A0A087WPT6_MOUSE Loading...

Activating transcription factor 7 interacting protein

AlphaFold DB , UniProt , Accession A0A087WPT6, Species MOUSE (Mus musculus, Mouse), Gene Atf7ip, Length 46 aa.

						>A0A087WPT6_MOUSE|A0A087WPT6|Atf7ip
MDSVEEPQKKVFKARKTMRASDRQQLDAVHRVKGELLRADGKLLNG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.1	Very low	57.6	Low	233 Å²	233	123.8 Å²	123.8	100%	1.148	64%	0.641	S	S	*	*				0	74.3	0	-92.8	-159.9	157.6	0	0	106.7
2	D	49.8	Very low	58.2	Low	142 Å²	142	126 Å²	126	76%	0.759	64%	0.643	S	S	*	*			trans	-131.8	30.2	-160.3	-60.5	-84.4	0	0	0	111.7
3	S	52.4	Low	58.8	Low	98 Å²	98	128.5 Å²	128.5	69%	0.685	65%	0.646	S	S	*	*	S	Bend	trans	-131.5	1.4	-164	-49.9	0	0	0	0	115.4	P7	S3-P7 WeakPolarHBondContact O-CG 3.49Å
4	V	53.8	Low	59.5	Low	104 Å²	104	122.9 Å²	122.9	63%	0.63	63%	0.629	S	S	*	*	S	Bend	trans	-119.8	-34.8	177.7	-171.1	0	0	0	0	112.4	P7 Q8	V4-P7 WeakPolarHBondContact O-CD 3.32Å; V4-Q8 PolarHBondContact O-N 3.33Å
5	E	55.1	Low	59.9	Low	126 Å²	126	126.8 Å²	126.8	59%	0.589	63%	0.633	S	S	*	*	H	α-helix	trans	-73.8	-36.1	-178.8	-159.7	178.7	96.9	0	0	112.6	K9	E5-K9 HydrophobicContact CG-CD 3.99Å; E5-K9 HydrophobicContact CG-CG 4.44Å; E5-K9 VanDerWaalsContact O-CB 3.28Å; E5-K9 WeakPolarHBondContact O-CB 3.36Å; E5-K9 VanDerWaalsContact O-CG 3.27Å; E5-K9 WeakPolarHBondContact O-CG 3.39Å; E5-K9 PolarHBondContact O-N 3.01Å; E5-K9 WeakPolarHBondContact OE1-CE 3.46Å; E5-K9 IonicContact OE1-NZ 2.6Å; E5-K9 PolarHBondContact OE1-NZ 2.83Å
6	E	55.4	Low	60.5	Low	116 Å²	116	129.9 Å²	129.9	54%	0.542	64%	0.642	S	S	.	*	H	α-helix	trans	-71	-43.3	179.9	-174.5	162.2	108.7	0	0	113.8	K10	E6-K10 HydrophobicContact CG-CD 4.07Å; E6-K10 WeakPolarHBondContact O-CB 3.27Å; E6-K10 WeakPolarHBondContact O-CG 3.21Å; E6-K10 PolarHBondContact O-N 3.33Å; E6-K10 IonicContact OE1-NZ 2.83Å; E6-K10 PolarHBondContact OE1-NZ 3.43Å
7	P	63.5	Low	61.1	Low	66 Å²	66	128.5 Å²	128.5	43%	0.429	64%	0.642	S	S	.	*	H	α-helix	trans	-59.7	-45.5	170.3	-22.6	31.6	0	0	0	112.2	S3 V4 K10 V11	S3-P7 WeakPolarHBondContact O-CG 3.49Å; V4-P7 WeakPolarHBondContact O-CD 3.32Å; P7-K10 PolarHBondContact O-N 2.6Å; P7-V11 WeakPolarHBondContact O-CB 3.38Å; P7-V11 VanDerWaalsContact O-CG2 3.26Å; P7-V11 WeakPolarHBondContact O-CG2 3.26Å; P7-V11 PolarHBondContact O-N 2.89Å
8	Q	66.8	Low	61.8	Low	134 Å²	134	125.2 Å²	125.2	63%	0.626	63%	0.625	S	S	*	*	H	α-helix	trans	-65.2	-45.2	-179.3	-81	-167.6	-28.8	0	0	112.2	V4 K10 V11 F12	V4-Q8 PolarHBondContact O-N 3.33Å; Q8-K10 VanDerWaalsContact C-N 3.31Å; Q8-K10 PolarHBondContact O-N 2.9Å; Q8-V11 PolarHBondContact O-N 2.89Å; Q8-F12 WeakPolarHBondContact O-CB 3.34Å; Q8-F12 PolarHBondContact O-N 3.44Å
9	K	62.8	Low	62.9	Low	125 Å²	125	128.5 Å²	128.5	54%	0.543	63%	0.629	S	S	.	*	H	α-helix	trans	-62.9	-36.9	176.5	-76.7	175.7	175.9	174.1	0	112	E5 F12 K13	E5-K9 HydrophobicContact CG-CD 3.99Å; E5-K9 HydrophobicContact CG-CG 4.44Å; E5-K9 VanDerWaalsContact O-CB 3.28Å; E5-K9 WeakPolarHBondContact O-CB 3.36Å; E5-K9 VanDerWaalsContact O-CG 3.27Å; E5-K9 WeakPolarHBondContact O-CG 3.39Å; E5-K9 PolarHBondContact O-N 3.01Å; E5-K9 WeakPolarHBondContact OE1-CE 3.46Å; E5-K9 IonicContact OE1-NZ 2.6Å; E5-K9 PolarHBondContact OE1-NZ 2.83Å; K9-F12 PolarHBondContact O-N 2.8Å; K9-K13 WeakPolarHBondContact O-CB 3.28Å; K9-K13 PolarHBondContact O-N 3.43Å
10	K	61.5	Low	63.8	Low	128 Å²	128	125.8 Å²	125.8	56%	0.557	63%	0.629	S	S	*	*	H	α-helix	trans	-66.4	-43.6	173.6	-77.9	170.8	179.2	164.7	0	111.8	E6 P7 Q8 F12 K13 A14	E6-K10 HydrophobicContact CG-CD 4.07Å; E6-K10 WeakPolarHBondContact O-CB 3.27Å; E6-K10 WeakPolarHBondContact O-CG 3.21Å; E6-K10 PolarHBondContact O-N 3.33Å; E6-K10 IonicContact OE1-NZ 2.83Å; E6-K10 PolarHBondContact OE1-NZ 3.43Å; P7-K10 PolarHBondContact O-N 2.6Å; Q8-K10 VanDerWaalsContact C-N 3.31Å; Q8-K10 PolarHBondContact O-N 2.9Å; K10-F12 VanDerWaalsContact C-N 3.32Å; K10-F12 PolarHBondContact O-N 2.87Å; K10-K13 PolarHBondContact O-N 2.82Å; K10-A14 WeakPolarHBondContact O-CB 3.33Å; K10-A14 PolarHBondContact O-N 3.39Å
11	V	64.6	Low	64.7	Low	90 Å²	90	122.4 Å²	122.4	55%	0.545	62%	0.617	S	S	.	*	H	α-helix	trans	-62.3	-40.8	173.9	169.8	0	0	0	0	111.2	P7 Q8 R15	P7-V11 WeakPolarHBondContact O-CB 3.38Å; P7-V11 VanDerWaalsContact O-CG2 3.26Å; P7-V11 WeakPolarHBondContact O-CG2 3.26Å; P7-V11 PolarHBondContact O-N 2.89Å; Q8-V11 PolarHBondContact O-N 2.89Å; V11-R15 WeakPolarHBondContact O-CB 3.27Å; V11-R15 PolarHBondContact O-N 3.47Å
12	F	64.3	Low	66.5	Low	150 Å²	150	114.2 Å²	114.2	66%	0.658	58%	0.578	S	S	*	*	H	α-helix	trans	-69.8	-43.8	179.4	-146.6	-87.2	0	0	0	111.6	Q8 K9 K10 R15 K16	Q8-F12 WeakPolarHBondContact O-CB 3.34Å; Q8-F12 PolarHBondContact O-N 3.44Å; K9-F12 PolarHBondContact O-N 2.8Å; K10-F12 VanDerWaalsContact C-N 3.32Å; K10-F12 PolarHBondContact O-N 2.87Å; F12-R15 PolarHBondContact O-N 3.26Å; F12-K16 VanDerWaalsContact O-CB 3.27Å; F12-K16 WeakPolarHBondContact O-CB 3.37Å; F12-K16 PolarHBondContact O-N 3.45Å
13	K	66.3	Low	68.1	Low	159 Å²	159	115.1 Å²	115.1	69%	0.691	57%	0.571	S	S	*	*	H	α-helix	trans	-60.3	-50.9	172.2	-100.6	-172.6	169.2	-177.7	0	110.8	K9 K10 R15 K16 T17	K9-K13 WeakPolarHBondContact O-CB 3.28Å; K9-K13 PolarHBondContact O-N 3.43Å; K10-K13 PolarHBondContact O-N 2.82Å; K13-R15 VanDerWaalsContact C-N 3.34Å; K13-R15 PolarHBondContact O-N 2.83Å; K13-K16 CarbonylContact O-C 3.51Å; K13-K16 WeakPolarHBondContact O-CA 3.37Å; K13-K16 PolarHBondContact O-N 2.81Å; K13-T17 WeakPolarHBondContact O-CB 3.23Å; K13-T17 WeakPolarHBondContact O-CG2 3.5Å; K13-T17 PolarHBondContact O-N 2.98Å; K13-T17 PolarHBondContact O-OG1 3.42Å
14	A	68.4	Low	69.7	Low	49 Å²	49	116.8 Å²	116.8	41%	0.405	57%	0.568	S	S	.	*	H	α-helix	trans	-53.2	-52.5	176.4	0	0	0	0	0	110.4	K10 K16 T17 M18	K10-A14 WeakPolarHBondContact O-CB 3.33Å; K10-A14 PolarHBondContact O-N 3.39Å; A14-K16 VanDerWaalsContact C-N 3.27Å; A14-K16 PolarHBondContact O-N 2.92Å; A14-T17 PolarHBondContact O-N 2.93Å; A14-T17 PolarHBondContact O-OG1 3.18Å; A14-M18 VanDerWaalsContact O-CG 3.23Å; A14-M18 WeakPolarHBondContact O-CG 3.47Å; A14-M18 PolarHBondContact O-N 3.23Å
15	R	65.6	Low	71.3	Confident	182 Å²	182	118 Å²	118	69%	0.687	57%	0.567	S	S	*	*	H	α-helix	trans	-56.7	-35.6	174.7	-91.2	-173.3	174.2	-158.8	-1.2	114.2	V11 F12 K13	V11-R15 WeakPolarHBondContact O-CB 3.27Å; V11-R15 PolarHBondContact O-N 3.47Å; F12-R15 PolarHBondContact O-N 3.26Å; K13-R15 VanDerWaalsContact C-N 3.34Å; K13-R15 PolarHBondContact O-N 2.83Å
16	K	69.4	Low	72.7	Confident	177 Å²	177	116.9 Å²	116.9	77%	0.77	56%	0.564	S	S	*	*	H	α-helix	trans	-83.3	-21.2	-177.8	-152.8	-174.1	-174.4	-172.4	0	112.9	F12 K13 A14	F12-K16 VanDerWaalsContact O-CB 3.27Å; F12-K16 WeakPolarHBondContact O-CB 3.37Å; F12-K16 PolarHBondContact O-N 3.45Å; K13-K16 CarbonylContact O-C 3.51Å; K13-K16 WeakPolarHBondContact O-CA 3.37Å; K13-K16 PolarHBondContact O-N 2.81Å; A14-K16 VanDerWaalsContact C-N 3.27Å; A14-K16 PolarHBondContact O-N 2.92Å
17	T	71.4	Confident	74.2	Confident	106 Å²	106	116.3 Å²	116.3	65%	0.65	57%	0.565	S	S	*	*	H	α-helix	trans	-103.2	-5.5	178.8	60.4	0	0	0	0	113.7	K13 A14 R19	K13-T17 WeakPolarHBondContact O-CB 3.23Å; K13-T17 WeakPolarHBondContact O-CG2 3.5Å; K13-T17 PolarHBondContact O-N 2.98Å; K13-T17 PolarHBondContact O-OG1 3.42Å; A14-T17 PolarHBondContact O-N 2.93Å; A14-T17 PolarHBondContact O-OG1 3.18Å; T17-R19 PolarHBondContact O-N 3.29Å
18	M	72.9	Confident	75.3	Confident	69 Å²	69	115.7 Å²	115.7	34%	0.34	57%	0.565	S	S	.	*	S	Bend	trans	-57.3	133.9	172.8	-82.5	-178.2	82.2	0	0	110	A14 D22 L26	A14-M18 VanDerWaalsContact O-CG 3.23Å; A14-M18 WeakPolarHBondContact O-CG 3.47Å; A14-M18 PolarHBondContact O-N 3.23Å; M18-D22 HydrophobicContact CB-CB 4.44Å; M18-D22 HydrophobicContact CE-CB 3.47Å; M18-D22 VanDerWaalsContact CE-CB 3.47Å; M18-L26 HydrophobicContact CE-CD1 3.49Å; M18-L26 VanDerWaalsContact CE-CD1 3.49Å; M18-L26 HydrophobicContact CE-CG 4.22Å; M18-L26 HydrophobicContact SD-CD1 4.19Å
19	R	82.4	Confident	76.3	Confident	187 Å²	187	113.9 Å²	113.9	71%	0.706	56%	0.563	S	S	*	*			trans	-66	154.7	176	-66.9	179.3	167.9	179.2	-3.1	108.9	T17 S21 D22 R23	T17-R19 PolarHBondContact O-N 3.29Å; R19-S21 PolarHBondContact O-N 3.03Å; R19-D22 WeakPolarHBondContact CB-OD2 3.33Å; R19-D22 PolarHBondContact N-OD2 3.45Å; R19-D22 PolarHBondContact O-N 3.07Å; R19-R23 PolarHBondContact O-N 3.18Å; R19-R23 VanDerWaalsContact O-N 3.07Å
20	A	80.6	Confident	77.5	Confident	74 Å²	74	114.7 Å²	114.7	61%	0.612	57%	0.568	S	S	*	*	H	α-helix	trans	-53.9	-37	175	0	0	0	0	0	111.4	R23 Q24	A20-R23 PolarHBondContact O-N 3.27Å; A20-Q24 WeakPolarHBondContact O-CB 3.49Å; A20-Q24 WeakPolarHBondContact O-CG 3.34Å; A20-Q24 PolarHBondContact O-N 3.36Å; A20-Q24 PolarHBondContact O-OE1 2.9Å
21	S	84.6	Confident	78.7	Confident	56 Å²	56	116.8 Å²	116.8	39%	0.392	57%	0.573	S	S	.	*	H	α-helix	trans	-60.2	-47.7	175	56.5	0	0	0	0	112.9	R19 R23 Q24 Q25	R19-S21 PolarHBondContact O-N 3.03Å; S21-R23 PolarHBondContact O-N 3.05Å; S21-Q24 PolarHBondContact O-N 3.3Å; S21-Q25 WeakPolarHBondContact O-CG 3.34Å; S21-Q25 PolarHBondContact O-N 3.03Å
22	D	84.3	Confident	79.7	Confident	60 Å²	60	116.8 Å²	116.8	32%	0.321	57%	0.573	S	S	.	*	H	α-helix	trans	-63.4	-38.1	-179.9	-52.3	-43.5	0	0	0	110.2	M18 R19 Q25 L26	M18-D22 HydrophobicContact CB-CB 4.44Å; M18-D22 HydrophobicContact CE-CB 3.47Å; M18-D22 VanDerWaalsContact CE-CB 3.47Å; R19-D22 WeakPolarHBondContact CB-OD2 3.33Å; R19-D22 PolarHBondContact N-OD2 3.45Å; R19-D22 PolarHBondContact O-N 3.07Å; D22-Q25 PolarHBondContact O-N 3.3Å; D22-L26 WeakPolarHBondContact O-CG 3.32Å; D22-L26 PolarHBondContact O-N 3.44Å
23	R	83.9	Confident	80.7	Confident	161 Å²	161	116 Å²	116	61%	0.608	57%	0.569	S	S	*	*	H	α-helix	trans	-67.7	-43.6	177.8	-154.8	171.3	-171.9	171.6	0.5	111.8	R19 A20 S21 Q25 L26 D27	R19-R23 PolarHBondContact O-N 3.18Å; R19-R23 VanDerWaalsContact O-N 3.07Å; A20-R23 PolarHBondContact O-N 3.27Å; S21-R23 PolarHBondContact O-N 3.05Å; R23-Q25 VanDerWaalsContact C-N 3.33Å; R23-Q25 PolarHBondContact O-N 2.89Å; R23-L26 PolarHBondContact O-N 3.39Å; R23-D27 PolarHBondContact O-N 2.89Å
24	Q	86.8	Confident	81.5	Confident	134 Å²	134	109.9 Å²	109.9	63%	0.626	55%	0.552	S	S	*	*	H	α-helix	trans	-63.4	-38.1	175.2	-73.6	172.6	-54.4	0	0	112.2	A20 S21 D27 A28	A20-Q24 WeakPolarHBondContact O-CB 3.49Å; A20-Q24 WeakPolarHBondContact O-CG 3.34Å; A20-Q24 PolarHBondContact O-N 3.36Å; A20-Q24 PolarHBondContact O-OE1 2.9Å; S21-Q24 PolarHBondContact O-N 3.3Å; Q24-D27 PolarHBondContact O-N 3.38Å; Q24-A28 WeakPolarHBondContact O-CB 3.44Å; Q24-A28 PolarHBondContact O-N 2.9Å
25	Q	86.9	Confident	82.1	Confident	129 Å²	129	112.2 Å²	112.2	60%	0.603	55%	0.554	S	S	*	*	H	α-helix	trans	-66	-42.5	175.1	-73.6	-178.8	-55.5	0	0	111.8	S21 D22 R23 A28 V29	S21-Q25 WeakPolarHBondContact O-CG 3.34Å; S21-Q25 PolarHBondContact O-N 3.03Å; D22-Q25 PolarHBondContact O-N 3.3Å; R23-Q25 VanDerWaalsContact C-N 3.33Å; R23-Q25 PolarHBondContact O-N 2.89Å; Q25-A28 PolarHBondContact O-N 3.49Å; Q25-V29 WeakPolarHBondContact O-CG2 3.37Å; Q25-V29 PolarHBondContact O-N 2.88Å
26	L	85.1	Confident	82.9	Confident	102 Å²	102	108.8 Å²	108.8	53%	0.534	55%	0.549	S	S	.	.	H	α-helix	trans	-62.9	-44.2	174.3	-76.2	-176.7	0	0	0	112.4	M18 D22 R23 A28 V29 H30	M18-L26 HydrophobicContact CE-CD1 3.49Å; M18-L26 VanDerWaalsContact CE-CD1 3.49Å; M18-L26 HydrophobicContact CE-CG 4.22Å; M18-L26 HydrophobicContact SD-CD1 4.19Å; D22-L26 WeakPolarHBondContact O-CG 3.32Å; D22-L26 PolarHBondContact O-N 3.44Å; R23-L26 PolarHBondContact O-N 3.39Å; L26-A28 VanDerWaalsContact C-N 3.31Å; L26-A28 PolarHBondContact O-N 3.45Å; L26-V29 PolarHBondContact O-N 3.46Å; L26-H30 WeakPolarHBondContact O-CB 3.41Å; L26-H30 PolarHBondContact O-N 3Å
27	D	85.9	Confident	83.2	Confident	104 Å²	104	105.8 Å²	105.8	56%	0.556	54%	0.541	S	S	*	.	H	α-helix	trans	-63.3	-39	177.7	-73.2	-21.9	0	0	0	111.3	R23 Q24 H30 R31	R23-D27 PolarHBondContact O-N 2.89Å; Q24-D27 PolarHBondContact O-N 3.38Å; D27-H30 PolarHBondContact O-N 2.96Å; D27-R31 WeakPolarHBondContact O-CB 3.34Å; D27-R31 PolarHBondContact O-N 3.38Å
28	A	86.9	Confident	83.4	Confident	53 Å²	53	110.4 Å²	110.4	44%	0.438	55%	0.546	S	S	.	.	H	α-helix	trans	-62.7	-46.8	174.9	0	0	0	0	0	111.9	Q24 Q25 L26 H30 R31 V32	Q24-A28 WeakPolarHBondContact O-CB 3.44Å; Q24-A28 PolarHBondContact O-N 2.9Å; Q25-A28 PolarHBondContact O-N 3.49Å; L26-A28 VanDerWaalsContact C-N 3.31Å; L26-A28 PolarHBondContact O-N 3.45Å; A28-H30 PolarHBondContact O-N 3.46Å; A28-R31 PolarHBondContact O-N 2.94Å; A28-V32 VanDerWaalsContact O-CG2 3.3Å; A28-V32 WeakPolarHBondContact O-CG2 3.32Å; A28-V32 PolarHBondContact O-N 3.41Å
29	V	88.3	Confident	83.3	Confident	96 Å²	96	109.6 Å²	109.6	58%	0.582	55%	0.55	S	S	*	*	H	α-helix	trans	-62.6	-43.2	176.6	171.7	0	0	0	0	111.1	Q25 L26 V32 K33	Q25-V29 WeakPolarHBondContact O-CG2 3.37Å; Q25-V29 PolarHBondContact O-N 2.88Å; L26-V29 PolarHBondContact O-N 3.46Å; V29-V32 PolarHBondContact O-N 3.32Å; V29-K33 VanDerWaalsContact O-CB 3.25Å; V29-K33 WeakPolarHBondContact O-CB 3.39Å; V29-K33 PolarHBondContact O-N 2.86Å
30	H	86.3	Confident	82.4	Confident	142 Å²	142	104.4 Å²	104.4	66%	0.657	54%	0.536	S	S	*	.	H	α-helix	trans	-63.5	-42.9	178.7	-178.1	-98.1	0	0	0	111.9	L26 D27 A28 K33 G34	L26-H30 WeakPolarHBondContact O-CB 3.41Å; L26-H30 PolarHBondContact O-N 3Å; D27-H30 PolarHBondContact O-N 2.96Å; A28-H30 PolarHBondContact O-N 3.46Å; H30-K33 PolarHBondContact O-N 2.91Å; H30-G34 PolarHBondContact O-N 3Å
31	R	87.1	Confident	81.6	Confident	172 Å²	172	102.4 Å²	102.4	65%	0.649	52%	0.523	S	S	*	.	H	α-helix	trans	-61.4	-51.6	175.6	179.1	179	172.2	178.9	0.1	111.7	D27 A28 K33 G34 E35	D27-R31 WeakPolarHBondContact O-CB 3.34Å; D27-R31 PolarHBondContact O-N 3.38Å; A28-R31 PolarHBondContact O-N 2.94Å; R31-K33 VanDerWaalsContact C-N 3.29Å; R31-K33 PolarHBondContact O-N 2.85Å; R31-G34 PolarHBondContact O-N 3.48Å; R31-G34 VanDerWaalsContact O-N 3.13Å; R31-E35 WeakPolarHBondContact CG-OE1 3.25Å; R31-E35 IonicContact CZ-OE1 3.61Å; R31-E35 IonicContact NE-OE1 2.86Å; R31-E35 PolarHBondContact NE-OE1 2.82Å; R31-E35 IonicContact NH2-OE1 3.45Å; R31-E35 PolarHBondContact NH2-OE1 3.13Å; R31-E35 WeakPolarHBondContact O-CG 3.3Å; R31-E35 PolarHBondContact O-N 2.95Å
32	V	87.1	Confident	80.4	Confident	90 Å²	90	108.1 Å²	108.1	55%	0.545	54%	0.541	S	S	.	.	H	α-helix	trans	-60.1	-41.9	179	171	0	0	0	0	110.8	A28 V29 G34 E35 L36	A28-V32 VanDerWaalsContact O-CG2 3.3Å; A28-V32 WeakPolarHBondContact O-CG2 3.32Å; A28-V32 PolarHBondContact O-N 3.41Å; V29-V32 PolarHBondContact O-N 3.32Å; V32-G34 PolarHBondContact O-N 3.48Å; V32-E35 PolarHBondContact O-N 3.39Å; V32-L36 VanDerWaalsContact O-CB 3.32Å; V32-L36 WeakPolarHBondContact O-CB 3.48Å; V32-L36 PolarHBondContact O-N 3.5Å
33	K	84.1	Confident	79.1	Confident	134 Å²	134	112 Å²	112	58%	0.583	56%	0.561	S	S	*	*	H	α-helix	trans	-63.3	-41.4	176.3	-169.7	176.5	179	-179.1	0	111.7	V29 H30 R31 L36 L37	V29-K33 VanDerWaalsContact O-CB 3.25Å; V29-K33 WeakPolarHBondContact O-CB 3.39Å; V29-K33 PolarHBondContact O-N 2.86Å; H30-K33 PolarHBondContact O-N 2.91Å; R31-K33 VanDerWaalsContact C-N 3.29Å; R31-K33 PolarHBondContact O-N 2.85Å; K33-L36 PolarHBondContact O-N 3.29Å; K33-L37 HydrophobicContact CG-CD1 3.96Å; K33-L37 WeakPolarHBondContact O-CB 3.33Å; K33-L37 WeakPolarHBondContact O-CD1 3.42Å; K33-L37 WeakPolarHBondContact O-CG 3.21Å; K33-L37 PolarHBondContact O-N 2.9Å
34	G	83.1	Confident	77.7	Confident	31 Å²	31	110.4 Å²	110.4	32%	0.32	56%	0.564	S	S	.	*	H	α-helix	trans	-65.3	-39	175.3	0	0	0	0	0	113.5	H30 R31 V32 R38	H30-G34 PolarHBondContact O-N 3Å; R31-G34 PolarHBondContact O-N 3.48Å; R31-G34 VanDerWaalsContact O-N 3.13Å; V32-G34 PolarHBondContact O-N 3.48Å; G34-R38 WeakPolarHBondContact O-CB 3.17Å; G34-R38 WeakPolarHBondContact O-CG 3.45Å; G34-R38 PolarHBondContact O-N 3.34Å
35	E	82.1	Confident	76.1	Confident	97 Å²	97	111.1 Å²	111.1	45%	0.453	57%	0.572	S	S	.	*	H	α-helix	trans	-66.9	-42.5	174.1	-72.1	172.5	-178.3	0	0	111.2	R31 V32 R38 A39	R31-E35 WeakPolarHBondContact CG-OE1 3.25Å; R31-E35 IonicContact CZ-OE1 3.61Å; R31-E35 IonicContact NE-OE1 2.86Å; R31-E35 PolarHBondContact NE-OE1 2.82Å; R31-E35 IonicContact NH2-OE1 3.45Å; R31-E35 PolarHBondContact NH2-OE1 3.13Å; R31-E35 WeakPolarHBondContact O-CG 3.3Å; R31-E35 PolarHBondContact O-N 2.95Å; V32-E35 PolarHBondContact O-N 3.39Å; E35-R38 PolarHBondContact O-N 3.05Å; E35-A39 WeakPolarHBondContact O-CB 3.45Å; E35-A39 PolarHBondContact O-N 2.84Å
36	L	81.2	Confident	74.2	Confident	111 Å²	111	111.7 Å²	111.7	58%	0.581	61%	0.613	S	S	*	*	H	α-helix	trans	-62.1	-48.4	174.8	-177.2	65	0	0	0	111.5	V32 K33 R38 A39 D40	V32-L36 VanDerWaalsContact O-CB 3.32Å; V32-L36 WeakPolarHBondContact O-CB 3.48Å; V32-L36 PolarHBondContact O-N 3.5Å; K33-L36 PolarHBondContact O-N 3.29Å; L36-R38 VanDerWaalsContact C-N 3.27Å; L36-R38 PolarHBondContact O-N 3.12Å; L36-A39 PolarHBondContact O-N 3.31Å; L36-A39 VanDerWaalsContact O-N 3.12Å; L36-D40 WeakPolarHBondContact O-CB 3.48Å; L36-D40 PolarHBondContact O-N 2.87Å
37	L	77.1	Confident	73.6	Confident	114 Å²	114	112.2 Å²	112.2	60%	0.597	62%	0.617	S	S	*	*	H	α-helix	trans	-59	-37.6	176	-85	152	0	0	0	112.5	K33 G41	K33-L37 HydrophobicContact CG-CD1 3.96Å; K33-L37 WeakPolarHBondContact O-CB 3.33Å; K33-L37 WeakPolarHBondContact O-CD1 3.42Å; K33-L37 WeakPolarHBondContact O-CG 3.21Å; K33-L37 PolarHBondContact O-N 2.9Å; L37-G41 PolarHBondContact O-N 3.44Å
38	R	74.8	Confident	73	Confident	203 Å²	203	112.6 Å²	112.6	77%	0.766	62%	0.62	S	S	*	*	H	α-helix	trans	-69.4	-38.2	174.5	-80.9	175.8	165.9	-97.5	-0.3	112.7	G34 E35 L36 K42	G34-R38 WeakPolarHBondContact O-CB 3.17Å; G34-R38 WeakPolarHBondContact O-CG 3.45Å; G34-R38 PolarHBondContact O-N 3.34Å; E35-R38 PolarHBondContact O-N 3.05Å; L36-R38 VanDerWaalsContact C-N 3.27Å; L36-R38 PolarHBondContact O-N 3.12Å; R38-K42 PolarHBondContact O-N 3.05Å
39	A	70.5	Confident	72.2	Confident	52 Å²	52	115.9 Å²	115.9	43%	0.43	63%	0.63	S	S	.	*	H	α-helix	trans	-67.6	-44.3	176.1	0	0	0	0	0	110.8	E35 L36 G41 K42 L43	E35-A39 WeakPolarHBondContact O-CB 3.45Å; E35-A39 PolarHBondContact O-N 2.84Å; L36-A39 PolarHBondContact O-N 3.31Å; L36-A39 VanDerWaalsContact O-N 3.12Å; A39-G41 PolarHBondContact O-N 3.33Å; A39-K42 WeakPolarHBondContact O-CB 3.42Å; A39-K42 PolarHBondContact O-N 3.48Å; A39-K42 VanDerWaalsContact O-N 3.13Å; A39-L43 PolarHBondContact O-N 3.45Å
40	D	64.1	Low	71.3	Confident	77 Å²	77	117.1 Å²	117.1	41%	0.412	63%	0.633	S	S	.	*	H	α-helix	trans	-60.7	-46.8	176.3	-139.1	-109.9	0	0	0	110.4	L36 K42 L43 L44	L36-D40 WeakPolarHBondContact O-CB 3.48Å; L36-D40 PolarHBondContact O-N 2.87Å; D40-K42 PolarHBondContact O-N 3.13Å; D40-L43 WeakPolarHBondContact O-CA 3.46Å; D40-L43 PolarHBondContact O-N 2.86Å; D40-L44 WeakPolarHBondContact O-CG 3.36Å; D40-L44 PolarHBondContact O-N 3.36Å
41	G	62.4	Low	70.3	Confident	33 Å²	33	115.6 Å²	115.6	34%	0.34	63%	0.631	S	S	.	*	H	α-helix	trans	-55.6	-24.1	174.8	0	0	0	0	0	115.8	L37 A39 N45	L37-G41 PolarHBondContact O-N 3.44Å; A39-G41 PolarHBondContact O-N 3.33Å; G41-N45 PolarHBondContact O-ND2 2.98Å
42	K	59.8	Low	69.2	Low	176 Å²	176	111.8 Å²	111.8	77%	0.765	63%	0.63	S	S	*	*	H	α-helix	trans	-82.5	-28.6	172.2	-78.4	-172.6	174	-159.5	0	113.5	R38 A39 D40	R38-K42 PolarHBondContact O-N 3.05Å; A39-K42 WeakPolarHBondContact O-CB 3.42Å; A39-K42 PolarHBondContact O-N 3.48Å; A39-K42 VanDerWaalsContact O-N 3.13Å; D40-K42 PolarHBondContact O-N 3.13Å
43	L	57.5	Low	67.9	Low	141 Å²	141	113.4 Å²	113.4	74%	0.738	64%	0.636	S	S	*	*	H	α-helix	trans	-78.9	-23.9	176.1	-62.8	176.1	0	0	0	112.4	A39 D40	A39-L43 PolarHBondContact O-N 3.45Å; D40-L43 WeakPolarHBondContact O-CA 3.46Å; D40-L43 PolarHBondContact O-N 2.86Å
44	L	55.4	Low	66.7	Low	127 Å²	127	111.8 Å²	111.8	67%	0.665	64%	0.64	S	S	*	*	S	Bend	trans	-86.1	-5.5	-179.3	-54.8	164.2	0	0	0	113.7	D40	D40-L44 WeakPolarHBondContact O-CG 3.36Å; D40-L44 PolarHBondContact O-N 3.36Å
45	N	53.2	Low	65.3	Low	150 Å²	150	118.5 Å²	118.5	80%	0.802	67%	0.667	S	S	*	*			trans	-111.4	59.1	174.8	-88.5	-79.2	0	0	0	110.4	G41	G41-N45 PolarHBondContact O-ND2 2.98Å
46	G	45.8	Very low	63.8	Low	141 Å²	141	120.5 Å²	120.5	100%	1.454	69%	0.686	S	S	*	*			trans	-122.8	0	173.1	0	0	0	0	0	110.7

Retrieved 46 of 46 residues in 12.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).