A0A087WPV8_MOUSE Loading...

Cap methyltransferase 2

AlphaFold DB , UniProt , Accession A0A087WPV8, Species MOUSE (Mus musculus, Mouse), Gene Cmtr2, Length 51 aa.

						>A0A087WPV8_MOUSE|A0A087WPV8|Cmtr2
MSKRRKLPARQPACLETFSPDVLNDVSELFAKSFSYRKPLDNEWQLPAPTE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.7	Very low	60.7	Low	237 Å²	237	183.5 Å²	183.5	100%	1.167	87%	0.872	S	S	*	*				0	84.2	0	-70.9	-69.1	-90.8	0	0	109.7	K3	M1-K3 PolarHBondContact O-N 3.2Å
2	S	55.4	Low	61	Low	120 Å²	120	178.2 Å²	178.2	84%	0.839	86%	0.864	S	S	*	*			trans	-78.4	96.1	176.6	37.1	0	0	0	0	109.4	R4	S2-R4 VanDerWaalsContact C-N 3.32Å; S2-R4 PolarHBondContact O-N 3.06Å
3	K	61.8	Low	61.4	Low	202 Å²	202	170.4 Å²	170.4	88%	0.878	85%	0.847	S	S	*	*			trans	-63.7	96.3	166.9	-76.5	173.9	173.5	166.9	0	107.4	M1 R5	M1-K3 PolarHBondContact O-N 3.2Å; K3-R5 PolarHBondContact O-N 3.1Å
4	R	65.1	Low	62.1	Low	241 Å²	241	162.5 Å²	162.5	91%	0.909	82%	0.815	S	S	*	*			trans	-54	107	166.4	-97.3	-177.1	171.5	-178.5	-2.3	106.8	S2 K6	S2-R4 VanDerWaalsContact C-N 3.32Å; S2-R4 PolarHBondContact O-N 3.06Å; R4-K6 PolarHBondContact O-N 3Å
5	R	67.1	Low	62.7	Low	241 Å²	241	159.3 Å²	159.3	91%	0.909	80%	0.801	S	S	*	*			trans	-60.4	112	164.9	-78.4	-175.1	-92.4	165.8	-6.3	105.6	K3 L7	K3-R5 PolarHBondContact O-N 3.1Å; R5-L7 PolarHBondContact O-N 3.43Å
6	K	67.8	Low	63.6	Low	203 Å²	203	160.7 Å²	160.7	88%	0.883	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-53.6	118	168.2	-95.9	159.5	170.7	174	0	105.6	R4	R4-K6 PolarHBondContact O-N 3Å
7	L	64.3	Low	64.8	Low	162 Å²	162	157.8 Å²	157.8	85%	0.848	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-47.7	130	166.5	-86.8	149	0	0	0	106	R5 A9	R5-L7 PolarHBondContact O-N 3.43Å; L7-A9 PolarHBondContact O-N 3.29Å
8	P	63.9	Low	65.9	Low	115 Å²	115	154.6 Å²	154.6	75%	0.747	78%	0.777	S	S	*	*	P	Polyproline II helix	trans	-48.7	125	174.2	-19.7	29.3	0	0	0	106.1	R10	P8-R10 PolarHBondContact O-N 3.25Å
9	A	63.3	Low	67.2	Low	85 Å²	85	149.3 Å²	149.3	70%	0.702	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-48.7	123.3	174.9	0	0	0	0	0	105.5	L7 Q11	L7-A9 PolarHBondContact O-N 3.29Å; A9-Q11 PolarHBondContact O-N 3.35Å
10	R	60.3	Low	68.4	Low	242 Å²	242	147 Å²	147	91%	0.913	75%	0.752	S	S	*	*			trans	-63.2	83.5	178.4	-174.2	175.5	172.7	-175.9	-2.6	105.6	P8 P12	P8-R10 PolarHBondContact O-N 3.25Å; R10-P12 VanDerWaalsContact O-CD 3.26Å; R10-P12 WeakPolarHBondContact O-CD 3.48Å; R10-P12 VanDerWaalsContact O-N 3.15Å
11	Q	63.5	Low	69.5	Low	170 Å²	170	145.6 Å²	145.6	79%	0.794	75%	0.746	S	S	*	*			trans	-62.4	117.9	176.9	-76.8	-177.2	-32.8	0	0	104	A9 A13	A9-Q11 PolarHBondContact O-N 3.35Å; Q11-A13 PolarHBondContact O-N 3.35Å
12	P	64.3	Low	72.1	Confident	120 Å²	120	137.3 Å²	137.3	78%	0.779	71%	0.709	S	S	*	*			trans	-60.4	111	169.5	25.1	-29.7	0	0	0	105.2	R10 C14	R10-P12 VanDerWaalsContact O-CD 3.26Å; R10-P12 WeakPolarHBondContact O-CD 3.48Å; R10-P12 VanDerWaalsContact O-N 3.15Å; P12-C14 PolarHBondContact O-N 2.87Å
13	A	65.6	Low	73.8	Confident	77 Å²	77	134.7 Å²	134.7	64%	0.636	69%	0.685	S	S	*	*			trans	-57.4	118.5	175.4	0	0	0	0	0	106.7	Q11 L15	Q11-A13 PolarHBondContact O-N 3.35Å; A13-L15 PolarHBondContact O-N 3.2Å; A13-L15 VanDerWaalsContact O-N 3.09Å
14	C	71.9	Confident	75.2	Confident	60 Å²	60	129 Å²	129	41%	0.405	66%	0.664	S	S	.	*			trans	-72.9	104.4	179.1	-170.7	0	0	0	0	107.7	P12 E16 T17 F18	P12-C14 PolarHBondContact O-N 2.87Å; C14-E16 PolarHBondContact O-N 3.03Å; C14-T17 PolarHBondContact O-N 3.31Å; C14-T17 PolarHBondContact O-OG1 3.39Å; C14-F18 VanDerWaalsContact O-CD2 3.29Å; C14-F18 WeakPolarHBondContact O-CD2 3.48Å; C14-F18 VanDerWaalsContact O-CE2 3.31Å; C14-F18 WeakPolarHBondContact O-CE2 3.35Å
15	L	70.5	Confident	76.4	Confident	115 Å²	115	122 Å²	122	60%	0.602	65%	0.645	S	S	*	*	G	3₁₀ helix	trans	-63.9	-24.6	179.7	-64.4	174.5	0	0	0	111.7	A13 T17 F18 L23	A13-L15 PolarHBondContact O-N 3.2Å; A13-L15 VanDerWaalsContact O-N 3.09Å; L15-T17 PolarHBondContact O-N 2.78Å; L15-F18 PolarHBondContact O-N 3.17Å; L15-L23 HydrophobicContact CD2-CD2 3.89Å
16	E	76.5	Confident	77.5	Confident	181 Å²	181	113.6 Å²	113.6	85%	0.846	62%	0.62	S	S	*	*	G	3₁₀ helix	trans	-68.2	-17.9	178.9	-57.4	169.8	162.8	0	0	113	C14 F18	C14-E16 PolarHBondContact O-N 3.03Å; E16-F18 VanDerWaalsContact C-N 3.32Å
17	T	84.4	Confident	78.4	Confident	112 Å²	112	107.5 Å²	107.5	69%	0.687	60%	0.603	S	S	*	*	G	3₁₀ helix	trans	-79.1	-17.5	177.4	-48.8	0	0	0	0	112.4	C14 L15	C14-T17 PolarHBondContact O-N 3.31Å; C14-T17 PolarHBondContact O-OG1 3.39Å; L15-T17 PolarHBondContact O-N 2.78Å
18	F	85.1	Confident	79.6	Confident	99 Å²	99	105.3 Å²	105.3	43%	0.434	59%	0.588	S	S	.	*	S	Bend	trans	-98.1	146	-175.3	-59.9	-81.1	0	0	0	111.1	C14 L15 E16 V22 L23	C14-F18 VanDerWaalsContact O-CD2 3.29Å; C14-F18 WeakPolarHBondContact O-CD2 3.48Å; C14-F18 VanDerWaalsContact O-CE2 3.31Å; C14-F18 WeakPolarHBondContact O-CE2 3.35Å; L15-F18 PolarHBondContact O-N 3.17Å; E16-F18 VanDerWaalsContact C-N 3.32Å; F18-V22 HydrophobicContact CD1-CG1 4.24Å; F18-L23 HydrophobicContact CB-CD2 3.88Å; F18-L23 HydrophobicContact CB-CG 4.04Å; F18-L23 HydrophobicContact CD2-CD2 4.48Å; F18-L23 HydrophobicContact CG-CD2 4.42Å
19	S	90.9	Very high	80.8	Confident	55 Å²	55	105.1 Å²	105.1	39%	0.385	58%	0.58	S	S	.	*			trans	-67.2	152.5	172.3	64.9	0	0	0	0	110.7	D21 V22 L23	S19-D21 PolarHBondContact O-N 3.17Å; S19-V22 PolarHBondContact O-N 3.19Å; S19-V22 VanDerWaalsContact O-N 3.17Å; S19-V22 WeakPolarHBondContact OG-CG2 3.42Å; S19-L23 PolarHBondContact O-N 2.93Å
20	P	90.1	Very high	81.7	Confident	103 Å²	103	109.3 Å²	109.3	67%	0.669	58%	0.583	S	S	*	*	H	α-helix	trans	-54.9	-36.2	176.7	-26.4	35.2	0	0	0	113.2	L23 N24	P20-L23 PolarHBondContact O-N 3.49Å; P20-N24 WeakPolarHBondContact O-CB 3.48Å; P20-N24 PolarHBondContact O-N 3.38Å
21	D	92.7	Very high	83	Confident	117 Å²	117	101.7 Å²	101.7	63%	0.626	57%	0.572	S	S	*	*	H	α-helix	trans	-63	-44.3	179.7	-52.9	-47.9	0	0	0	111.8	S19 L23 N24 D25	S19-D21 PolarHBondContact O-N 3.17Å; D21-L23 VanDerWaalsContact C-N 3.33Å; D21-L23 PolarHBondContact O-N 2.95Å; D21-N24 WeakPolarHBondContact O-CB 3.49Å; D21-N24 PolarHBondContact O-N 2.9Å; D21-D25 PolarHBondContact O-N 2.87Å
22	V	90.6	Very high	83.8	Confident	64 Å²	64	100.4 Å²	100.4	39%	0.388	56%	0.564	S	S	.	*	H	α-helix	trans	-64.5	-40.3	177.8	171.7	0	0	0	0	110.9	F18 S19 N24 D25 V26	F18-V22 HydrophobicContact CD1-CG1 4.24Å; S19-V22 PolarHBondContact O-N 3.19Å; S19-V22 VanDerWaalsContact O-N 3.17Å; S19-V22 WeakPolarHBondContact OG-CG2 3.42Å; V22-N24 VanDerWaalsContact C-N 3.3Å; V22-N24 PolarHBondContact O-N 3.08Å; V22-D25 PolarHBondContact O-N 3.34Å; V22-V26 HydrophobicContact CG1-CG2 4.42Å; V22-V26 WeakPolarHBondContact O-CB 3.14Å; V22-V26 WeakPolarHBondContact O-CG2 3.31Å; V22-V26 PolarHBondContact O-N 2.98Å
23	L	90.3	Very high	84.3	Confident	64 Å²	64	99.9 Å²	99.9	34%	0.335	56%	0.563	S	S	.	*	H	α-helix	trans	-64.6	-38	176.5	-64.4	178.8	0	0	0	111.5	L15 F18 S19 P20 D21 S27	L15-L23 HydrophobicContact CD2-CD2 3.89Å; F18-L23 HydrophobicContact CB-CD2 3.88Å; F18-L23 HydrophobicContact CB-CG 4.04Å; F18-L23 HydrophobicContact CD2-CD2 4.48Å; F18-L23 HydrophobicContact CG-CD2 4.42Å; S19-L23 PolarHBondContact O-N 2.93Å; P20-L23 PolarHBondContact O-N 3.49Å; D21-L23 VanDerWaalsContact C-N 3.33Å; D21-L23 PolarHBondContact O-N 2.95Å; L23-S27 WeakPolarHBondContact O-CB 3.48Å; L23-S27 PolarHBondContact O-N 3.42Å
24	N	91.3	Very high	84.7	Confident	84 Å²	84	101.6 Å²	101.6	45%	0.449	56%	0.556	S	S	.	*	H	α-helix	trans	-65.5	-49.8	175.9	-172	73.5	0	0	0	111.6	P20 D21 V22 V26 S27 E28	P20-N24 WeakPolarHBondContact O-CB 3.48Å; P20-N24 PolarHBondContact O-N 3.38Å; D21-N24 WeakPolarHBondContact O-CB 3.49Å; D21-N24 PolarHBondContact O-N 2.9Å; V22-N24 VanDerWaalsContact C-N 3.3Å; V22-N24 PolarHBondContact O-N 3.08Å; N24-V26 VanDerWaalsContact C-N 3.31Å; N24-V26 PolarHBondContact O-N 3.48Å; N24-S27 WeakPolarHBondContact O-CB 3.48Å; N24-S27 PolarHBondContact O-N 2.99Å; N24-S27 VanDerWaalsContact O-N 3.08Å; N24-E28 PolarHBondContact ND2-OE1 3.27Å; N24-E28 WeakPolarHBondContact O-CG 3.33Å; N24-E28 PolarHBondContact O-N 3.3Å
25	D	90.8	Very high	84.9	Confident	93 Å²	93	104 Å²	104	50%	0.497	57%	0.574	S	S	.	*	H	α-helix	trans	-58.4	-43.3	178.3	-70.8	-10.2	0	0	0	111.7	D21 V22 E28 L29	D21-D25 PolarHBondContact O-N 2.87Å; V22-D25 PolarHBondContact O-N 3.34Å; D25-E28 PolarHBondContact O-N 3.21Å; D25-L29 WeakPolarHBondContact O-CG 3.36Å; D25-L29 PolarHBondContact O-N 3.01Å
26	V	88.8	Confident	85.1	Confident	64 Å²	64	108.4 Å²	108.4	39%	0.388	58%	0.584	S	S	.	*	H	α-helix	trans	-63.5	-44.5	175.7	171.9	0	0	0	0	110.5	V22 N24 E28 L29 F30	V22-V26 HydrophobicContact CG1-CG2 4.42Å; V22-V26 WeakPolarHBondContact O-CB 3.14Å; V22-V26 WeakPolarHBondContact O-CG2 3.31Å; V22-V26 PolarHBondContact O-N 2.98Å; N24-V26 VanDerWaalsContact C-N 3.31Å; N24-V26 PolarHBondContact O-N 3.48Å; V26-E28 VanDerWaalsContact C-N 3.32Å; V26-E28 PolarHBondContact O-N 3.17Å; V26-L29 WeakPolarHBondContact O-CB 3.38Å; V26-L29 PolarHBondContact O-N 3.42Å; V26-F30 HydrophobicContact CG1-CD2 3.83Å; V26-F30 HydrophobicContact CG1-CE2 3.81Å; V26-F30 WeakPolarHBondContact O-CD2 3.22Å; V26-F30 PolarHBondContact O-N 3.28Å
27	S	86.9	Confident	85.1	Confident	76 Å²	76	110.8 Å²	110.8	53%	0.531	59%	0.585	S	S	.	*	H	α-helix	trans	-58.6	-44.6	177	-173.1	0	0	0	0	111.7	L23 N24 F30 A31	L23-S27 WeakPolarHBondContact O-CB 3.48Å; L23-S27 PolarHBondContact O-N 3.42Å; N24-S27 WeakPolarHBondContact O-CB 3.48Å; N24-S27 PolarHBondContact O-N 2.99Å; N24-S27 VanDerWaalsContact O-N 3.08Å; S27-F30 PolarHBondContact O-N 3.29Å; S27-A31 WeakPolarHBondContact O-CB 3.26Å; S27-A31 PolarHBondContact O-N 3.43Å
28	E	90.7	Very high	84.7	Confident	116 Å²	116	114.2 Å²	114.2	54%	0.542	59%	0.591	S	S	.	*	H	α-helix	trans	-63.6	-40.8	177.4	-71.7	-177.2	-165.7	0	0	112.7	N24 D25 V26 F30 A31 K32	N24-E28 PolarHBondContact ND2-OE1 3.27Å; N24-E28 WeakPolarHBondContact O-CG 3.33Å; N24-E28 PolarHBondContact O-N 3.3Å; D25-E28 PolarHBondContact O-N 3.21Å; V26-E28 VanDerWaalsContact C-N 3.32Å; V26-E28 PolarHBondContact O-N 3.17Å; E28-F30 VanDerWaalsContact C-N 3.28Å; E28-F30 PolarHBondContact O-N 2.9Å; E28-A31 PolarHBondContact O-N 3.21Å; E28-K32 PolarHBondContact O-N 3.49Å
29	L	87.9	Confident	84.4	Confident	110 Å²	110	112 Å²	112	58%	0.576	59%	0.586	S	S	*	*	H	α-helix	trans	-57.8	-40.4	176.1	-78.3	169.7	0	0	0	112.3	D25 V26	D25-L29 WeakPolarHBondContact O-CG 3.36Å; D25-L29 PolarHBondContact O-N 3.01Å; V26-L29 WeakPolarHBondContact O-CB 3.38Å; V26-L29 PolarHBondContact O-N 3.42Å
30	F	83.3	Confident	83.6	Confident	173 Å²	173	117.1 Å²	117.1	76%	0.759	61%	0.608	S	S	*	*	H	α-helix	trans	-87.2	-24.4	-179.6	-74.3	-74.9	0	0	0	113.8	V26 S27 E28 K32	V26-F30 HydrophobicContact CG1-CD2 3.83Å; V26-F30 HydrophobicContact CG1-CE2 3.81Å; V26-F30 WeakPolarHBondContact O-CD2 3.22Å; V26-F30 PolarHBondContact O-N 3.28Å; S27-F30 PolarHBondContact O-N 3.29Å; E28-F30 VanDerWaalsContact C-N 3.28Å; E28-F30 PolarHBondContact O-N 2.9Å; F30-K32 PolarHBondContact O-N 3.29Å
31	A	86.4	Confident	82.7	Confident	82 Å²	82	118 Å²	118	68%	0.678	61%	0.607	S	S	*	*	H	α-helix	trans	-63.8	-30.3	172.1	0	0	0	0	0	111.3	S27 E28 S33	S27-A31 WeakPolarHBondContact O-CB 3.26Å; S27-A31 PolarHBondContact O-N 3.43Å; E28-A31 PolarHBondContact O-N 3.21Å; A31-S33 PolarHBondContact O-N 3.09Å
32	K	81.2	Confident	81.6	Confident	144 Å²	144	117.4 Å²	117.4	63%	0.626	60%	0.604	S	S	*	*	S	Bend	trans	-77.7	102.2	174.6	-158.6	161.3	171.6	-177.8	0	109.5	E28 F30 F34	E28-K32 PolarHBondContact O-N 3.49Å; F30-K32 PolarHBondContact O-N 3.29Å; K32-F34 HydrophobicContact CB-CE2 4.06Å; K32-F34 HydrophobicContact CB-CZ 4.32Å; K32-F34 HydrophobicContact CD-CZ 4.12Å; K32-F34 HydrophobicContact CG-CE2 4.28Å; K32-F34 HydrophobicContact CG-CZ 4.11Å; K32-F34 WeakPolarHBondContact O-CD2 3.2Å; K32-F34 WeakPolarHBondContact O-CE2 3.41Å; K32-F34 PolarHBondContact O-N 3.45Å; K32-F34 VanDerWaalsContact O-N 3.1Å
33	S	73.7	Confident	80.6	Confident	109 Å²	109	121.9 Å²	121.9	76%	0.762	62%	0.621	S	S	*	*			trans	-67.8	110.2	175.5	61.1	0	0	0	0	110.1	A31	A31-S33 PolarHBondContact O-N 3.09Å
34	F	73.9	Confident	79.9	Confident	113 Å²	113	129.2 Å²	129.2	50%	0.496	64%	0.644	S	S	.	*			trans	-86.9	116.6	170.3	-65.4	-84.7	0	0	0	109.3	K32 Y36	K32-F34 HydrophobicContact CB-CE2 4.06Å; K32-F34 HydrophobicContact CB-CZ 4.32Å; K32-F34 HydrophobicContact CD-CZ 4.12Å; K32-F34 HydrophobicContact CG-CE2 4.28Å; K32-F34 HydrophobicContact CG-CZ 4.11Å; K32-F34 WeakPolarHBondContact O-CD2 3.2Å; K32-F34 WeakPolarHBondContact O-CE2 3.41Å; K32-F34 PolarHBondContact O-N 3.45Å; K32-F34 VanDerWaalsContact O-N 3.1Å; F34-Y36 HydrophobicContact CB-CE2 4.07Å; F34-Y36 WeakPolarHBondContact O-CD2 3.31Å; F34-Y36 PolarHBondContact O-N 3.23Å
35	S	77.5	Confident	79.2	Confident	111 Å²	111	131.6 Å²	131.6	78%	0.776	65%	0.652	S	S	*	*			trans	-75.7	93.7	165.9	-59.8	0	0	0	0	108.4	R37	S35-R37 PolarHBondContact O-N 3.06Å
36	Y	74.6	Confident	78.5	Confident	207 Å²	207	134.9 Å²	134.9	81%	0.812	67%	0.669	S	S	*	*			trans	-63.3	106.3	167.9	-63.3	-79.6	0	0	0	108.1	F34	F34-Y36 HydrophobicContact CB-CE2 4.07Å; F34-Y36 WeakPolarHBondContact O-CD2 3.31Å; F34-Y36 PolarHBondContact O-N 3.23Å
37	R	75.6	Confident	78.2	Confident	230 Å²	230	137.5 Å²	137.5	87%	0.868	69%	0.687	S	S	*	*	P	Polyproline II helix	trans	-73.5	136.5	168.2	-66.9	-162.8	-174.9	-173.6	2.9	107.8	S35 P39	S35-R37 PolarHBondContact O-N 3.06Å; R37-P39 WeakPolarHBondContact O-CD 3.29Å
38	K	75.6	Confident	77.8	Confident	185 Å²	185	137.8 Å²	137.8	80%	0.804	69%	0.694	S	S	*	*	P	Polyproline II helix	trans	-54.7	125.8	166.4	-172.5	-179.4	177.7	-175.8	0	107.2	L40	K38-L40 PolarHBondContact O-N 2.64Å
39	P	79.4	Confident	77.4	Confident	51 Å²	51	138.4 Å²	138.4	33%	0.331	71%	0.708	S	S	.	*	P	Polyproline II helix	trans	-57.3	137.4	175.4	5.1	-5.6	0	0	0	108.9	R37 D41 W44	R37-P39 WeakPolarHBondContact O-CD 3.29Å; P39-D41 PolarHBondContact O-N 2.93Å; P39-W44 HydrophobicContact CG-CB 4.05Å; P39-W44 HydrophobicContact CG-CG 3.9Å
40	L	75.3	Confident	77	Confident	163 Å²	163	139.8 Å²	139.8	85%	0.853	72%	0.722	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.4	-30.5	-168.2	-145.4	86.8	0	0	0	112.2	K38	K38-L40 PolarHBondContact O-N 2.64Å
41	D	70.4	Confident	76.2	Confident	122 Å²	122	144.1 Å²	144.1	65%	0.652	74%	0.744	S	S	*	*	T	Hydrogen-bonded Turn	trans	-135.8	46.4	-163.3	-87.5	-36.6	0	0	0	114.3	P39 E43	P39-D41 PolarHBondContact O-N 2.93Å; D41-E43 PolarHBondContact O-N 3.06Å
42	N	68.6	Low	75.7	Confident	105 Å²	105	147.3 Å²	147.3	56%	0.561	75%	0.748	S	S	*	*	S	Bend	trans	55.8	15.7	170.7	-72.3	-58.9	0	0	0	114.9	W44 Q45	N42-W44 PolarHBondContact O-N 3.08Å; N42-Q45 HydrophobicContact CB-CG 3.91Å; N42-Q45 VanDerWaalsContact O-CG 3.31Å; N42-Q45 WeakPolarHBondContact O-CG 3.38Å; N42-Q45 PolarHBondContact O-N 3.03Å; N42-Q45 PolarHBondContact OD1-NE2 2.93Å; N42-Q45 VanDerWaalsContact OD1-NE2 3.17Å
43	E	71.5	Confident	75.4	Confident	158 Å²	158	147.4 Å²	147.4	74%	0.738	75%	0.754	S	S	*	*			trans	-55.1	-30.1	179	-67.4	-177.8	136.8	0	0	111.4	D41 Q45	D41-E43 PolarHBondContact O-N 3.06Å; E43-Q45 PolarHBondContact O-N 3.05Å
44	W	75.3	Confident	75.5	Confident	217 Å²	217	149.6 Å²	149.6	82%	0.822	75%	0.754	S	S	*	*	S	Bend	trans	-100.6	66.9	175.2	-59.9	79.3	0	0	0	109.9	P39 N42	P39-W44 HydrophobicContact CG-CB 4.05Å; P39-W44 HydrophobicContact CG-CG 3.9Å; N42-W44 PolarHBondContact O-N 3.08Å
45	Q	75.3	Confident	75.6	Confident	134 Å²	134	151.7 Å²	151.7	63%	0.626	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-96.9	143.5	166.4	-84.3	-176.6	8.8	0	0	110.5	N42 E43	N42-Q45 HydrophobicContact CB-CG 3.91Å; N42-Q45 VanDerWaalsContact O-CG 3.31Å; N42-Q45 WeakPolarHBondContact O-CG 3.38Å; N42-Q45 PolarHBondContact O-N 3.03Å; N42-Q45 PolarHBondContact OD1-NE2 2.93Å; N42-Q45 VanDerWaalsContact OD1-NE2 3.17Å; E43-Q45 PolarHBondContact O-N 3.05Å
46	L	77.3	Confident	75.5	Confident	163 Å²	163	154.3 Å²	154.3	85%	0.853	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-66.1	142	165.5	-66.9	172.7	0	0	0	108.2	A48	L46-A48 PolarHBondContact O-N 2.89Å
47	P	81.7	Confident	75.5	Confident	118 Å²	118	150.7 Å²	150.7	77%	0.766	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-54.2	140.6	174.3	22.4	-32	0	0	0	109.7
48	A	79.4	Confident	75.5	Confident	82 Å²	82	145.1 Å²	145.1	68%	0.678	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-54.2	143.5	178.1	0	0	0	0	0	109.7	L46 T50	L46-A48 PolarHBondContact O-N 2.89Å; A48-T50 PolarHBondContact O-N 3.23Å; A48-T50 VanDerWaalsContact O-N 3.08Å
49	P	81.6	Confident	75.5	Confident	129 Å²	129	142 Å²	142	84%	0.838	76%	0.755	S	S	*	*	P	Polyproline II helix	trans	-57.1	120.3	172.3	-13.8	26.3	0	0	0	108	E51	P49-E51 PolarHBondContact O-N 3.18Å
50	T	78.6	Confident	75.2	Confident	140 Å²	140	149.6 Å²	149.6	86%	0.859	79%	0.79	S	S	*	*	P	Polyproline II helix	trans	-68.5	116.3	168	45.8	0	0	0	0	107.8	A48	A48-T50 PolarHBondContact O-N 3.23Å; A48-T50 VanDerWaalsContact O-N 3.08Å
51	E	67.6	Low	75.2	Confident	264 Å²	264	148.4 Å²	148.4	100%	1.234	78%	0.784	S	S	*	*			trans	-73.2	0	171	-169	171.3	-173.2	0	0	111.5	P49	P49-E51 PolarHBondContact O-N 3.18Å

Retrieved 51 of 51 residues in 9.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).