A0A087WPT1_MOUSE Loading...

Brca1 associated protein 1

AlphaFold DB , UniProt , Accession A0A087WPT1, Species MOUSE (Mus musculus, Mouse), Gene Bap1, Length 93 aa.

						>A0A087WPT1_MOUSE|A0A087WPT1|Bap1
HNYAKSPMQEEEDLAAGVGRSRVPVRAPQQYSEDEDDYEDEDEDVQNTNPAIRCFLEKMTAYFVLTAYATTVLSVTWVLSLARACCTLLKMVY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	H	61.5	Low	59.8	Low	244 Å²	244	162.3 Å²	162.3	100%	1.13	83%	0.826	S	S	*	*				0	109.9	0	-76.7	-69.3	0	0	0	108.7
2	N	56	Low	59.5	Low	144 Å²	144	164.7 Å²	164.7	77%	0.77	83%	0.832	S	S	*	*			trans	-121.5	109.7	-175.8	-96.6	-64.9	0	0	0	109.1
3	Y	53.8	Low	59.4	Low	200 Å²	200	162.5 Å²	162.5	78%	0.784	82%	0.824	S	S	*	*			trans	43.1	101.5	148.1	-56.9	-87.5	0	0	0	118.2	K5	Y3-K5 PolarHBondContact O-N 3.43Å
4	A	59.9	Low	59.1	Low	105 Å²	105	163.5 Å²	163.5	87%	0.868	83%	0.831	S	S	*	*			trans	-59.2	67.7	140.9	0	0	0	0	0	109.9	S6	A4-S6 VanDerWaalsContact C-N 3.34Å; A4-S6 PolarHBondContact O-N 3.07Å; A4-S6 VanDerWaalsContact O-N 3.09Å
5	K	64.8	Low	59	Low	185 Å²	185	159.3 Å²	159.3	80%	0.804	83%	0.831	S	S	*	*			trans	-73.1	95.3	166.6	-171.4	176.4	-175.7	-175	0	105.8	Y3	Y3-K5 PolarHBondContact O-N 3.43Å
6	S	65	Low	58.7	Low	101 Å²	101	155.8 Å²	155.8	71%	0.706	83%	0.832	S	S	*	*			trans	-56.6	127.3	167.7	-60.9	0	0	0	0	107.7	A4 M8	A4-S6 VanDerWaalsContact C-N 3.34Å; A4-S6 PolarHBondContact O-N 3.07Å; A4-S6 VanDerWaalsContact O-N 3.09Å; S6-M8 PolarHBondContact O-N 3.09Å
7	P	59.6	Low	58.2	Low	121 Å²	121	151 Å²	151	79%	0.786	83%	0.829	S	S	*	*			trans	-66.8	104.4	172.5	27.8	-29.7	0	0	0	106.6	Q9	P7-Q9 VanDerWaalsContact C-N 3.29Å; P7-Q9 PolarHBondContact O-N 3.36Å
8	M	55.7	Low	57.5	Low	163 Å²	163	151.1 Å²	151.1	80%	0.803	83%	0.834	S	S	*	*			trans	-62.4	97.3	164.8	-173.7	166	52	0	0	105.9	S6 E10	S6-M8 PolarHBondContact O-N 3.09Å; M8-E10 VanDerWaalsContact C-N 3.29Å; M8-E10 PolarHBondContact O-N 3.31Å; M8-E10 VanDerWaalsContact O-N 3.09Å
9	Q	64.2	Low	57.3	Low	195 Å²	195	146.4 Å²	146.4	91%	0.911	82%	0.824	S	S	*	*			trans	-80.3	83.3	177.8	-173.3	173.7	-4.2	0	0	107.4	P7	P7-Q9 VanDerWaalsContact C-N 3.29Å; P7-Q9 PolarHBondContact O-N 3.36Å
10	E	59.2	Low	56.6	Low	138 Å²	138	151.5 Å²	151.5	65%	0.645	83%	0.83	S	S	*	*			trans	-119.9	78.4	174.4	-167.3	179.5	-155.5	0	0	108.7	M8	M8-E10 VanDerWaalsContact C-N 3.29Å; M8-E10 PolarHBondContact O-N 3.31Å; M8-E10 VanDerWaalsContact O-N 3.09Å
11	E	57.6	Low	56.1	Low	189 Å²	189	149.8 Å²	149.8	88%	0.883	83%	0.828	S	S	*	*			trans	-143	71	161.8	-71.7	-167.4	-176.3	0	0	108.9
12	E	56.7	Low	55.8	Low	191 Å²	191	149.4 Å²	149.4	89%	0.893	82%	0.817	S	S	*	*			trans	-152.2	6.2	161	-110.3	163	-158.7	0	0	114	L14	E12-L14 VanDerWaalsContact C-N 3.29Å; E12-L14 PolarHBondContact O-N 2.96Å; E12-L14 VanDerWaalsContact O-N 3.07Å
13	D	58.2	Low	55.3	Low	137 Å²	137	149.1 Å²	149.1	73%	0.733	82%	0.82	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.6	39.4	-177.3	-158.9	29	0	0	0	115
14	L	54.8	Low	55.1	Low	176 Å²	176	144.9 Å²	144.9	92%	0.921	82%	0.817	S	S	*	*	T	Hydrogen-bonded Turn	trans	-142	25	-179.4	-100.9	114.1	0	0	0	116.8	E12	E12-L14 VanDerWaalsContact C-N 3.29Å; E12-L14 PolarHBondContact O-N 2.96Å; E12-L14 VanDerWaalsContact O-N 3.07Å
15	A	57.3	Low	54.6	Low	100 Å²	100	146.9 Å²	146.9	83%	0.826	82%	0.818	S	S	*	*			trans	-137.6	50.6	174.5	0	0	0	0	0	114.6
16	A	54.4	Low	53.4	Low	103 Å²	103	149.8 Å²	149.8	85%	0.851	82%	0.824	S	S	*	*			trans	-135.6	74	159.9	0	0	0	0	0	110	V18	A16-V18 PolarHBondContact O-N 2.93Å
17	G	51.5	Low	52.3	Low	75 Å²	75	148.1 Å²	148.1	77%	0.773	82%	0.816	S	S	*	*			trans	-52.1	131.5	175	0	0	0	0	0	113.1
18	V	44.5	Very low	51.9	Low	153 Å²	153	148.1 Å²	148.1	93%	0.927	82%	0.816	S	S	*	*			trans	1.6	114.4	146.7	178	0	0	0	0	115.9	A16	A16-V18 PolarHBondContact O-N 2.93Å
19	G	53.1	Low	51.4	Low	62 Å²	62	147.6 Å²	147.6	64%	0.639	81%	0.812	S	S	*	*			trans	121.9	102.9	133.7	0	0	0	0	0	117.2
20	R	44.5	Very low	50.9	Low	248 Å²	248	146.8 Å²	146.8	94%	0.936	81%	0.808	S	S	*	*				177.2	113.2	123.2	-95.6	163.7	147.2	-139.6	-11.6	114.3
21	S	45.7	Very low	49.9	Very low	115 Å²	115	149.5 Å²	149.5	80%	0.804	81%	0.814	S	S	*	*				69.1	100.7	130	-157.7	0	0	0	0	122.5
22	R	55.8	Low	49.5	Very low	236 Å²	236	145.5 Å²	145.5	89%	0.891	81%	0.806	S	S	*	*			trans	5.2	129.1	143.6	-61.2	173.9	177.3	148	-0.5	119.5
23	V	44.3	Very low	49.4	Very low	138 Å²	138	146 Å²	146	84%	0.836	81%	0.809	S	S	*	*				-160.3	137.4	125.9	172.7	0	0	0	0	109.8
24	P	49.4	Very low	49.6	Very low	112 Å²	112	146.7 Å²	146.7	73%	0.727	81%	0.813	S	S	*	*			trans	-88.7	144.1	173.7	15.5	1.7	0	0	0	114
25	V	50.8	Low	49.7	Very low	146 Å²	146	146.4 Å²	146.4	89%	0.885	81%	0.806	S	S	*	*			trans	36.5	119.2	149.4	-175.3	0	0	0	0	118.8
26	R	39.6	Very low	49.8	Very low	247 Å²	247	147.6 Å²	147.6	93%	0.932	80%	0.799	S	S	*	*			trans	-139.4	105.7	154.7	-169.1	170.3	-179.3	137.8	-1.4	112
27	A	40.5	Very low	50.4	Low	65 Å²	65	149.7 Å²	149.7	54%	0.537	80%	0.796	S	S	.	*			trans	46.1	131	152.6	0	0	0	0	0	121.7	Q29	A27-Q29 PolarHBondContact O-N 3.31Å
28	P	51.2	Low	50.4	Low	121 Å²	121	156 Å²	156	79%	0.786	80%	0.798	S	S	*	*			trans	-72.3	117.7	163.2	31	-29	0	0	0	108.9	Q30	P28-Q30 PolarHBondContact O-N 3.09Å
29	Q	45.6	Very low	51.1	Low	153 Å²	153	157 Å²	157	72%	0.715	79%	0.793	S	S	*	*			trans	-82.1	99.1	162	-76.7	-76.3	-51.2	0	0	106.5	A27 Y31	A27-Q29 PolarHBondContact O-N 3.31Å; Q29-Y31 PolarHBondContact O-N 2.78Å
30	Q	54.5	Low	51	Low	177 Å²	177	160 Å²	160	83%	0.827	79%	0.794	S	S	*	*			trans	-57.9	118.6	160.9	-66.8	176.9	-79.1	0	0	108.2	P28	P28-Q30 PolarHBondContact O-N 3.09Å
31	Y	38.4	Very low	51.4	Low	196 Å²	196	156.4 Å²	156.4	77%	0.769	79%	0.788	S	S	*	*			trans	-138.8	109.3	151.2	-86	-77.3	0	0	0	109.2	Q29	Q29-Y31 PolarHBondContact O-N 2.78Å
32	S	48.9	Very low	51.4	Low	104 Å²	104	157.4 Å²	157.4	73%	0.727	78%	0.784	S	S	*	*			trans	55.7	94.3	149.1	51.9	0	0	0	0	119.3	D34	S32-D34 PolarHBondContact O-N 3.3Å
33	E	54.5	Low	51	Low	201 Å²	201	155 Å²	155	94%	0.939	78%	0.783	S	S	*	*			trans	-61.2	96.3	138.3	-65.5	164.2	139	0	0	108.8
34	D	62.9	Low	51.1	Low	152 Å²	152	154.6 Å²	154.6	81%	0.813	78%	0.776	S	S	*	*			trans	172.7	140.4	143.3	-110.8	-25.7	0	0	0	109.1	S32	S32-D34 PolarHBondContact O-N 3.3Å
35	E	56.6	Low	51.2	Low	170 Å²	170	154.4 Å²	154.4	79%	0.794	77%	0.773	S	S	*	*	S	Bend	trans	83.6	83.6	179.3	-57.8	-154.4	155.7	0	0	115.8
36	D	59.5	Low	51	Low	125 Å²	125	155.4 Å²	155.4	67%	0.668	77%	0.768	S	S	*	*				176	106.8	84.9	-82.6	-34.9	0	0	0	110.5	Y38	D36-Y38 VanDerWaalsContact C-N 3.33Å; D36-Y38 HydrophobicContact CB-CD2 4.23Å; D36-Y38 PolarHBondContact O-N 3.45Å
37	D	65.8	Low	51.4	Low	148 Å²	148	148.8 Å²	148.8	79%	0.791	75%	0.751	S	S	*	*			trans	-64.7	90.7	162.1	178.7	26.6	0	0	0	109
38	Y	51.8	Low	52.3	Low	208 Å²	208	148.4 Å²	148.4	82%	0.816	74%	0.742	S	S	*	*			trans	-114.9	85.8	157.3	-87.3	-83.9	0	0	0	108	D36 D40	D36-Y38 VanDerWaalsContact C-N 3.33Å; D36-Y38 HydrophobicContact CB-CD2 4.23Å; D36-Y38 PolarHBondContact O-N 3.45Å; Y38-D40 PolarHBondContact O-N 3.32Å
39	E	58.8	Low	53	Low	174 Å²	174	146 Å²	146	81%	0.813	72%	0.722	S	S	*	*			trans	-53.5	108	144	-82.5	-171.8	169.2	0	0	107.9
40	D	51.6	Low	54	Low	125 Å²	125	143.7 Å²	143.7	67%	0.668	72%	0.721	S	S	*	*			trans	-165.5	112.3	141.1	-127.2	-8	0	0	0	112.7	Y38 D42	Y38-D40 PolarHBondContact O-N 3.32Å; D40-D42 PolarHBondContact O-N 3.41Å
41	E	53.3	Low	54.5	Low	171 Å²	171	138 Å²	138	80%	0.799	70%	0.704	S	S	*	*	S	Bend	trans	70.7	12.4	135.4	-77.3	-173.5	168.4	0	0	123.1
42	D	46	Very low	56.1	Low	137 Å²	137	133 Å²	133	73%	0.733	69%	0.689	S	S	*	*	G	3₁₀ helix	trans	-91.2	4.3	170.6	-78.3	-39.9	0	0	0	115	D40 D44	D40-D42 PolarHBondContact O-N 3.41Å; D42-D44 VanDerWaalsContact C-N 3.29Å; D42-D44 PolarHBondContact O-N 2.76Å
43	E	47.6	Very low	57	Low	184 Å²	184	135.7 Å²	135.7	86%	0.86	68%	0.684	S	S	*	*	G	3₁₀ helix	trans	-79.3	-6.1	177.9	-117.4	177.4	172.2	0	0	114.1
44	D	46.3	Very low	57.6	Low	131 Å²	131	128.5 Å²	128.5	70%	0.701	66%	0.655	S	S	*	*	G	3₁₀ helix	trans	-94.7	-4.4	177.6	-125.5	-11.5	0	0	0	114	D42 Q46	D42-D44 VanDerWaalsContact C-N 3.29Å; D42-D44 PolarHBondContact O-N 2.76Å; D44-Q46 VanDerWaalsContact C-N 3.3Å
45	V	50.4	Low	57.9	Low	108 Å²	108	128.5 Å²	128.5	66%	0.655	65%	0.648	S	S	*	*	S	Bend	trans	-79.5	-18.8	170.4	179.7	0	0	0	0	111.2
46	Q	46.8	Very low	58.7	Low	167 Å²	167	125.4 Å²	125.4	78%	0.78	64%	0.637	S	S	*	*	S	Bend	trans	-104.2	-7.2	-177.2	-63.1	-146.3	-2.1	0	0	115.1	D44 T48	D44-Q46 VanDerWaalsContact C-N 3.3Å; Q46-T48 PolarHBondContact O-N 2.84Å; Q46-T48 PolarHBondContact O-OG1 3.41Å
47	N	49.4	Very low	59.4	Low	107 Å²	107	127 Å²	127	57%	0.572	64%	0.64	S	S	*	*			trans	-73.2	55.7	158.1	-169.8	17.6	0	0	0	110.1	N49	N47-N49 PolarHBondContact O-N 2.88Å
48	T	58.7	Low	60.2	Low	57 Å²	57	126.3 Å²	126.3	35%	0.35	63%	0.63	S	S	.	*			trans	-69.1	75.5	162.8	52.5	0	0	0	0	106.8	Q46 P50 R53	Q46-T48 PolarHBondContact O-N 2.84Å; Q46-T48 PolarHBondContact O-OG1 3.41Å; T48-P50 VanDerWaalsContact O-N 3.09Å; T48-R53 VanDerWaalsContact CB-CG 3.49Å; T48-R53 HydrophobicContact CG2-CG 4.18Å; T48-R53 WeakPolarHBondContact OG1-CD 3.43Å
49	N	64.8	Low	61.6	Low	71 Å²	71	121.6 Å²	121.6	38%	0.38	62%	0.617	S	S	.	*			trans	-38.4	124.8	168.6	-178.2	-36.1	0	0	0	105.8	N47 A51 I52 R53	N47-N49 PolarHBondContact O-N 2.88Å; N49-A51 CarbonylContact O-C 3.57Å; N49-A51 PolarHBondContact O-N 3.44Å; N49-A51 WeakPolarHBondContact OD1-CB 3.49Å; N49-A51 PolarHBondContact OD1-N 2.88Å; N49-I52 HydrophobicContact CB-CB 4.35Å; N49-I52 HydrophobicContact CB-CD1 3.81Å; N49-I52 HydrophobicContact CB-CG1 3.92Å; N49-I52 WeakPolarHBondContact O-CA 3.43Å; N49-I52 WeakPolarHBondContact O-CB 3.36Å; N49-I52 PolarHBondContact O-N 2.99Å; N49-R53 PolarHBondContact O-N 3.47Å
50	P	67.4	Low	62.9	Low	105 Å²	105	118 Å²	118	68%	0.682	61%	0.607	S	S	*	*	H	α-helix	trans	-54.7	-24.4	-175.1	22.1	-33.9	0	0	0	111	T48 C54	T48-P50 VanDerWaalsContact O-N 3.09Å; P50-C54 WeakPolarHBondContact O-CB 3.45Å; P50-C54 PolarHBondContact O-N 3.41Å
51	A	65.4	Low	64.5	Low	58 Å²	58	115.2 Å²	115.2	48%	0.479	60%	0.601	S	S	.	*	H	α-helix	trans	-61.8	-47.7	168	0	0	0	0	0	113.2	N49 C54 F55	N49-A51 CarbonylContact O-C 3.57Å; N49-A51 PolarHBondContact O-N 3.44Å; N49-A51 WeakPolarHBondContact OD1-CB 3.49Å; N49-A51 PolarHBondContact OD1-N 2.88Å; A51-C54 PolarHBondContact O-N 3.48Å; A51-F55 WeakPolarHBondContact O-CB 3.32Å; A51-F55 PolarHBondContact O-N 3.35Å
52	I	71.9	Confident	66.2	Low	89 Å²	89	114.9 Å²	114.9	46%	0.456	59%	0.593	S	S	.	*	H	α-helix	trans	-63.8	-43.3	-179.8	-64	171.3	0	0	0	111.1	N49 F55 L56	N49-I52 HydrophobicContact CB-CB 4.35Å; N49-I52 HydrophobicContact CB-CD1 3.81Å; N49-I52 HydrophobicContact CB-CG1 3.92Å; N49-I52 WeakPolarHBondContact O-CA 3.43Å; N49-I52 WeakPolarHBondContact O-CB 3.36Å; N49-I52 PolarHBondContact O-N 2.99Å; I52-F55 PolarHBondContact O-N 2.88Å; I52-L56 HydrophobicContact CG2-CD1 3.65Å; I52-L56 HydrophobicContact CG2-CG 4.43Å; I52-L56 WeakPolarHBondContact O-CB 3.18Å; I52-L56 VanDerWaalsContact O-CD1 3.31Å; I52-L56 WeakPolarHBondContact O-CD1 3.41Å; I52-L56 VanDerWaalsContact O-CG 3.29Å; I52-L56 WeakPolarHBondContact O-CG 3.24Å; I52-L56 PolarHBondContact O-N 3.49Å
53	R	67.6	Low	68.3	Low	162 Å²	162	115.5 Å²	115.5	61%	0.611	59%	0.59	S	S	*	*	H	α-helix	trans	-64.9	-45.5	176.1	-57.4	-171	72.8	166.6	-4.9	112.3	T48 N49 F55 L56 E57	T48-R53 VanDerWaalsContact CB-CG 3.49Å; T48-R53 HydrophobicContact CG2-CG 4.18Å; T48-R53 WeakPolarHBondContact OG1-CD 3.43Å; N49-R53 PolarHBondContact O-N 3.47Å; R53-F55 VanDerWaalsContact C-N 3.25Å; R53-F55 PolarHBondContact O-N 2.91Å; R53-L56 PolarHBondContact O-N 3.49Å; R53-E57 WeakPolarHBondContact O-CB 3.21Å; R53-E57 PolarHBondContact O-N 3.04Å
54	C	67.7	Low	70.4	Confident	50 Å²	50	111.1 Å²	111.1	34%	0.338	58%	0.576	S	S	.	*	H	α-helix	trans	-64.4	-32.8	176.2	-172.6	0	0	0	0	111.5	P50 A51 K58	P50-C54 WeakPolarHBondContact O-CB 3.45Å; P50-C54 PolarHBondContact O-N 3.41Å; A51-C54 PolarHBondContact O-N 3.48Å; C54-K58 WeakPolarHBondContact O-CB 3.06Å; C54-K58 WeakPolarHBondContact O-CD 3.3Å; C54-K58 WeakPolarHBondContact O-CG 3.41Å; C54-K58 PolarHBondContact O-N 2.86Å; C54-K58 VanDerWaalsContact O-N 3.17Å; C54-K58 VanDerWaalsContact SG-CE 3.52Å; C54-K58 PolarHBondContact SG-NZ 2.82Å
55	F	68.2	Low	72.6	Confident	152 Å²	152	110.3 Å²	110.3	67%	0.667	57%	0.571	S	S	*	*	H	α-helix	trans	-72.1	-46.2	176.6	-154.4	-91.2	0	0	0	111.3	A51 I52 R53 E57 K58 M59	A51-F55 WeakPolarHBondContact O-CB 3.32Å; A51-F55 PolarHBondContact O-N 3.35Å; I52-F55 PolarHBondContact O-N 2.88Å; R53-F55 VanDerWaalsContact C-N 3.25Å; R53-F55 PolarHBondContact O-N 2.91Å; F55-E57 PolarHBondContact O-N 3.36Å; F55-K58 CarbonylContact O-C 3.46Å; F55-K58 PolarHBondContact O-N 3.48Å; F55-M59 VanDerWaalsContact O-CB 3.24Å; F55-M59 WeakPolarHBondContact O-CB 3.22Å; F55-M59 PolarHBondContact O-N 3.36Å
56	L	73.8	Confident	74.7	Confident	105 Å²	105	107.8 Å²	107.8	55%	0.55	56%	0.555	S	S	.	*	H	α-helix	trans	-60.5	-42.4	176.7	-75.8	154.8	0	0	0	112	I52 R53 M59	I52-L56 HydrophobicContact CG2-CD1 3.65Å; I52-L56 HydrophobicContact CG2-CG 4.43Å; I52-L56 WeakPolarHBondContact O-CB 3.18Å; I52-L56 VanDerWaalsContact O-CD1 3.31Å; I52-L56 WeakPolarHBondContact O-CD1 3.41Å; I52-L56 VanDerWaalsContact O-CG 3.29Å; I52-L56 WeakPolarHBondContact O-CG 3.24Å; I52-L56 PolarHBondContact O-N 3.49Å; R53-L56 PolarHBondContact O-N 3.49Å; L56-M59 WeakPolarHBondContact O-CB 3.34Å; L56-M59 PolarHBondContact O-N 3.5Å
57	E	73.9	Confident	76.9	Confident	157 Å²	157	101.8 Å²	101.8	73%	0.734	53%	0.534	S	S	*	.	H	α-helix	trans	-64.4	-43	177.2	-167.6	-176.9	161.9	0	0	111.5	R53 F55 M59	R53-E57 WeakPolarHBondContact O-CB 3.21Å; R53-E57 PolarHBondContact O-N 3.04Å; F55-E57 PolarHBondContact O-N 3.36Å; E57-M59 VanDerWaalsContact C-N 3.34Å
58	K	82.2	Confident	79.1	Confident	134 Å²	134	104 Å²	104	58%	0.583	54%	0.536	S	S	*	.	H	α-helix	trans	-75.5	-22.1	177.5	-70.1	173.4	-179	172.4	0	113.3	C54 F55 T60 A61 Y62	C54-K58 WeakPolarHBondContact O-CB 3.06Å; C54-K58 WeakPolarHBondContact O-CD 3.3Å; C54-K58 WeakPolarHBondContact O-CG 3.41Å; C54-K58 PolarHBondContact O-N 2.86Å; C54-K58 VanDerWaalsContact O-N 3.17Å; C54-K58 VanDerWaalsContact SG-CE 3.52Å; C54-K58 PolarHBondContact SG-NZ 2.82Å; F55-K58 CarbonylContact O-C 3.46Å; F55-K58 PolarHBondContact O-N 3.48Å; K58-T60 VanDerWaalsContact C-N 3.33Å; K58-T60 PolarHBondContact O-N 2.78Å; K58-A61 PolarHBondContact O-N 3.28Å; K58-Y62 WeakPolarHBondContact O-CB 3.42Å; K58-Y62 PolarHBondContact O-N 3.17Å
59	M	81.8	Confident	80.8	Confident	110 Å²	110	103.2 Å²	103.2	54%	0.542	54%	0.535	S	S	.	.	H	α-helix	trans	-64.9	-38.7	-177.5	-168.2	171.1	-176.5	0	0	111.4	F55 L56 E57 F63	F55-M59 VanDerWaalsContact O-CB 3.24Å; F55-M59 WeakPolarHBondContact O-CB 3.22Å; F55-M59 PolarHBondContact O-N 3.36Å; L56-M59 WeakPolarHBondContact O-CB 3.34Å; L56-M59 PolarHBondContact O-N 3.5Å; E57-M59 VanDerWaalsContact C-N 3.34Å; M59-F63 VanDerWaalsContact O-CB 3.22Å; M59-F63 WeakPolarHBondContact O-CB 3.26Å; M59-F63 PolarHBondContact O-N 3.4Å
60	T	85.2	Confident	82.2	Confident	99 Å²	99	103.5 Å²	103.5	61%	0.607	54%	0.539	S	S	*	.	H	α-helix	trans	-66.1	-47.4	176.3	-53.3	0	0	0	0	111.2	K58 Y62 F63 V64	K58-T60 VanDerWaalsContact C-N 3.33Å; K58-T60 PolarHBondContact O-N 2.78Å; T60-Y62 PolarHBondContact O-N 3.47Å; T60-F63 PolarHBondContact O-N 2.86Å; T60-V64 WeakPolarHBondContact O-CG2 3.31Å; T60-V64 PolarHBondContact O-N 3.41Å
61	A	86.6	Confident	83.5	Confident	66 Å²	66	102 Å²	102	55%	0.545	53%	0.529	S	S	.	.	H	α-helix	trans	-63.6	-41.4	177.2	0	0	0	0	0	112.1	K58 V64 L65	K58-A61 PolarHBondContact O-N 3.28Å; A61-V64 PolarHBondContact O-N 3.27Å; A61-L65 WeakPolarHBondContact O-CB 3.47Å; A61-L65 PolarHBondContact O-N 3.05Å
62	Y	88.6	Confident	84.9	Confident	163 Å²	163	102.1 Å²	102.1	64%	0.639	52%	0.523	S	S	*	.	H	α-helix	trans	-65.4	-40.5	177.1	-176.2	-99.1	0	0	0	112	K58 T60 L65 T66	K58-Y62 WeakPolarHBondContact O-CB 3.42Å; K58-Y62 PolarHBondContact O-N 3.17Å; T60-Y62 PolarHBondContact O-N 3.47Å; Y62-L65 PolarHBondContact O-N 3.23Å; Y62-T66 VanDerWaalsContact O-CB 3.24Å; Y62-T66 WeakPolarHBondContact O-CB 3.31Å; Y62-T66 PolarHBondContact O-N 3.01Å; Y62-T66 PolarHBondContact O-OG1 3.03Å
63	F	91	Very high	86	Confident	151 Å²	151	103.1 Å²	103.1	66%	0.662	53%	0.529	S	S	*	.	H	α-helix	trans	-62.9	-48.8	176	-179.6	-99.4	0	0	0	111.6	M59 T60 L65 T66 A67	M59-F63 VanDerWaalsContact O-CB 3.22Å; M59-F63 WeakPolarHBondContact O-CB 3.26Å; M59-F63 PolarHBondContact O-N 3.4Å; T60-F63 PolarHBondContact O-N 2.86Å; F63-L65 PolarHBondContact O-N 2.9Å; F63-T66 PolarHBondContact O-N 2.69Å; F63-A67 WeakPolarHBondContact O-CB 3.26Å; F63-A67 PolarHBondContact O-N 3.23Å
64	V	91.4	Very high	87.3	Confident	92 Å²	92	98.4 Å²	98.4	56%	0.558	52%	0.521	S	S	*	.	H	α-helix	trans	-62.3	-44.6	177.6	174	0	0	0	0	111.1	T60 A61 T66 A67 Y68	T60-V64 WeakPolarHBondContact O-CG2 3.31Å; T60-V64 PolarHBondContact O-N 3.41Å; A61-V64 PolarHBondContact O-N 3.27Å; V64-T66 PolarHBondContact O-N 2.76Å; V64-A67 PolarHBondContact O-N 3.42Å; V64-Y68 VanDerWaalsContact O-CB 3.32Å; V64-Y68 WeakPolarHBondContact O-CB 3.45Å; V64-Y68 PolarHBondContact O-N 3.02Å
65	L	92.3	Very high	88.5	Confident	114 Å²	114	100.5 Å²	100.5	60%	0.597	53%	0.532	S	S	*	.	H	α-helix	trans	-64.7	-40.3	179.2	-174.4	62.5	0	0	0	112	A61 Y62 F63 Y68 A69	A61-L65 WeakPolarHBondContact O-CB 3.47Å; A61-L65 PolarHBondContact O-N 3.05Å; Y62-L65 PolarHBondContact O-N 3.23Å; F63-L65 PolarHBondContact O-N 2.9Å; L65-Y68 PolarHBondContact O-N 3.42Å; L65-A69 VanDerWaalsContact O-CB 3.31Å; L65-A69 WeakPolarHBondContact O-CB 3.22Å; L65-A69 PolarHBondContact O-N 3Å
66	T	93.6	Very high	89.8	Confident	54 Å²	54	96.9 Å²	96.9	33%	0.331	52%	0.522	S	S	.	.	H	α-helix	trans	-68.6	-42.2	177.6	-57.2	0	0	0	0	111.4	Y62 F63 V64 A69 T70	Y62-T66 VanDerWaalsContact O-CB 3.24Å; Y62-T66 WeakPolarHBondContact O-CB 3.31Å; Y62-T66 PolarHBondContact O-N 3.01Å; Y62-T66 PolarHBondContact O-OG1 3.03Å; F63-T66 PolarHBondContact O-N 2.69Å; V64-T66 PolarHBondContact O-N 2.76Å; T66-A69 PolarHBondContact O-N 3.44Å; T66-T70 HydrophobicContact CG2-CG2 4.49Å; T66-T70 WeakPolarHBondContact O-CB 3.34Å; T66-T70 VanDerWaalsContact O-CG2 3.31Å; T66-T70 WeakPolarHBondContact O-CG2 3.29Å; T66-T70 PolarHBondContact O-N 2.87Å; T66-T70 PolarHBondContact O-OG1 3.5Å
67	A	93.7	Very high	90.8	Very high	41 Å²	41	101.1 Å²	101.1	34%	0.339	53%	0.531	S	S	.	.	H	α-helix	trans	-63.2	-42	174.9	0	0	0	0	0	111.6	F63 V64 T70 T71	F63-A67 WeakPolarHBondContact O-CB 3.26Å; F63-A67 PolarHBondContact O-N 3.23Å; V64-A67 PolarHBondContact O-N 3.42Å; A67-T70 WeakPolarHBondContact CA-OG1 3.28Å; A67-T70 PolarHBondContact O-OG1 3.06Å; A67-T71 WeakPolarHBondContact O-CB 3.48Å; A67-T71 VanDerWaalsContact O-CG2 3.28Å; A67-T71 WeakPolarHBondContact O-CG2 3.49Å; A67-T71 PolarHBondContact O-N 2.93Å; A67-T71 PolarHBondContact O-OG1 2.96Å
68	Y	94.8	Very high	91.8	Very high	154 Å²	154	98.5 Å²	98.5	60%	0.604	53%	0.526	S	S	*	.	H	α-helix	trans	-64	-45.8	174.5	178.7	-102.5	0	0	0	112.1	V64 L65 T70 T71 V72	V64-Y68 VanDerWaalsContact O-CB 3.32Å; V64-Y68 WeakPolarHBondContact O-CB 3.45Å; V64-Y68 PolarHBondContact O-N 3.02Å; L65-Y68 PolarHBondContact O-N 3.42Å; Y68-T70 PolarHBondContact O-N 2.75Å; Y68-T71 WeakPolarHBondContact CA-OG1 3.49Å; Y68-T71 PolarHBondContact O-N 2.9Å; Y68-T71 PolarHBondContact O-OG1 3.38Å; Y68-V72 HydrophobicContact CD1-CG2 4.37Å; Y68-V72 HydrophobicContact CD2-CG2 4.25Å; Y68-V72 HydrophobicContact CE1-CG2 3.96Å; Y68-V72 HydrophobicContact CE2-CG2 3.83Å; Y68-V72 VanDerWaalsContact O-CG2 3.3Å; Y68-V72 WeakPolarHBondContact O-CG2 3.46Å; Y68-V72 PolarHBondContact O-N 2.87Å
69	A	94.8	Very high	92.3	Very high	41 Å²	41	96.7 Å²	96.7	34%	0.339	52%	0.522	S	S	.	.	H	α-helix	trans	-62.4	-44	179.3	0	0	0	0	0	112.1	L65 T66 V72 L73	L65-A69 VanDerWaalsContact O-CB 3.31Å; L65-A69 WeakPolarHBondContact O-CB 3.22Å; L65-A69 PolarHBondContact O-N 3Å; T66-A69 PolarHBondContact O-N 3.44Å; A69-V72 PolarHBondContact O-N 2.71Å; A69-L73 VanDerWaalsContact O-CB 3.3Å; A69-L73 WeakPolarHBondContact O-CB 3.31Å; A69-L73 WeakPolarHBondContact O-CG 3.15Å; A69-L73 PolarHBondContact O-N 3.27Å
70	T	95	Very high	92.8	Very high	76 Å²	76	95.1 Å²	95.1	47%	0.466	52%	0.521	S	S	.	.	H	α-helix	trans	-67.5	-38	179.7	51.6	0	0	0	0	112.6	T66 A67 Y68 S74	T66-T70 HydrophobicContact CG2-CG2 4.49Å; T66-T70 WeakPolarHBondContact O-CB 3.34Å; T66-T70 VanDerWaalsContact O-CG2 3.31Å; T66-T70 WeakPolarHBondContact O-CG2 3.29Å; T66-T70 PolarHBondContact O-N 2.87Å; T66-T70 PolarHBondContact O-OG1 3.5Å; A67-T70 WeakPolarHBondContact CA-OG1 3.28Å; A67-T70 PolarHBondContact O-OG1 3.06Å; Y68-T70 PolarHBondContact O-N 2.75Å; T70-S74 WeakPolarHBondContact O-CB 3.1Å; T70-S74 PolarHBondContact O-N 3.44Å; T70-S74 PolarHBondContact O-OG 3.36Å
71	T	94.5	Very high	93.2	Very high	74 Å²	74	95.9 Å²	95.9	45%	0.454	52%	0.521	S	S	.	.	H	α-helix	trans	-65.9	-44.9	174.4	50.3	0	0	0	0	111.7	A67 Y68 L73 S74 V75	A67-T71 WeakPolarHBondContact O-CB 3.48Å; A67-T71 VanDerWaalsContact O-CG2 3.28Å; A67-T71 WeakPolarHBondContact O-CG2 3.49Å; A67-T71 PolarHBondContact O-N 2.93Å; A67-T71 PolarHBondContact O-OG1 2.96Å; Y68-T71 WeakPolarHBondContact CA-OG1 3.49Å; Y68-T71 PolarHBondContact O-N 2.9Å; Y68-T71 PolarHBondContact O-OG1 3.38Å; T71-L73 PolarHBondContact O-N 3.01Å; T71-S74 WeakPolarHBondContact CA-OG 3.35Å; T71-S74 PolarHBondContact O-N 2.89Å; T71-S74 PolarHBondContact O-OG 3.01Å; T71-V75 WeakPolarHBondContact O-CB 3.45Å; T71-V75 VanDerWaalsContact O-CG2 3.26Å; T71-V75 WeakPolarHBondContact O-CG2 3.48Å; T71-V75 PolarHBondContact O-N 2.9Å
72	V	95.4	Very high	93.5	Very high	61 Å²	61	95 Å²	95	37%	0.37	51%	0.514	S	S	.	.	H	α-helix	trans	-63.2	-44.7	175.9	173.4	0	0	0	0	111.5	Y68 A69 S74 T76	Y68-V72 HydrophobicContact CD1-CG2 4.37Å; Y68-V72 HydrophobicContact CD2-CG2 4.25Å; Y68-V72 HydrophobicContact CE1-CG2 3.96Å; Y68-V72 HydrophobicContact CE2-CG2 3.83Å; Y68-V72 VanDerWaalsContact O-CG2 3.3Å; Y68-V72 WeakPolarHBondContact O-CG2 3.46Å; Y68-V72 PolarHBondContact O-N 2.87Å; A69-V72 PolarHBondContact O-N 2.71Å; V72-S74 PolarHBondContact O-N 2.9Å; V72-T76 HydrophobicContact CG1-CG2 4.36Å; V72-T76 WeakPolarHBondContact O-CB 3.34Å; V72-T76 VanDerWaalsContact O-CG2 3.26Å; V72-T76 WeakPolarHBondContact O-CG2 3.34Å; V72-T76 PolarHBondContact O-N 2.96Å; V72-T76 PolarHBondContact O-OG1 3.47Å
73	L	93.8	Very high	93.7	Very high	109 Å²	109	95.3 Å²	95.3	57%	0.571	51%	0.514	S	S	*	.	H	α-helix	trans	-64.5	-40.1	179.4	-73.5	171.7	0	0	0	112.4	A69 T71 T76 W77	A69-L73 VanDerWaalsContact O-CB 3.3Å; A69-L73 WeakPolarHBondContact O-CB 3.31Å; A69-L73 WeakPolarHBondContact O-CG 3.15Å; A69-L73 PolarHBondContact O-N 3.27Å; T71-L73 PolarHBondContact O-N 3.01Å; L73-T76 WeakPolarHBondContact CA-OG1 3.34Å; L73-T76 PolarHBondContact O-OG1 3.36Å; L73-W77 WeakPolarHBondContact O-CB 3.24Å; L73-W77 PolarHBondContact O-N 3.5Å
74	S	94.3	Very high	93.7	Very high	63 Å²	63	90.1 Å²	90.1	44%	0.441	50%	0.499	S	S	.	.	H	α-helix	trans	-68.9	-45.2	177.4	56.2	0	0	0	0	112.2	T70 T71 V72 T76 W77 V78	T70-S74 WeakPolarHBondContact O-CB 3.1Å; T70-S74 PolarHBondContact O-N 3.44Å; T70-S74 PolarHBondContact O-OG 3.36Å; T71-S74 WeakPolarHBondContact CA-OG 3.35Å; T71-S74 PolarHBondContact O-N 2.89Å; T71-S74 PolarHBondContact O-OG 3.01Å; V72-S74 PolarHBondContact O-N 2.9Å; S74-T76 VanDerWaalsContact C-N 3.34Å; S74-T76 PolarHBondContact O-N 3.46Å; S74-W77 PolarHBondContact O-N 2.86Å; S74-V78 WeakPolarHBondContact O-CG2 3.37Å; S74-V78 PolarHBondContact O-N 3.29Å
75	V	94	Very high	93.6	Very high	95 Å²	95	88.7 Å²	88.7	58%	0.576	49%	0.493	S	S	*	.	H	α-helix	trans	-62	-42.5	177.2	171.8	0	0	0	0	111.2	T71 V78 L79	T71-V75 WeakPolarHBondContact O-CB 3.45Å; T71-V75 VanDerWaalsContact O-CG2 3.26Å; T71-V75 WeakPolarHBondContact O-CG2 3.48Å; T71-V75 PolarHBondContact O-N 2.9Å; V75-V78 PolarHBondContact O-N 3.02Å; V75-L79 WeakPolarHBondContact O-CB 3.39Å; V75-L79 PolarHBondContact O-N 2.96Å
76	T	94.8	Very high	93.3	Very high	75 Å²	75	87.1 Å²	87.1	46%	0.46	49%	0.49	S	S	.	.	H	α-helix	trans	-65.9	-39.9	177.4	49.9	0	0	0	0	112.2	V72 L73 S74 L79 S80	V72-T76 HydrophobicContact CG1-CG2 4.36Å; V72-T76 WeakPolarHBondContact O-CB 3.34Å; V72-T76 VanDerWaalsContact O-CG2 3.26Å; V72-T76 WeakPolarHBondContact O-CG2 3.34Å; V72-T76 PolarHBondContact O-N 2.96Å; V72-T76 PolarHBondContact O-OG1 3.47Å; L73-T76 WeakPolarHBondContact CA-OG1 3.34Å; L73-T76 PolarHBondContact O-OG1 3.36Å; S74-T76 VanDerWaalsContact C-N 3.34Å; S74-T76 PolarHBondContact O-N 3.46Å; T76-L79 PolarHBondContact O-N 3.49Å; T76-S80 VanDerWaalsContact O-CB 3.24Å; T76-S80 WeakPolarHBondContact O-CB 3.45Å; T76-S80 PolarHBondContact O-N 2.96Å
77	W	96.3	Very high	93.1	Very high	195 Å²	195	88.6 Å²	88.6	74%	0.739	50%	0.499	S	S	*	.	H	α-helix	trans	-60.8	-48.6	173.5	-108.6	77.3	0	0	0	112.5	L73 S74 L79 S80 L81	L73-W77 WeakPolarHBondContact O-CB 3.24Å; L73-W77 PolarHBondContact O-N 3.5Å; S74-W77 PolarHBondContact O-N 2.86Å; W77-L79 VanDerWaalsContact C-N 3.35Å; W77-L79 PolarHBondContact O-N 2.89Å; W77-S80 PolarHBondContact O-N 3.43Å; W77-L81 WeakPolarHBondContact O-CB 3.46Å; W77-L81 PolarHBondContact O-N 2.96Å
78	V	94.9	Very high	92.8	Very high	102 Å²	102	92 Å²	92	62%	0.618	51%	0.511	S	S	*	.	H	α-helix	trans	-62.1	-43.7	179.1	171.5	0	0	0	0	110.9	S74 V75 S80 L81 A82	S74-V78 WeakPolarHBondContact O-CG2 3.37Å; S74-V78 PolarHBondContact O-N 3.29Å; V75-V78 PolarHBondContact O-N 3.02Å; V78-S80 VanDerWaalsContact C-N 3.35Å; V78-S80 PolarHBondContact O-N 2.91Å; V78-L81 PolarHBondContact O-N 2.78Å; V78-A82 WeakPolarHBondContact O-CB 3.24Å; V78-A82 PolarHBondContact O-N 3.45Å
79	L	91.6	Very high	92.4	Very high	95 Å²	95	89.1 Å²	89.1	50%	0.497	51%	0.506	S	S	.	.	H	α-helix	trans	-68.3	-35.8	179.9	-161.5	69.5	0	0	0	112.2	V75 T76 W77 R83	V75-L79 WeakPolarHBondContact O-CB 3.39Å; V75-L79 PolarHBondContact O-N 2.96Å; T76-L79 PolarHBondContact O-N 3.49Å; W77-L79 VanDerWaalsContact C-N 3.35Å; W77-L79 PolarHBondContact O-N 2.89Å; L79-R83 WeakPolarHBondContact O-CB 3.18Å; L79-R83 WeakPolarHBondContact O-CG 3.3Å; L79-R83 PolarHBondContact O-N 3.09Å
80	S	92.4	Very high	92	Very high	77 Å²	77	95.3 Å²	95.3	54%	0.538	53%	0.525	S	S	.	.	H	α-helix	trans	-65.1	-46.1	173.5	-171.5	0	0	0	0	111.3	T76 W77 V78 A82 R83 A84	T76-S80 VanDerWaalsContact O-CB 3.24Å; T76-S80 WeakPolarHBondContact O-CB 3.45Å; T76-S80 PolarHBondContact O-N 2.96Å; W77-S80 PolarHBondContact O-N 3.43Å; V78-S80 VanDerWaalsContact C-N 3.35Å; V78-S80 PolarHBondContact O-N 2.91Å; S80-A82 PolarHBondContact O-N 3.31Å; S80-R83 PolarHBondContact O-N 3.45Å; S80-A84 WeakPolarHBondContact O-CB 3.5Å; S80-A84 PolarHBondContact O-N 3.28Å
81	L	93.9	Very high	91.2	Very high	115 Å²	115	99.8 Å²	99.8	60%	0.602	54%	0.543	S	S	*	.	H	α-helix	trans	-63	-42.2	176.6	-175.7	62.6	0	0	0	111.8	W77 V78 A84 C85	W77-L81 WeakPolarHBondContact O-CB 3.46Å; W77-L81 PolarHBondContact O-N 2.96Å; V78-L81 PolarHBondContact O-N 2.78Å; L81-A84 PolarHBondContact O-N 2.91Å; L81-C85 VanDerWaalsContact O-CB 3.27Å; L81-C85 WeakPolarHBondContact O-CB 3.39Å; L81-C85 PolarHBondContact O-N 3.24Å
82	A	91.8	Very high	90.7	Very high	48 Å²	48	102.1 Å²	102.1	40%	0.397	56%	0.557	S	S	.	*	H	α-helix	trans	-61.2	-44.6	175.7	0	0	0	0	0	111.5	V78 S80 C85 C86	V78-A82 WeakPolarHBondContact O-CB 3.24Å; V78-A82 PolarHBondContact O-N 3.45Å; S80-A82 PolarHBondContact O-N 3.31Å; A82-C85 PolarHBondContact O-N 3.28Å; A82-C86 PolarHBondContact O-N 3.29Å; A82-C86 PolarHBondContact O-SG 2.89Å
83	R	92.8	Very high	89.4	Confident	169 Å²	169	111 Å²	111	64%	0.638	59%	0.585	S	S	*	*	H	α-helix	trans	-60.8	-47.6	174.8	-83	-179.4	153.2	111.3	-2.9	112.1	L79 S80 C85 C86 T87	L79-R83 WeakPolarHBondContact O-CB 3.18Å; L79-R83 WeakPolarHBondContact O-CG 3.3Å; L79-R83 PolarHBondContact O-N 3.09Å; S80-R83 PolarHBondContact O-N 3.45Å; R83-C85 VanDerWaalsContact C-N 3.32Å; R83-C85 PolarHBondContact O-N 3.16Å; R83-C86 PolarHBondContact O-N 2.9Å; R83-T87 WeakPolarHBondContact O-CG2 3.34Å; R83-T87 PolarHBondContact O-N 3.32Å; R83-T87 PolarHBondContact O-OG1 3.35Å
84	A	92.4	Very high	89.2	Confident	42 Å²	42	111.2 Å²	111.2	35%	0.347	59%	0.586	S	S	.	*	H	α-helix	trans	-59.4	-44.4	177.4	0	0	0	0	0	111.3	S80 L81 T87 L88	S80-A84 WeakPolarHBondContact O-CB 3.5Å; S80-A84 PolarHBondContact O-N 3.28Å; L81-A84 PolarHBondContact O-N 2.91Å; A84-T87 WeakPolarHBondContact CA-OG1 3.3Å; A84-T87 PolarHBondContact O-N 2.94Å; A84-T87 PolarHBondContact O-OG1 3.19Å; A84-L88 VanDerWaalsContact O-CG 3.3Å; A84-L88 WeakPolarHBondContact O-CG 3.27Å; A84-L88 PolarHBondContact O-N 3.4Å
85	C	88.6	Confident	89	Confident	63 Å²	63	113.7 Å²	113.7	43%	0.426	59%	0.594	S	S	.	*	H	α-helix	trans	-60.1	-49.6	176.1	-168.2	0	0	0	0	111.3	L81 A82 R83 T87 L88 L89	L81-C85 VanDerWaalsContact O-CB 3.27Å; L81-C85 WeakPolarHBondContact O-CB 3.39Å; L81-C85 PolarHBondContact O-N 3.24Å; A82-C85 PolarHBondContact O-N 3.28Å; R83-C85 VanDerWaalsContact C-N 3.32Å; R83-C85 PolarHBondContact O-N 3.16Å; C85-T87 VanDerWaalsContact C-N 3.3Å; C85-T87 PolarHBondContact O-N 3.35Å; C85-L88 PolarHBondContact O-N 3.31Å; C85-L88 VanDerWaalsContact O-N 3.13Å; C85-L89 VanDerWaalsContact O-CD1 3.3Å; C85-L89 WeakPolarHBondContact O-CD1 3.34Å; C85-L89 PolarHBondContact O-N 3.05Å; C85-L89 VanDerWaalsContact SG-CD1 3.52Å
86	C	86.7	Confident	88.7	Confident	81 Å²	81	114.7 Å²	114.7	55%	0.547	60%	0.595	S	S	.	*	H	α-helix	trans	-59.3	-38.2	177	-70	0	0	0	0	113.1	A82 R83 K90	A82-C86 PolarHBondContact O-N 3.29Å; A82-C86 PolarHBondContact O-SG 2.89Å; R83-C86 PolarHBondContact O-N 2.9Å; C86-K90 WeakPolarHBondContact O-CB 3.3Å; C86-K90 PolarHBondContact O-N 3.48Å; C86-K90 VanDerWaalsContact O-N 3.09Å
87	T	88.8	Confident	88.3	Confident	85 Å²	85	117.1 Å²	117.1	52%	0.521	60%	0.603	S	S	.	*	H	α-helix	trans	-68.4	-37.5	176.2	48.2	0	0	0	0	112.5	R83 A84 C85 K90 M91	R83-T87 WeakPolarHBondContact O-CG2 3.34Å; R83-T87 PolarHBondContact O-N 3.32Å; R83-T87 PolarHBondContact O-OG1 3.35Å; A84-T87 WeakPolarHBondContact CA-OG1 3.3Å; A84-T87 PolarHBondContact O-N 2.94Å; A84-T87 PolarHBondContact O-OG1 3.19Å; C85-T87 VanDerWaalsContact C-N 3.3Å; C85-T87 PolarHBondContact O-N 3.35Å; T87-K90 PolarHBondContact O-N 2.98Å; T87-M91 PolarHBondContact O-N 2.71Å
88	L	87.1	Confident	87.8	Confident	111 Å²	111	112.2 Å²	112.2	58%	0.581	59%	0.594	S	S	*	*	H	α-helix	trans	-69	-44.3	176.9	-70.6	170.8	0	0	0	111.3	A84 C85 K90 M91 V92	A84-L88 VanDerWaalsContact O-CG 3.3Å; A84-L88 WeakPolarHBondContact O-CG 3.27Å; A84-L88 PolarHBondContact O-N 3.4Å; C85-L88 PolarHBondContact O-N 3.31Å; C85-L88 VanDerWaalsContact O-N 3.13Å; L88-K90 VanDerWaalsContact C-N 3.27Å; L88-K90 PolarHBondContact O-N 2.85Å; L88-M91 PolarHBondContact O-N 3.35Å; L88-V92 WeakPolarHBondContact O-CG2 3.45Å; L88-V92 PolarHBondContact O-N 2.9Å
89	L	86.2	Confident	87.4	Confident	95 Å²	95	112.9 Å²	112.9	50%	0.497	59%	0.593	S	S	.	*	H	α-helix	trans	-57.6	-40.8	173.5	-89	120.8	0	0	0	111.8	C85 M91 V92 Y93	C85-L89 VanDerWaalsContact O-CD1 3.3Å; C85-L89 WeakPolarHBondContact O-CD1 3.34Å; C85-L89 PolarHBondContact O-N 3.05Å; C85-L89 VanDerWaalsContact SG-CD1 3.52Å; L89-M91 VanDerWaalsContact C-N 3.26Å; L89-M91 PolarHBondContact O-N 3.05Å; L89-V92 PolarHBondContact O-N 3.13Å; L89-Y93 WeakPolarHBondContact O-CB 3.34Å; L89-Y93 PolarHBondContact O-N 3.22Å
90	K	85.8	Confident	87.1	Confident	171 Å²	171	114.1 Å²	114.1	74%	0.743	60%	0.6	S	S	*	*	H	α-helix	trans	-66.7	-19.2	175.4	-99.9	-178.9	160.6	64.4	0	115.3	C86 T87 L88	C86-K90 WeakPolarHBondContact O-CB 3.3Å; C86-K90 PolarHBondContact O-N 3.48Å; C86-K90 VanDerWaalsContact O-N 3.09Å; T87-K90 PolarHBondContact O-N 2.98Å; L88-K90 VanDerWaalsContact C-N 3.27Å; L88-K90 PolarHBondContact O-N 2.85Å
91	M	79.2	Confident	86.6	Confident	170 Å²	170	117 Å²	117	84%	0.837	60%	0.604	S	S	*	*	H	α-helix	trans	-93.7	-23.4	175.7	-75.7	-158.8	175.6	0	0	112.4	T87 L88 L89	T87-M91 PolarHBondContact O-N 2.71Å; L88-M91 PolarHBondContact O-N 3.35Å; L89-M91 VanDerWaalsContact C-N 3.26Å; L89-M91 PolarHBondContact O-N 3.05Å
92	V	84.9	Confident	86	Confident	123 Å²	123	117.2 Å²	117.2	75%	0.745	60%	0.604	S	S	*	*	H	α-helix	trans	-91.2	-33.7	-178.7	174.6	0	0	0	0	112.1	L88 L89	L88-V92 WeakPolarHBondContact O-CG2 3.45Å; L88-V92 PolarHBondContact O-N 2.9Å; L89-V92 PolarHBondContact O-N 3.13Å
93	Y	68.1	Low	85.5	Confident	248 Å²	248	123.5 Å²	123.5	97%	0.973	62%	0.623	S	S	*	*			trans	-97.4	0	172.1	-92.6	-88.8	0	0	0	111.2	L89	L89-Y93 WeakPolarHBondContact O-CB 3.34Å; L89-Y93 PolarHBondContact O-N 3.22Å

Retrieved 93 of 93 residues in 32.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).