A0A087WPU2_MOUSE Loading...

Predicted gene 28434

AlphaFold DB , UniProt , Accession A0A087WPU2, Species MOUSE (Mus musculus, Mouse), Gene Gm28434, Length 46 aa.

						>A0A087WPU2_MOUSE|A0A087WPU2|Gm28434
MKILILTVITLNFVIFFPGAFQENEASDSICCHLEPKCLLIKAEKR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.3	Low	83.2	Confident	218 Å²	218	123.4 Å²	123.4	100%	1.074	64%	0.64	S	S	*	*				0	-30.3	0	-73.6	-179.3	164.2	0	0	114.8
2	K	72.3	Confident	83.4	Confident	189 Å²	189	119.5 Å²	119.5	82%	0.822	62%	0.621	S	S	*	*	H	α-helix	trans	-71.4	-30.1	-177.4	-64	178.6	178.3	175.1	0	115.1	L4 I5 L6	K2-L4 PolarHBondContact O-N 3.32Å; K2-I5 PolarHBondContact O-N 3.5Å; K2-L6 PolarHBondContact O-N 3.45Å
3	I	80.9	Confident	83.3	Confident	139 Å²	139	120 Å²	120	71%	0.713	62%	0.616	S	S	*	*	H	α-helix	trans	-64.2	-42.7	-177	-62.8	163.6	0	0	0	111.4	I5 L6 T7	I3-I5 VanDerWaalsContact C-N 3.29Å; I3-I5 PolarHBondContact O-N 3.05Å; I3-L6 PolarHBondContact O-N 3.11Å; I3-T7 PolarHBondContact O-N 3.28Å; I3-T7 VanDerWaalsContact O-N 3.11Å; I3-T7 PolarHBondContact O-OG1 3.4Å; I3-T7 VanDerWaalsContact O-OG1 3.05Å
4	L	83	Confident	83.2	Confident	130 Å²	130	117.9 Å²	117.9	68%	0.681	61%	0.611	S	S	*	*	H	α-helix	trans	-60.6	-39.7	-178.4	-171.6	68.5	0	0	0	112.2	K2 T7 V8	K2-L4 PolarHBondContact O-N 3.32Å; L4-T7 PolarHBondContact O-N 3.34Å; L4-V8 VanDerWaalsContact O-CG2 3.3Å; L4-V8 WeakPolarHBondContact O-CG2 3.3Å; L4-V8 PolarHBondContact O-N 3.15Å; L4-V8 VanDerWaalsContact O-N 3.15Å
5	I	88.6	Confident	83.1	Confident	110 Å²	110	117.8 Å²	117.8	56%	0.564	61%	0.61	S	S	*	*	H	α-helix	trans	-67.6	-43.8	-178.5	-61.1	169.4	0	0	0	110.3	K2 I3 T7 V8 I9	K2-I5 PolarHBondContact O-N 3.5Å; I3-I5 VanDerWaalsContact C-N 3.29Å; I3-I5 PolarHBondContact O-N 3.05Å; I5-T7 PolarHBondContact O-N 3.15Å; I5-V8 PolarHBondContact O-N 3.43Å; I5-I9 VanDerWaalsContact O-N 3.15Å; I5-I9 PolarHBondContact O-N 3.01Å; I5-I9 HydrophobicContact CG2-CD1 3.92Å; I5-I9 WeakPolarHBondContact O-CG1 3.43Å
6	L	87.8	Confident	82.8	Confident	116 Å²	116	119.6 Å²	119.6	61%	0.607	61%	0.612	S	S	*	*	H	α-helix	trans	-63.1	-42.9	179.1	-173	62.7	0	0	0	111.3	K2 I3 V8 I9 T10	K2-L6 PolarHBondContact O-N 3.45Å; I3-L6 PolarHBondContact O-N 3.11Å; L6-V8 PolarHBondContact O-N 2.9Å; L6-I9 PolarHBondContact O-N 3.47Å; L6-T10 PolarHBondContact O-N 3.43Å; L6-T10 PolarHBondContact O-OG1 3.06Å; L6-T10 VanDerWaalsContact O-OG1 3.13Å
7	T	87.5	Confident	82	Confident	82 Å²	82	119.9 Å²	119.9	50%	0.503	61%	0.609	S	S	.	*	H	α-helix	trans	-61.4	-42.3	177.7	-52.5	0	0	0	0	112.2	I3 L4 I5 I9 T10 L11	I3-T7 PolarHBondContact O-N 3.28Å; I3-T7 VanDerWaalsContact O-N 3.11Å; I3-T7 PolarHBondContact O-OG1 3.4Å; I3-T7 VanDerWaalsContact O-OG1 3.05Å; L4-T7 PolarHBondContact O-N 3.34Å; I5-T7 PolarHBondContact O-N 3.15Å; T7-I9 VanDerWaalsContact C-N 3.34Å; T7-I9 PolarHBondContact O-N 3.44Å; T7-T10 PolarHBondContact O-N 3.47Å; T7-L11 WeakPolarHBondContact O-CB 3.33Å; T7-L11 PolarHBondContact O-N 3.49Å
8	V	90	Very high	81	Confident	80 Å²	80	119.6 Å²	119.6	49%	0.485	62%	0.616	S	S	.	*	H	α-helix	trans	-65.2	-38.2	179.1	172.2	0	0	0	0	111.7	L4 I5 L6 N12	L4-V8 VanDerWaalsContact O-CG2 3.3Å; L4-V8 WeakPolarHBondContact O-CG2 3.3Å; L4-V8 PolarHBondContact O-N 3.15Å; L4-V8 VanDerWaalsContact O-N 3.15Å; I5-V8 PolarHBondContact O-N 3.43Å; L6-V8 PolarHBondContact O-N 2.9Å; V8-N12 PolarHBondContact O-N 3.16Å; V8-N12 VanDerWaalsContact O-N 3.16Å; V8-N12 PolarHBondContact O-ND2 3Å
9	I	89.4	Confident	80.2	Confident	102 Å²	102	116 Å²	116	52%	0.523	61%	0.611	S	S	.	*	H	α-helix	trans	-67.1	-47.3	177.8	-66.3	166.1	0	0	0	110.5	I5 L6 T7 L11 N12 F13	I5-I9 VanDerWaalsContact O-N 3.15Å; I5-I9 PolarHBondContact O-N 3.01Å; I5-I9 HydrophobicContact CG2-CD1 3.92Å; I5-I9 WeakPolarHBondContact O-CG1 3.43Å; L6-I9 PolarHBondContact O-N 3.47Å; T7-I9 VanDerWaalsContact C-N 3.34Å; T7-I9 PolarHBondContact O-N 3.44Å; I9-L11 VanDerWaalsContact C-N 3.33Å; I9-L11 PolarHBondContact O-N 3.03Å; I9-N12 PolarHBondContact O-N 3.29Å; I9-F13 PolarHBondContact O-N 3.2Å
10	T	84.9	Confident	79.1	Confident	78 Å²	78	113 Å²	113	48%	0.479	60%	0.603	S	S	.	*	H	α-helix	trans	-61.4	-41.8	178.6	-56.6	0	0	0	0	111.8	L6 T7 N12 F13 V14	L6-T10 PolarHBondContact O-N 3.43Å; L6-T10 PolarHBondContact O-OG1 3.06Å; L6-T10 VanDerWaalsContact O-OG1 3.13Å; T7-T10 PolarHBondContact O-N 3.47Å; T10-N12 PolarHBondContact O-N 3.13Å; T10-F13 PolarHBondContact O-N 3.28Å; T10-V14 HydrophobicContact CG2-CG2 4.49Å; T10-V14 WeakPolarHBondContact O-CG2 3.26Å; T10-V14 PolarHBondContact O-N 3.49Å
11	L	87.1	Confident	78.1	Confident	113 Å²	113	117.4 Å²	117.4	59%	0.592	62%	0.618	S	S	*	*	H	α-helix	trans	-63.7	-43.2	179.5	-154	83.5	0	0	0	111.8	T7 I9 V14 I15	T7-L11 WeakPolarHBondContact O-CB 3.33Å; T7-L11 PolarHBondContact O-N 3.49Å; I9-L11 VanDerWaalsContact C-N 3.33Å; I9-L11 PolarHBondContact O-N 3.03Å; L11-V14 PolarHBondContact O-N 3.18Å; L11-I15 HydrophobicContact CD2-CD1 4.5Å; L11-I15 HydrophobicContact CG-CD1 4.29Å; L11-I15 WeakPolarHBondContact O-CD1 3.2Å; L11-I15 VanDerWaalsContact O-CG1 3.26Å; L11-I15 WeakPolarHBondContact O-CG1 3.35Å; L11-I15 PolarHBondContact O-N 3.5Å
12	N	86.1	Confident	77.8	Confident	77 Å²	77	115.2 Å²	115.2	41%	0.412	61%	0.605	S	S	.	*	H	α-helix	trans	-61.5	-46.3	174.5	-86.3	-87.3	0	0	0	111.1	V8 I9 T10 V14 I15 F16	V8-N12 PolarHBondContact O-N 3.16Å; V8-N12 VanDerWaalsContact O-N 3.16Å; V8-N12 PolarHBondContact O-ND2 3Å; I9-N12 PolarHBondContact O-N 3.29Å; T10-N12 PolarHBondContact O-N 3.13Å; N12-V14 VanDerWaalsContact C-N 3.32Å; N12-V14 PolarHBondContact O-N 3.34Å; N12-I15 PolarHBondContact O-N 2.99Å; N12-F16 PolarHBondContact O-N 3.34Å; N12-F16 HydrophobicContact CB-CD2 4.39Å; N12-F16 WeakPolarHBondContact O-CD2 3.42Å
13	F	82.3	Confident	76.8	Confident	126 Å²	126	114.9 Å²	114.9	55%	0.553	61%	0.606	S	S	*	*	H	α-helix	trans	-59.8	-41.6	-178.2	-165.8	-94.6	0	0	0	112.6	I9 T10 F17 A20	I9-F13 PolarHBondContact O-N 3.2Å; T10-F13 PolarHBondContact O-N 3.28Å; F13-F17 HydrophobicContact CD2-CD2 4.49Å; F13-F17 HydrophobicContact CE2-CD2 4.44Å; F13-F17 PolarHBondContact O-N 3.13Å; F13-A20 HydrophobicContact CE1-CB 4.27Å
14	V	81.8	Confident	75.3	Confident	91 Å²	91	115.4 Å²	115.4	55%	0.552	61%	0.611	S	S	*	*	H	α-helix	trans	-66.8	-38.6	177.7	173.5	0	0	0	0	112.2	T10 L11 N12	T10-V14 HydrophobicContact CG2-CG2 4.49Å; T10-V14 WeakPolarHBondContact O-CG2 3.26Å; T10-V14 PolarHBondContact O-N 3.49Å; L11-V14 PolarHBondContact O-N 3.18Å; N12-V14 VanDerWaalsContact C-N 3.32Å; N12-V14 PolarHBondContact O-N 3.34Å
15	I	80.8	Confident	73.4	Confident	116 Å²	116	118.8 Å²	118.8	60%	0.595	62%	0.623	S	S	*	*	H	α-helix	trans	-69.8	-42.7	179.6	-66.7	165.4	0	0	0	111.2	L11 N12	L11-I15 HydrophobicContact CD2-CD1 4.5Å; L11-I15 HydrophobicContact CG-CD1 4.29Å; L11-I15 WeakPolarHBondContact O-CD1 3.2Å; L11-I15 VanDerWaalsContact O-CG1 3.26Å; L11-I15 WeakPolarHBondContact O-CG1 3.35Å; L11-I15 PolarHBondContact O-N 3.5Å; N12-I15 PolarHBondContact O-N 2.99Å
16	F	78.2	Confident	71.4	Confident	146 Å²	146	118 Å²	118	64%	0.64	63%	0.633	S	S	*	*	H	α-helix	trans	-82.1	-23.7	-176	-75.2	-74.3	0	0	0	113.6	N12	N12-F16 PolarHBondContact O-N 3.34Å; N12-F16 HydrophobicContact CB-CD2 4.39Å; N12-F16 WeakPolarHBondContact O-CD2 3.42Å
17	F	69.4	Low	69.5	Low	126 Å²	126	118 Å²	118	55%	0.553	64%	0.643	S	S	*	*			trans	-132.7	68.3	-177.9	-65.3	-87.7	0	0	0	112.4	F13 G19 A20	F13-F17 HydrophobicContact CD2-CD2 4.49Å; F13-F17 HydrophobicContact CE2-CD2 4.44Å; F13-F17 PolarHBondContact O-N 3.13Å; F17-G19 PolarHBondContact O-N 2.98Å; F17-G19 VanDerWaalsContact O-N 3.13Å; F17-A20 PolarHBondContact O-N 3.25Å; F17-A20 HydrophobicContact CB-CB 3.97Å
18	P	64.4	Low	67.3	Low	113 Å²	113	121.4 Å²	121.4	73%	0.734	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.6	-16.2	179.4	27.4	-35.4	0	0	0	113.6
19	G	65.6	Low	65.3	Low	52 Å²	52	121.8 Å²	121.8	54%	0.536	66%	0.664	S	S	.	*	T	Hydrogen-bonded Turn	trans	-93.4	-9	179.3	0	0	0	0	0	115.3	F17 F21 Q22	F17-G19 PolarHBondContact O-N 2.98Å; F17-G19 VanDerWaalsContact O-N 3.13Å; G19-F21 PolarHBondContact O-N 3.47Å; G19-Q22 PolarHBondContact O-N 3.32Å
20	A	59.2	Low	63.7	Low	55 Å²	55	124.1 Å²	124.1	46%	0.455	68%	0.676	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.2	-6.8	-177.1	0	0	0	0	0	113.7	F13 F17	F13-A20 HydrophobicContact CE1-CB 4.27Å; F17-A20 PolarHBondContact O-N 3.25Å; F17-A20 HydrophobicContact CB-CB 3.97Å
21	F	58	Low	62	Low	206 Å²	206	126.2 Å²	126.2	90%	0.904	69%	0.693	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.8	7.6	173.3	-133.5	-95.2	0	0	0	112.7	G19 E23	G19-F21 PolarHBondContact O-N 3.47Å; F21-E23 PolarHBondContact O-N 3.27Å
22	Q	55.5	Low	59.8	Low	172 Å²	172	127.4 Å²	127.4	80%	0.804	71%	0.709	S	S	*	*			trans	-101	53.3	179.4	-151.7	-176.9	118.8	0	0	110.4	G19	G19-Q22 PolarHBondContact O-N 3.32Å
23	E	52.6	Low	58	Low	182 Å²	182	132.1 Å²	132.1	85%	0.85	73%	0.728	S	S	*	*			trans	-125.7	109.3	164.6	-74.4	-164.8	90.7	0	0	109.7	F21	F21-E23 PolarHBondContact O-N 3.27Å
24	N	49.3	Very low	56.5	Low	151 Å²	151	134.3 Å²	134.3	81%	0.807	74%	0.744	S	S	*	*	S	Bend	trans	96.5	75.1	136	-136.7	18.5	0	0	0	118.2
25	E	42.7	Very low	54.3	Low	201 Å²	201	138 Å²	138	94%	0.939	76%	0.756	S	S	*	*	S	Bend	trans	-157.2	69.9	136.4	-150.1	174.9	102.1	0	0	110.9
26	A	47.3	Very low	52.7	Low	94 Å²	94	138.2 Å²	138.2	78%	0.777	77%	0.765	S	S	*	*			trans	-152.2	53.5	161.8	0	0	0	0	0	109.8	D28	A26-D28 PolarHBondContact O-N 2.89Å; A26-D28 VanDerWaalsContact O-N 3.13Å
27	S	47.6	Very low	51.2	Low	116 Å²	116	140.9 Å²	140.9	81%	0.811	78%	0.776	S	S	*	*			trans	-78.5	67	154.8	-176.4	0	0	0	0	108.1
28	D	41.3	Very low	50.1	Low	152 Å²	152	140.4 Å²	140.4	81%	0.813	79%	0.787	S	S	*	*			trans	-142.3	119	156.8	-113.8	-49.7	0	0	0	108.9	A26	A26-D28 PolarHBondContact O-N 2.89Å; A26-D28 VanDerWaalsContact O-N 3.13Å
29	S	48.1	Very low	49.1	Very low	89 Å²	89	141.4 Å²	141.4	62%	0.622	79%	0.785	S	S	*	*			trans	-59.1	155.9	-178.8	66.2	0	0	0	0	112.1
30	I	56.3	Low	48.1	Very low	150 Å²	150	146.7 Å²	146.7	77%	0.769	80%	0.8	S	S	*	*			trans	75.3	81.8	154.1	-53.1	152.6	0	0	0	115.3
31	C	47.2	Very low	47.6	Very low	123 Å²	123	151.6 Å²	151.6	83%	0.831	82%	0.818	S	S	*	*			trans	-172	61.6	136.1	-111.9	0	0	0	0	113.7
32	C	42	Very low	47	Very low	137 Å²	137	150.3 Å²	150.3	93%	0.926	81%	0.811	S	S	*	*			trans	-128.9	44.5	152.7	-80.8	0	0	0	0	109.6
33	H	47.7	Very low	46.9	Very low	177 Å²	177	146.7 Å²	146.7	82%	0.819	81%	0.811	S	S	*	*			trans	-104.6	66.2	170.7	-164.1	95.5	0	0	0	108.8
34	L	50.6	Low	47	Very low	171 Å²	171	147.3 Å²	147.3	90%	0.895	81%	0.814	S	S	*	*	S	Bend	trans	-163.3	33.2	164.9	-105	154.1	0	0	0	112.6
35	E	37	Very low	47.3	Very low	169 Å²	169	149.7 Å²	149.7	79%	0.79	82%	0.817	S	S	*	*	S	Bend	trans	-128.5	111.2	151.8	-99.8	-96.3	75.1	0	0	106	K37	E35-K37 PolarHBondContact O-N 3.13Å
36	P	47.1	Very low	47.2	Very low	121 Å²	121	155.1 Å²	155.1	79%	0.786	83%	0.829	S	S	*	*	S	Bend	trans	-85	57.1	-160.6	36.1	-37.2	0	0	0	111.7
37	K	45.2	Very low	47.2	Very low	202 Å²	202	158.2 Å²	158.2	88%	0.878	83%	0.832	S	S	*	*			trans	-141.2	43.5	172.3	-71.1	-168.9	179.5	171.6	0	112.7	E35	E35-K37 PolarHBondContact O-N 3.13Å
38	C	47.2	Very low	47.2	Very low	116 Å²	116	160.4 Å²	160.4	78%	0.784	83%	0.833	S	S	*	*	S	Bend	trans	-86.6	105.8	162	-161.2	0	0	0	0	108.6
39	L	42.8	Very low	47.5	Very low	133 Å²	133	160.8 Å²	160.8	70%	0.696	83%	0.834	S	S	*	*			trans	51.2	81.9	161.6	-63.2	168.3	0	0	0	117.4	I41	L39-I41 HydrophobicContact CD2-CD1 4.11Å; L39-I41 HydrophobicContact CD2-CG1 4.23Å
40	L	44.3	Very low	47.5	Very low	163 Å²	163	165.1 Å²	165.1	85%	0.853	85%	0.846	S	S	*	*			trans	-104.1	65.4	138.1	-79.3	168.9	0	0	0	109	K42	L40-K42 PolarHBondContact O-N 3.22Å
41	I	49.8	Very low	46.9	Very low	159 Å²	159	166 Å²	166	82%	0.815	85%	0.851	S	S	*	*			trans	-83.9	74.1	148.2	-56.4	177.6	0	0	0	105.4	L39	L39-I41 HydrophobicContact CD2-CD1 4.11Å; L39-I41 HydrophobicContact CD2-CG1 4.23Å
42	K	46.3	Very low	46.9	Very low	178 Å²	178	168.9 Å²	168.9	77%	0.774	85%	0.852	S	S	*	*			trans	-144.2	111.2	162.8	-159.9	172.4	-174.3	175.6	0	107.4	L40	L40-K42 PolarHBondContact O-N 3.22Å
43	A	52	Low	47.3	Very low	96 Å²	96	171.1 Å²	171.1	79%	0.793	85%	0.847	S	S	*	*			trans	81.7	92.2	168.1	0	0	0	0	0	118.6
44	E	55	Low	47.2	Very low	195 Å²	195	170.7 Å²	170.7	91%	0.911	85%	0.849	S	S	*	*			trans	-125.5	113.1	133.4	-172.9	93.7	90.3	0	0	106.1
45	K	55.1	Low	46.9	Very low	201 Å²	201	170.7 Å²	170.7	87%	0.874	85%	0.845	S	S	*	*			trans	-99.1	99.2	-175.7	-179.9	-177.4	-176	178.2	0	107.6
46	R	41.5	Very low	47.8	Very low	315 Å²	315	170.8 Å²	170.8	100%	1.189	85%	0.85	S	S	*	*			trans	-162.4	0	151.8	-112.1	177.7	-168.1	-178.9	4.7	110.7

Retrieved 46 of 46 residues in 8.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).