHBondContact O-CB 3.43Å; R21-A25 PolarHBondContact O-N 3.09Å
22	L	94.7	Very high	86.2	Confident	91 Å²	91	108.5 Å²	108.5	48%	0.476	58%	0.577	S	S	.	*	H	α-helix	trans	-65.4	-42	175	178.5	62.8	0	0	0	112	E18 A19 Q20 E24 A25 R26	E18-L22 WeakPolarHBondContact O-CB 3.43Å; E18-L22 PolarHBondContact O-N 3.39Å; A19-L22 PolarHBondContact O-N 3.42Å; Q20-L22 VanDerWaalsContact C-N 3.31Å; Q20-L22 PolarHBondContact O-N 3.4Å; L22-E24 VanDerWaalsContact C-N 3.33Å; L22-A25 PolarHBondContact O-N 3.43Å; L22-R26 WeakPolarHBondContact O-CB 3.39Å; L22-R26 WeakPolarHBondContact O-CG 3.41Å; L22-R26 PolarHBondContact O-N 3.29Å
23	A	95.2	Very high	88.3	Confident	56 Å²	56	103.7 Å²	103.7	46%	0.463	56%	0.561	S	S	.	*	H	α-helix	trans	-62.8	-41.8	176.1	0	0	0	0	0	111.4	A19 Q20 R26 L27	A19-A23 WeakPolarHBondContact O-CB 3.36Å; A19-A23 PolarHBondContact O-N 2.93Å; Q20-A23 PolarHBondContact O-N 3.4Å; A23-R26 PolarHBondContact O-N 3.45Å; A23-L27 PolarHBondContact O-N 3.23Å
24	E	93.9	Very high	90.3	Very high	133 Å²	133	104.6 Å²	104.6	62%	0.621	55%	0.553	S	S	*	*	H	α-helix	trans	-64	-46.7	175	-171.9	179.4	-179	0	0	111.8	Q20 R21 L22 R26 L27 A28	Q20-E24 PolarHBondContact O-N 3.19Å; R21-E24 PolarHBondContact O-N 2.75Å; L22-E24 VanDerWaalsContact C-N 3.33Å; E24-R26 VanDerWaalsContact C-N 3.29Å; E24-R26 PolarHBondContact O-N 3.45Å; E24-L27 WeakPolarHBondContact O-CB 3.43Å; E24-L27 PolarHBondContact O-N 2.92Å; E24-L27 VanDerWaalsContact O-N 3.1Å; E24-A28 WeakPolarHBondContact O-CB 3.44Å; E24-A28 PolarHBondContact O-N 2.92Å
25	A	96.9	Very high	92.5	Very high	57 Å²	57	102.6 Å²	102.6	47%	0.471	54%	0.543	S	S	.	.	H	α-helix	trans	-58.2	-41.9	176.5	0	0	0	0	0	111.8	R21 L22 A28 A29	R21-A25 WeakPolarHBondContact O-CB 3.43Å; R21-A25 PolarHBondContact O-N 3.09Å; L22-A25 PolarHBondContact O-N 3.43Å; A25-A28 PolarHBondContact O-N 3.37Å; A25-A29 WeakPolarHBondContact O-CB 3.45Å; A25-A29 PolarHBondContact O-N 3.1Å
26	R	97.1	Very high	94	Very high	166 Å²	166	102.6 Å²	102.6	63%	0.626	54%	0.54	S	S	*	.	H	α-helix	trans	-63.1	-42.1	174.3	-78.6	175.3	144	155.1	-3.5	112.4	L22 A23 E24 A29 K30	L22-R26 WeakPolarHBondContact O-CB 3.39Å; L22-R26 WeakPolarHBondContact O-CG 3.41Å; L22-R26 PolarHBondContact O-N 3.29Å; A23-R26 PolarHBondContact O-N 3.45Å; E24-R26 VanDerWaalsContact C-N 3.29Å; E24-R26 PolarHBondContact O-N 3.45Å; R26-A29 PolarHBondContact O-N 3.34Å; R26-K30 WeakPolarHBondContact O-CG 3.45Å; R26-K30 PolarHBondContact O-N 2.9Å; R26-K30 VanDerWaalsContact O-N 3.09Å
27	L	97.6	Very high	94.9	Very high	81 Å²	81	102.4 Å²	102.4	42%	0.424	54%	0.542	S	S	.	.	H	α-helix	trans	-65.7	-42.1	176.3	-179.6	61.1	0	0	0	111.3	A23 E24 K30 R31	A23-L27 PolarHBondContact O-N 3.23Å; E24-L27 WeakPolarHBondContact O-CB 3.43Å; E24-L27 PolarHBondContact O-N 2.92Å; E24-L27 VanDerWaalsContact O-N 3.1Å; L27-K30 PolarHBondContact O-N 2.8Å; L27-R31 VanDerWaalsContact O-CG 3.32Å; L27-R31 WeakPolarHBondContact O-CG 3.32Å; L27-R31 PolarHBondContact O-N 3.09Å
28	A	97.5	Very high	95.6	Very high	52 Å²	52	104.7 Å²	104.7	43%	0.43	54%	0.537	S	S	.	.	H	α-helix	trans	-60.6	-46.4	175.3	0	0	0	0	0	111.3	E24 A25 K30 R31 A32	E24-A28 WeakPolarHBondContact O-CB 3.44Å; E24-A28 PolarHBondContact O-N 2.92Å; A25-A28 PolarHBondContact O-N 3.37Å; A28-K30 PolarHBondContact O-N 3.43Å; A28-R31 WeakPolarHBondContact O-CB 3.5Å; A28-R31 PolarHBondContact O-N 3.5Å; A28-R31 VanDerWaalsContact O-N 3.15Å; A28-A32 WeakPolarHBondContact O-CB 3.39Å; A28-A32 PolarHBondContact O-N 2.89Å
29	A	97.6	Very high	96.1	Very high	62 Å²	62	104 Å²	104	51%	0.512	53%	0.533	S	S	.	.	H	α-helix	trans	-59.7	-44	176.4	0	0	0	0	0	112.4	A25 R26 R31 A32 A33	A25-A29 WeakPolarHBondContact O-CB 3.45Å; A25-A29 PolarHBondContact O-N 3.1Å; R26-A29 PolarHBondContact O-N 3.34Å; A29-R31 VanDerWaalsContact C-N 3.33Å; A29-R31 PolarHBondContact O-N 2.96Å; A29-A32 PolarHBondContact O-N 3.37Å; A29-A33 PolarHBondContact O-N 3.41Å
30	K	98.4	Very high	96.6	Very high	160 Å²	160	108 Å²	108	70%	0.696	55%	0.548	S	S	*	.	H	α-helix	trans	-62.9	-39.5	174.9	-73.1	179.1	179.8	-177.7	0	112.4	R26 L27 A28 R34	R26-K30 WeakPolarHBondContact O-CG 3.45Å; R26-K30 PolarHBondContact O-N 2.9Å; R26-K30 VanDerWaalsContact O-N 3.09Å; L27-K30 PolarHBondContact O-N 2.8Å; A28-K30 PolarHBondContact O-N 3.43Å; K30-R34 WeakPolarHBondContact O-CB 3.47Å; K30-R34 PolarHBondContact O-N 3.08Å; K30-R34 VanDerWaalsContact O-N 3.09Å
31	R	97.9	Very high	96.9	Very high	167 Å²	167	110.5 Å²	110.5	63%	0.63	55%	0.552	S	S	*	*	H	α-helix	trans	-65.6	-42.1	175.7	-74.2	173.2	175.3	171.7	-1	111.2	L27 A28 A29 R34 A35	L27-R31 VanDerWaalsContact O-CG 3.32Å; L27-R31 WeakPolarHBondContact O-CG 3.32Å; L27-R31 PolarHBondContact O-N 3.09Å; A28-R31 WeakPolarHBondContact O-CB 3.5Å; A28-R31 PolarHBondContact O-N 3.5Å; A28-R31 VanDerWaalsContact O-N 3.15Å; A29-R31 VanDerWaalsContact C-N 3.33Å; A29-R31 PolarHBondContact O-N 2.96Å; R31-R34 PolarHBondContact O-N 2.87Å; R31-A35 PolarHBondContact O-N 2.92Å
32	A	98.1	Very high	97.3	Very high	45 Å²	45	107.3 Å²	107.3	37%	0.372	55%	0.547	S	S	.	.	H	α-helix	trans	-61	-51.4	175.7	0	0	0	0	0	111.4	A28 A29 R34 A35 E36	A28-A32 WeakPolarHBondContact O-CB 3.39Å; A28-A32 PolarHBondContact O-N 2.89Å; A29-A32 PolarHBondContact O-N 3.37Å; A32-R34 PolarHBondContact O-N 2.96Å; A32-A35 CarbonylContact O-C 3.58Å; A32-A35 WeakPolarHBondContact O-CA 3.36Å; A32-A35 WeakPolarHBondContact O-CB 3.42Å; A32-A35 PolarHBondContact O-N 2.96Å; A32-E36 PolarHBondContact O-N 3.44Å
33	A	98.3	Very high	97.4	Very high	55 Å²	55	110.2 Å²	110.2	46%	0.455	56%	0.556	S	S	.	*	H	α-helix	trans	-57.3	-37	176.2	0	0	0	0	0	112.6	A29 A37	A29-A33 PolarHBondContact O-N 3.41Å; A33-A37 WeakPolarHBondContact O-CB 3.5Å; A33-A37 PolarHBondContact O-N 3.08Å
34	R	97.8	Very high	97.4	Very high	168 Å²	168	111 Å²	111	63%	0.634	55%	0.55	S	S	*	*	H	α-helix	trans	-69.4	-35.1	174.7	-170.2	175	-172.7	175.7	2.3	112.6	K30 R31 A32 R38	K30-R34 WeakPolarHBondContact O-CB 3.47Å; K30-R34 PolarHBondContact O-N 3.08Å; K30-R34 VanDerWaalsContact O-N 3.09Å; R31-R34 PolarHBondContact O-N 2.87Å; A32-R34 PolarHBondContact O-N 2.96Å; R34-R38 WeakPolarHBondContact O-CG 3.47Å; R34-R38 PolarHBondContact O-N 2.93Å
35	A	98.2	Very high	97.5	Very high	57 Å²	57	108.1 Å²	108.1	47%	0.471	54%	0.539	S	S	.	.	H	α-helix	trans	-67	-46.3	174.2	0	0	0	0	0	110.7	R31 A32 A37 R38 E39	R31-A35 PolarHBondContact O-N 2.92Å; A32-A35 CarbonylContact O-C 3.58Å; A32-A35 WeakPolarHBondContact O-CA 3.36Å; A32-A35 WeakPolarHBondContact O-CB 3.42Å; A32-A35 PolarHBondContact O-N 2.96Å; A35-A37 PolarHBondContact O-N 3.24Å; A35-R38 WeakPolarHBondContact O-CA 3.33Å; A35-R38 WeakPolarHBondContact O-CB 3.35Å; A35-R38 PolarHBondContact O-N 3.3Å; A35-R38 VanDerWaalsContact O-N 3.08Å; A35-E39 PolarHBondContact O-N 3.2Å
36	E	97.3	Very high	97.3	Very high	119 Å²	119	111.6 Å²	111.6	56%	0.556	55%	0.545	S	S	*	.	H	α-helix	trans	-60.1	-44.1	175.9	-70.3	174.1	-168.5	0	0	112	A32 R38 E39 I40	A32-E36 PolarHBondContact O-N 3.44Å; E36-R38 PolarHBondContact O-N 2.82Å; E36-E39 WeakPolarHBondContact O-CB 3.37Å; E36-E39 PolarHBondContact O-N 3.15Å; E36-E39 VanDerWaalsContact O-N 3.09Å; E36-I40 WeakPolarHBondContact O-CG1 3.27Å; E36-I40 PolarHBondContact O-N 3.2Å
37	A	98.2	Very high	97.1	Very high	58 Å²	58	109.1 Å²	109.1	48%	0.479	54%	0.536	S	S	.	.	H	α-helix	trans	-60	-35.2	175.5	0	0	0	0	0	112.5	A33 A35 R41	A33-A37 WeakPolarHBondContact O-CB 3.5Å; A33-A37 PolarHBondContact O-N 3.08Å; A35-A37 PolarHBondContact O-N 3.24Å; A37-R41 PolarHBondContact O-N 2.91Å
38	R	98.4	Very high	96.9	Very high	156 Å²	156	109.3 Å²	109.3	59%	0.589	54%	0.535	S	S	*	.	H	α-helix	trans	-71.1	-40	174.5	-73.3	173	170.8	-158.7	-3.2	111.5	R34 A35 E36 R41 M42	R34-R38 WeakPolarHBondContact O-CG 3.47Å; R34-R38 PolarHBondContact O-N 2.93Å; A35-R38 WeakPolarHBondContact O-CA 3.33Å; A35-R38 WeakPolarHBondContact O-CB 3.35Å; A35-R38 PolarHBondContact O-N 3.3Å; A35-R38 VanDerWaalsContact O-N 3.08Å; E36-R38 PolarHBondContact O-N 2.82Å; R38-R41 PolarHBondContact O-N 3.48Å; R38-M42 WeakPolarHBondContact O-CB 3.45Å; R38-M42 WeakPolarHBondContact O-CG 3.32Å; R38-M42 PolarHBondContact O-N 3.35Å
39	E	97.6	Very high	96.5	Very high	136 Å²	136	113 Å²	113	64%	0.636	54%	0.543	S	S	*	.	H	α-helix	trans	-62.4	-45.7	177.3	-173	176.6	172.4	0	0	111.5	A35 E36 R41 M42 K43	A35-E39 PolarHBondContact O-N 3.2Å; E36-E39 WeakPolarHBondContact O-CB 3.37Å; E36-E39 PolarHBondContact O-N 3.15Å; E36-E39 VanDerWaalsContact O-N 3.09Å; E39-R41 VanDerWaalsContact C-N 3.32Å; E39-R41 PolarHBondContact O-N 2.74Å; E39-M42 PolarHBondContact O-N 3.21Å; E39-K43 WeakPolarHBondContact O-CB 3.39Å; E39-K43 PolarHBondContact O-N 3.27Å
40	I	97.8	Very high	96	Very high	122 Å²	122	118.1 Å²	118.1	63%	0.626	55%	0.554	S	S	*	*	H	α-helix	trans	-57.2	-47.3	174.4	-66.4	166.8	0	0	0	110.3	E36 M42 K43 E44	E36-I40 WeakPolarHBondContact O-CG1 3.27Å; E36-I40 PolarHBondContact O-N 3.2Å; I40-M42 PolarHBondContact O-N 3.04Å; I40-K43 PolarHBondContact O-N 2.89Å; I40-E44 WeakPolarHBondContact O-CB 3.35Å; I40-E44 PolarHBondContact O-N 3.23Å
41	R	97.4	Very high	95.2	Very high	184 Å²	184	116.3 Å²	116.3	69%	0.694	55%	0.548	S	S	*	.	H	α-helix	trans	-61.8	-43.2	177.5	-178.1	175.5	-179.5	135.8	1.2	112.2	A37 R38 E39 E44 L45	A37-R41 PolarHBondContact O-N 2.91Å; R38-R41 PolarHBondContact O-N 3.48Å; E39-R41 VanDerWaalsContact C-N 3.32Å; E39-R41 PolarHBondContact O-N 2.74Å; R41-E44 PolarHBondContact O-N 3.32Å; R41-L45 HydrophobicContact CG-CD1 4.32Å; R41-L45 VanDerWaalsContact O-CG 3.27Å; R41-L45 WeakPolarHBondContact O-CG 3.42Å; R41-L45 PolarHBondContact O-N 3.48Å
42	M	96.9	Very high	93.9	Very high	128 Å²	128	113.6 Å²	113.6	63%	0.631	55%	0.55	S	S	*	.	H	α-helix	trans	-64.3	-44.5	178.8	-76.5	-64.1	-62.5	0	0	111.7	R38 E39 I40 E44 L45 E46	R38-M42 WeakPolarHBondContact O-CB 3.45Å; R38-M42 WeakPolarHBondContact O-CG 3.32Å; R38-M42 PolarHBondContact O-N 3.35Å; E39-M42 PolarHBondContact O-N 3.21Å; I40-M42 PolarHBondContact O-N 3.04Å; M42-E44 VanDerWaalsContact C-N 3.33Å; M42-E44 PolarHBondContact O-N 2.92Å; M42-L45 WeakPolarHBondContact O-CB 3.49Å; M42-L45 PolarHBondContact O-N 3.19Å; M42-L45 HydrophobicContact SD-CD1 4.48Å; M42-E46 PolarHBondContact O-N 3.09Å
43	K	96.3	Very high	92.3	Very high	153 Å²	153	117.3 Å²	117.3	67%	0.665	56%	0.563	S	S	*	*	H	α-helix	trans	-64.1	-38.2	177.7	-171.9	176	-177.8	177	0	112.3	E39 I40 E46 R47	E39-K43 WeakPolarHBondContact O-CB 3.39Å; E39-K43 PolarHBondContact O-N 3.27Å; I40-K43 PolarHBondContact O-N 2.89Å; K43-E46 PolarHBondContact O-N 3Å; K43-R47 PolarHBondContact O-N 3.4Å
44	E	96.2	Very high	90.5	Very high	72 Å²	72	117.5 Å²	117.5	34%	0.336	57%	0.571	S	S	.	*	H	α-helix	trans	-66.9	-39.2	174.7	-178.8	56.7	-152.4	0	0	111.7	I40 R41 M42 R47 Q48	I40-E44 WeakPolarHBondContact O-CB 3.35Å; I40-E44 PolarHBondContact O-N 3.23Å; R41-E44 PolarHBondContact O-N 3.32Å; M42-E44 VanDerWaalsContact C-N 3.33Å; M42-E44 PolarHBondContact O-N 2.92Å; E44-R47 PolarHBondContact O-N 3.47Å; E44-R47 IonicContact OE1-CZ 3.46Å; E44-R47 IonicContact OE1-NE 3.35Å; E44-R47 PolarHBondContact OE1-NE 2.97Å; E44-R47 IonicContact OE1-NH2 2.74Å; E44-R47 PolarHBondContact OE1-NH2 2.96Å; E44-R47 IonicContact OE2-CZ 3.85Å; E44-R47 IonicContact OE2-NE 3.04Å; E44-R47 PolarHBondContact OE2-NE 2.88Å; E44-R47 IonicContact OE2-NH2 3.78Å; E44-Q48 WeakPolarHBondContact O-CG 3.46Å; E44-Q48 PolarHBondContact O-N 3.47Å; E44-Q48 PolarHBondContact OE1-NE2 3.42Å
45	L	95.4	Very high	88.5	Confident	73 Å²	73	119.4 Å²	119.4	38%	0.382	58%	0.579	S	S	.	*	H	α-helix	trans	-63	-40.7	173.1	-71.7	171.5	0	0	0	111.9	R41 M42 Q48 Q49	R41-L45 HydrophobicContact CG-CD1 4.32Å; R41-L45 VanDerWaalsContact O-CG 3.27Å; R41-L45 WeakPolarHBondContact O-CG 3.42Å; R41-L45 PolarHBondContact O-N 3.48Å; M42-L45 WeakPolarHBondContact O-CB 3.49Å; M42-L45 PolarHBondContact O-N 3.19Å; M42-L45 HydrophobicContact SD-CD1 4.48Å; L45-Q48 PolarHBondContact O-N 2.97Å; L45-Q49 WeakPolarHBondContact O-CG 3.4Å; L45-Q49 PolarHBondContact O-N 2.87Å
46	E	92.8	Very high	86.4	Confident	130 Å²	130	122.8 Å²	122.8	61%	0.607	59%	0.59	S	S	*	*	H	α-helix	trans	-63.2	-43	174.6	-174.4	-176.6	-179.4	0	0	111.6	M42 K43 Q49 K50	M42-E46 PolarHBondContact O-N 3.09Å; K43-E46 PolarHBondContact O-N 3Å; E46-Q49 PolarHBondContact O-N 2.97Å; E46-K50 WeakPolarHBondContact O-CB 3.27Å; E46-K50 PolarHBondContact O-N 3.36Å
47	R	93.4	Very high	84.4	Confident	113 Å²	113	120.4 Å²	120.4	43%	0.426	60%	0.597	S	S	.	*	H	α-helix	trans	-59.3	-47.6	175.2	-170.8	-173.2	75	81.9	7.2	111.3	K43 E44 Q49 K50 E51	K43-R47 PolarHBondContact O-N 3.4Å; E44-R47 PolarHBondContact O-N 3.47Å; E44-R47 IonicContact OE1-CZ 3.46Å; E44-R47 IonicContact OE1-NE 3.35Å; E44-R47 PolarHBondContact OE1-NE 2.97Å; E44-R47 IonicContact OE1-NH2 2.74Å; E44-R47 PolarHBondContact OE1-NH2 2.96Å; E44-R47 IonicContact OE2-CZ 3.85Å; E44-R47 IonicContact OE2-NE 3.04Å; E44-R47 PolarHBondContact OE2-NE 2.88Å; E44-R47 IonicContact OE2-NH2 3.78Å; R47-Q49 PolarHBondContact O-N 3.3Å; R47-K50 PolarHBondContact O-N 2.96Å; R47-E51 VanDerWaalsContact CG-OE1 3.26Å; R47-E51 WeakPolarHBondContact CG-OE1 3.47Å; R47-E51 IonicContact CZ-OE1 3.62Å; R47-E51 IonicContact CZ-OE2 3.55Å; R47-E51 IonicContact NH1-OE1 2.67Å; R47-E51 PolarHBondContact NH1-OE1 3.4Å; R47-E51 IonicContact NH1-OE2 2.72Å; R47-E51 PolarHBondContact NH1-OE2 3.26Å; R47-E51 IonicContact NH2-OE2 3.99Å; R47-E51 WeakPolarHBondContact O-CB 3.42Å; R47-E51 WeakPolarHBondContact O-CG 3.23Å; R47-E51 PolarHBondContact O-N 3.44Å
48	Q	94.2	Very high	82.5	Confident	86 Å²	86	123.8 Å²	123.8	40%	0.402	61%	0.607	S	S	.	*	H	α-helix	trans	-59	-47.2	176.6	-73.1	173.3	20	0	0	111.2	E44 L45 K50 E51 T52	E44-Q48 WeakPolarHBondContact O-CG 3.46Å; E44-Q48 PolarHBondContact O-N 3.47Å; E44-Q48 PolarHBondContact OE1-NE2 3.42Å; L45-Q48 PolarHBondContact O-N 2.97Å; Q48-K50 PolarHBondContact O-N 2.72Å; Q48-E51 PolarHBondContact O-N 2.98Å; Q48-T52 WeakPolarHBondContact O-CB 3.47Å; Q48-T52 VanDerWaalsContact O-CG2 3.27Å; Q48-T52 WeakPolarHBondContact O-CG2 3.26Å; Q48-T52 PolarHBondContact O-N 2.67Å; Q48-T52 PolarHBondContact O-OG1 3.27Å
49	Q	89.4	Confident	80.4	Confident	129 Å²	129	126.9 Å²	126.9	60%	0.603	62%	0.62	S	S	*	*	H	α-helix	trans	-59.3	-46.5	176.7	-74.7	-179.6	-1.5	0	0	111.7	L45 E46 R47 E51 T52 N53	L45-Q49 WeakPolarHBondContact O-CG 3.4Å; L45-Q49 PolarHBondContact O-N 2.87Å; E46-Q49 PolarHBondContact O-N 2.97Å; R47-Q49 PolarHBondContact O-N 3.3Å; Q49-E51 VanDerWaalsContact C-N 3.29Å; Q49-E51 PolarHBondContact O-N 2.83Å; Q49-T52 PolarHBondContact O-N 3.47Å; Q49-T52 PolarHBondContact O-OG1 2.95Å; Q49-N53 VanDerWaalsContact O-CB 3.23Å; Q49-N53 WeakPolarHBondContact O-CB 3.38Å; Q49-N53 PolarHBondContact O-N 3.38Å
50	K	85.7	Confident	78.1	Confident	169 Å²	169	126.6 Å²	126.6	74%	0.735	63%	0.632	S	S	*	*	H	α-helix	trans	-62.9	-36	179.9	-168.8	173.8	-176.7	176.7	0	112.7	E46 R47 Q48	E46-K50 WeakPolarHBondContact O-CB 3.27Å; E46-K50 PolarHBondContact O-N 3.36Å; R47-K50 PolarHBondContact O-N 2.96Å; Q48-K50 PolarHBondContact O-N 2.72Å
51	E	81.3	Confident	75.7	Confident	123 Å²	123	124.1 Å²	124.1	58%	0.575	64%	0.637	S	S	*	*	H	α-helix	trans	-78.1	-33.5	178	-71.5	172.4	-167.4	0	0	112.8	R47 Q48 Q49	R47-E51 VanDerWaalsContact CG-OE1 3.26Å; R47-E51 WeakPolarHBondContact CG-OE1 3.47Å; R47-E51 IonicContact CZ-OE1 3.62Å; R47-E51 IonicContact CZ-OE2 3.55Å; R47-E51 IonicContact NH1-OE1 2.67Å; R47-E51 PolarHBondContact NH1-OE1 3.4Å; R47-E51 IonicContact NH1-OE2 2.72Å; R47-E51 PolarHBondContact NH1-OE2 3.26Å; R47-E51 IonicContact NH2-OE2 3.99Å; R47-E51 WeakPolarHBondContact O-CB 3.42Å; R47-E51 WeakPolarHBondContact O-CG 3.23Å; R47-E51 PolarHBondContact O-N 3.44Å; Q48-E51 PolarHBondContact O-N 2.98Å; Q49-E51 VanDerWaalsContact C-N 3.29Å; Q49-E51 PolarHBondContact O-N 2.83Å
52	T	71.7	Confident	73.6	Confident	110 Å²	110	121.7 Å²	121.7	68%	0.675	65%	0.647	S	S	*	*	H	α-helix	trans	-85	-33.4	178.8	61.4	0	0	0	0	113.6	Q48 Q49	Q48-T52 WeakPolarHBondContact O-CB 3.47Å; Q48-T52 VanDerWaalsContact O-CG2 3.27Å; Q48-T52 WeakPolarHBondContact O-CG2 3.26Å; Q48-T52 PolarHBondContact O-N 2.67Å; Q48-T52 PolarHBondContact O-OG1 3.27Å; Q49-T52 PolarHBondContact O-N 3.47Å; Q49-T52 PolarHBondContact O-OG1 2.95Å
53	N	63.6	Low	71.4	Confident	122 Å²	122	123.3 Å²	123.3	65%	0.652	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.7	11.3	-176.6	-105.1	26.2	0	0	0	114	Q49 Y55 D56	Q49-N53 VanDerWaalsContact O-CB 3.23Å; Q49-N53 WeakPolarHBondContact O-CB 3.38Å; Q49-N53 PolarHBondContact O-N 3.38Å; N53-Y55 PolarHBondContact O-N 2.8Å; N53-D56 PolarHBondContact O-N 3.35Å
54	G	62	Low	69.3	Low	59 Å²	59	119.8 Å²	119.8	61%	0.608	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	24.4	78.4	169.2	0	0	0	0	0	115.7	D56	G54-D56 PolarHBondContact O-N 3.34Å
55	Y	55.3	Low	67.3	Low	208 Å²	208	124.8 Å²	124.8	82%	0.816	68%	0.676	S	S	*	*	S	Bend	trans	48.3	60.7	169.9	-148.5	-84.6	0	0	0	115	N53	N53-Y55 PolarHBondContact O-N 2.8Å
56	D	53.5	Low	65.3	Low	129 Å²	129	126.9 Å²	126.9	69%	0.69	70%	0.697	S	S	*	*			trans	-126.5	52.7	163.8	-164.6	22.7	0	0	0	110.5	N53 G54	N53-D56 PolarHBondContact O-N 3.35Å; G54-D56 PolarHBondContact O-N 3.34Å
57	G	56	Low	63.5	Low	69 Å²	69	131.1 Å²	131.1	71%	0.711	71%	0.708	S	S	*	*			trans	-91.1	4	-179.5	0	0	0	0	0	114.2
58	D	56.9	Low	61.5	Low	128 Å²	128	135.9 Å²	135.9	68%	0.684	73%	0.726	S	S	*	*	S	Bend	trans	-94.4	-1.2	-169.7	-65.3	-31.6	0	0	0	113.8
59	Y	54.3	Low	59.7	Low	221 Å²	221	137.7 Å²	137.7	87%	0.867	75%	0.747	S	S	*	*	S	Bend	trans	-135	4.8	-173.2	-132	-97.2	0	0	0	119.3
60	C	50.4	Low	58.1	Low	131 Å²	131	134.9 Å²	134.9	89%	0.885	75%	0.754	S	S	*	*	S	Bend	trans	-144.2	74.7	177.8	-167.4	0	0	0	0	113.5
61	G	47.1	Very low	56.3	Low	70 Å²	70	137.3 Å²	137.3	72%	0.722	76%	0.758	S	S	*	*			trans	-172.3	1.8	174.5	0	0	0	0	0	117.2	Q63	G61-Q63 PolarHBondContact O-N 2.9Å
62	S	54	Low	54.9	Low	132 Å²	132	137.4 Å²	137.4	92%	0.923	77%	0.769	S	S	*	*			trans	-74.7	40.9	176.9	-58.8	0	0	0	0	113.4
63	Q	50.3	Low	53.6	Low	163 Å²	163	136.7 Å²	136.7	76%	0.762	77%	0.769	S	S	*	*			trans	-117.3	70.4	173	-120.8	178.7	45.5	0	0	111	G61 L65	G61-Q63 PolarHBondContact O-N 2.9Å; Q63-L65 PolarHBondContact O-N 3.45Å
64	S	51.1	Low	52.9	Low	79 Å²	79	140.2 Å²	140.2	55%	0.552	78%	0.781	S	S	*	*				41.5	50.8	125.8	69.7	0	0	0	0	117.9	S66 R67	S64-S66 PolarHBondContact O-N 3.42Å; S64-S66 VanDerWaalsContact O-N 3.11Å; S64-R67 PolarHBondContact O-N 3.31Å
65	L	55.3	Low	52.4	Low	177 Å²	177	147.2 Å²	147.2	93%	0.927	79%	0.791	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.1	-1.5	165	-66	178.3	0	0	0	112.6	Q63 R67	Q63-L65 PolarHBondContact O-N 3.45Å; L65-R67 VanDerWaalsContact C-N 3.33Å; L65-R67 PolarHBondContact O-N 2.88Å
66	S	53.3	Low	52.1	Low	117 Å²	117	140 Å²	140	82%	0.818	78%	0.78	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.1	1.8	176.3	-146.6	0	0	0	0	114.8	S64	S64-S66 PolarHBondContact O-N 3.42Å; S64-S66 VanDerWaalsContact O-N 3.11Å
67	R	54	Low	52	Low	219 Å²	219	139.8 Å²	139.8	83%	0.826	79%	0.789	S	S	*	*	S	Bend	trans	-113.4	116.7	172.5	-79.7	-154.1	-104.7	-105.1	5	111.2	S64 L65	S64-R67 PolarHBondContact O-N 3.31Å; L65-R67 VanDerWaalsContact C-N 3.33Å; L65-R67 PolarHBondContact O-N 2.88Å
68	R	51.8	Low	52.1	Low	213 Å²	213	142.4 Å²	142.4	80%	0.804	78%	0.782	S	S	*	*			trans	108.4	28	156.3	-144.2	163.8	-169.1	-97.3	1.4	117.3	G70	R68-G70 PolarHBondContact O-N 3.17Å
69	S	57.3	Low	52	Low	123 Å²	123	143.8 Å²	143.8	86%	0.86	79%	0.789	S	S	*	*	S	Bend	trans	-74.1	104.8	139	57.2	0	0	0	0	108.8
70	G	54.9	Low	51.9	Low	71 Å²	71	140.4 Å²	140.4	73%	0.732	79%	0.785	S	S	*	*	S	Bend	trans	119.1	46.9	156.6	0	0	0	0	0	120.4	R68	R68-G70 PolarHBondContact O-N 3.17Å
71	R	48.7	Very low	52.2	Low	219 Å²	219	139.7 Å²	139.7	83%	0.826	78%	0.782	S	S	*	*			trans	-137.8	118.2	157.2	-91.1	-163.7	172.1	-149.5	-1.1	112.1
72	P	50.6	Low	52.7	Low	126 Å²	126	141.7 Å²	141.7	82%	0.818	79%	0.785	S	S	*	*			trans	-75.3	123.5	161.3	32.8	-27.1	0	0	0	106.8
73	S	46	Very low	52.7	Low	94 Å²	94	140.5 Å²	140.5	66%	0.657	78%	0.776	S	S	*	*			trans	-129.6	102.1	168.7	-177	0	0	0	0	106.5	Y75	S73-Y75 PolarHBondContact O-N 3.48Å
74	E	48.3	Very low	53.2	Low	197 Å²	197	145 Å²	145	92%	0.921	79%	0.786	S	S	*	*	S	Bend	trans	-67.4	67.9	173.5	-64.3	177.6	147.5	0	0	110.2
75	Y	50.3	Low	53.5	Low	206 Å²	206	145.7 Å²	145.7	81%	0.808	80%	0.797	S	S	*	*			trans	-166.1	80.6	162.5	-149.1	-99.9	0	0	0	110	S73	S73-Y75 PolarHBondContact O-N 3.48Å
76	G	50.8	Low	53.3	Low	57 Å²	57	142.6 Å²	142.6	59%	0.588	79%	0.79	S	S	*	*			trans	-167.4	21.1	178.9	0	0	0	0	0	113.8	H78	G76-H78 PolarHBondContact O-N 3.11Å
77	S	50.8	Low	53	Low	124 Å²	124	141 Å²	141	87%	0.867	78%	0.779	S	S	*	*			trans	-79.3	62.1	178.7	-46.9	0	0	0	0	110.4
78	H	57.2	Low	53.3	Low	124 Å²	124	143 Å²	143	57%	0.574	79%	0.787	S	S	*	*	S	Bend	trans	-170.8	139	168.4	48	-79.1	0	0	0	106.3	G76	G76-H78 PolarHBondContact O-N 3.11Å
79	L	55	Low	53.7	Low	157 Å²	157	136.5 Å²	136.5	82%	0.822	78%	0.778	S	S	*	*	S	Bend	trans	96.2	20	176.3	-48.4	165.4	0	0	0	118.9
80	N	53.5	Low	53.4	Low	150 Å²	150	136.8 Å²	136.8	80%	0.802	78%	0.78	S	S	*	*			trans	-138.3	44.8	157.7	-147.7	65.8	0	0	0	113.7	S82	N80-S82 PolarHBondContact O-N 3.48Å
81	S	54.8	Low	53.6	Low	116 Å²	116	139.1 Å²	139.1	81%	0.811	79%	0.785	S	S	*	*			trans	-87.9	88.4	162.7	-64.6	0	0	0	0	108.9
82	S	58	Low	54.1	Low	111 Å²	111	133.1 Å²	133.1	78%	0.776	78%	0.783	S	S	*	*			trans	164.7	86.2	149.4	-81.2	0	0	0	0	111.1	N80	N80-S82 PolarHBondContact O-N 3.48Å
83	S	54.5	Low	54.5	Low	107 Å²	107	138.9 Å²	138.9	75%	0.748	79%	0.788	S	S	*	*	S	Bend	trans	-160	-1.2	158.7	-78.5	0	0	0	0	114.1
84	R	60.3	Low	54.9	Low	257 Å²	257	139.2 Å²	139.2	97%	0.97	80%	0.796	S	S	*	*	S	Bend	trans	-94.2	6.7	-178.9	-58	-170.3	107.1	162.9	4.8	114.5
85	A	58.5	Low	54.9	Low	95 Å²	95	134.9 Å²	134.9	79%	0.785	79%	0.788	S	S	*	*			trans	-113.5	60.7	175.2	0	0	0	0	0	111
86	S	50.1	Low	55.2	Low	112 Å²	112	131 Å²	131	78%	0.783	79%	0.788	S	S	*	*			trans	-108.8	74.3	159.2	173.3	0	0	0	0	107.7	R88	S86-R88 PolarHBondContact O-N 2.9Å
87	S	48.4	Very low	55.4	Low	83 Å²	83	134.6 Å²	134.6	58%	0.58	80%	0.798	S	S	*	*			trans	-47.6	124.4	168.2	-50.4	0	0	0	0	108.7	A89	S87-A89 PolarHBondContact O-N 3.49Å
88	R	60.3	Low	55.3	Low	261 Å²	261	138.9 Å²	138.9	99%	0.985	82%	0.818	S	S	*	*	S	Bend		40.7	7.2	82.3	-73.4	-175.6	165.1	141.5	-4.2	116.5	S86	S86-R88 PolarHBondContact O-N 2.9Å
89	A	59.4	Low	55.2	Low	76 Å²	76	139.6 Å²	139.6	63%	0.628	83%	0.831	S	S	*	*			trans	-108.4	-4.9	-171.7	0	0	0	0	0	115.4	S87	S87-A89 PolarHBondContact O-N 3.49Å
90	S	51.5	Low	55.2	Low	129 Å²	129	138.7 Å²	138.7	90%	0.902	83%	0.831	S	S	*	*	S	Bend	trans	-99.2	23.2	-175.3	-57.1	0	0	0	0	115.9
91	S	58.2	Low	55.3	Low	120 Å²	120	138.1 Å²	138.1	84%	0.839	83%	0.833	S	S	*	*	S	Bend	trans	-116	13.5	-176.7	-165.6	0	0	0	0	116.3
92	A	58.8	Low	55.3	Low	93 Å²	93	139.4 Å²	139.4	77%	0.769	83%	0.834	S	S	*	*	S	Bend	trans	-133.2	28	-172	0	0	0	0	0	116.2
93	R	60.3	Low	55.2	Low	248 Å²	248	141.1 Å²	141.1	94%	0.936	84%	0.838	S	S	*	*			trans	-155	52.1	176.6	-124.4	174.1	-176.5	-96.8	1.8	115.4
94	A	54	Low	55.2	Low	100 Å²	100	143.4 Å²	143.4	83%	0.826	84%	0.844	S	S	*	*			trans	-119.7	79.3	155.5	0	0	0	0	0	107.9
95	S	47.7	Very low	54.8	Low	107 Å²	107	135.3 Å²	135.3	75%	0.748	84%	0.835	S	S	*	*			trans	-69.3	135.8	158.4	-90.3	0	0	0	0	107.9	V97	S95-V97 PolarHBondContact O-N 2.85Å
96	P	58.2	Low	54.6	Low	125 Å²	125	138.4 Å²	138.4	81%	0.812	84%	0.838	S	S	*	*			trans	-68.6	121.8	166.8	29.2	-31.1	0	0	0	108.8
97	V	53.8	Low	54.9	Low	132 Å²	132	140.6 Å²	140.6	80%	0.8	84%	0.843	S	S	*	*			trans	-131.3	98.7	157.1	179.4	0	0	0	0	106	S95	S95-V97 PolarHBondContact O-N 2.85Å
98	V	48.9	Very low	55.5	Low	213 Å²	213	145.8 Å²	145.8	100%	1.291	87%	0.867	S	S	*	*			trans	156	0	149.6	163.2	0	0	0	0	107.2

Retrieved 98 of 98 residues in 13.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).