A0A087WPW2_MOUSE Loading...

Serum/glucocorticoid regulated kinase 3

AlphaFold DB , UniProt , Accession A0A087WPW2, Species MOUSE (Mus musculus, Mouse), Gene Sgk3, Length 68 aa.

						>A0A087WPW2_MOUSE|A0A087WPW2|Sgk3
MQRDCIMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSVRDYIVSV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.4	Very low	47.3	Very low	241 Å²	241	161.3 Å²	161.3	100%	1.187	77%	0.768	S	S	*	*				0	70	0	-67	-77	-176.6	0	0	107.9
2	Q	37.9	Very low	49.7	Very low	169 Å²	169	152.3 Å²	152.3	79%	0.79	74%	0.735	S	S	*	*			trans	-86.4	116.1	178.5	-164.1	149	-9	0	0	106.3	D4	Q2-D4 VanDerWaalsContact C-N 3.25Å; Q2-D4 PolarHBondContact O-N 3.42Å
3	R	46.4	Very low	52.5	Low	230 Å²	230	149.5 Å²	149.5	87%	0.868	74%	0.739	S	S	*	*			trans	-75.4	88.5	172.6	-67.5	-175.9	-176.9	104.4	-0.9	106.4	C5	R3-C5 PolarHBondContact O-N 3.5Å
4	D	41.3	Very low	55.4	Low	120 Å²	120	145.2 Å²	145.2	64%	0.642	73%	0.727	S	S	*	*			trans	-72.3	81.4	166	-64.4	-41.8	0	0	0	107.3	Q2 I6	Q2-D4 VanDerWaalsContact C-N 3.25Å; Q2-D4 PolarHBondContact O-N 3.42Å; D4-I6 HydrophobicContact CB-CG1 4.46Å; D4-I6 PolarHBondContact O-N 3.31Å
5	C	41.2	Very low	58	Low	99 Å²	99	140.2 Å²	140.2	67%	0.669	71%	0.712	S	S	*	*			trans	-68.7	81.8	159.6	-63.4	0	0	0	0	106.3	R3 M7	R3-C5 PolarHBondContact O-N 3.5Å; C5-M7 PolarHBondContact O-N 2.67Å
6	I	44.7	Very low	60.4	Low	143 Å²	143	137.4 Å²	137.4	73%	0.733	70%	0.703	S	S	*	*			trans	-59.4	96.3	163.9	-62.2	174.1	0	0	0	105.1	D4 D8	D4-I6 HydrophobicContact CB-CG1 4.46Å; D4-I6 PolarHBondContact O-N 3.31Å; I6-D8 PolarHBondContact O-N 3.07Å
7	M	51.8	Low	62.5	Low	151 Å²	151	132.8 Å²	132.8	74%	0.744	69%	0.686	S	S	*	*			trans	-61.7	107.6	164.1	-74.9	-72.5	164.3	0	0	105.1	C5 Y9	C5-M7 PolarHBondContact O-N 2.67Å; M7-Y9 PolarHBondContact O-N 3.44Å
8	D	44.8	Very low	64.4	Low	144 Å²	144	130.6 Å²	130.6	77%	0.77	68%	0.675	S	S	*	*			trans	-65.1	74.6	167.9	-132.2	-65.7	0	0	0	106.9	I6 K10	I6-D8 PolarHBondContact O-N 3.07Å; D8-K10 PolarHBondContact O-N 3.27Å
9	Y	54.3	Low	66	Low	172 Å²	172	127.9 Å²	127.9	68%	0.675	67%	0.666	S	S	*	*			trans	-78	43.5	-175.2	-149	-87.8	0	0	0	109.9	M7 E11	M7-Y9 PolarHBondContact O-N 3.44Å; Y9-E11 HydrophobicContact CD1-CG 3.83Å; Y9-E11 HydrophobicContact CE1-CG 3.45Å; Y9-E11 VanDerWaalsContact CE1-CG 3.45Å; Y9-E11 WeakPolarHBondContact CE1-OE1 3.39Å; Y9-E11 PolarHBondContact O-N 2.9Å; Y9-E11 VanDerWaalsContact O-N 3.11Å; Y9-E11 PolarHBondContact OH-OE1 3.34Å
10	K	57	Low	67.5	Low	174 Å²	174	124 Å²	124	76%	0.757	65%	0.65	S	S	*	*			trans	-76.6	79.7	147.3	-96	-166.4	174.6	-173.8	0	105.5	D8 S12	D8-K10 PolarHBondContact O-N 3.27Å; K10-S12 PolarHBondContact O-N 2.88Å; K10-S12 PolarHBondContact O-OG 3.43Å
11	E	61.6	Low	68.8	Low	131 Å²	131	121.2 Å²	121.2	61%	0.612	64%	0.641	S	S	*	*			trans	-48.4	100.5	157.2	-81	-178	164.2	0	0	105.8	Y9 C13	Y9-E11 HydrophobicContact CD1-CG 3.83Å; Y9-E11 HydrophobicContact CE1-CG 3.45Å; Y9-E11 VanDerWaalsContact CE1-CG 3.45Å; Y9-E11 WeakPolarHBondContact CE1-OE1 3.39Å; Y9-E11 PolarHBondContact O-N 2.9Å; Y9-E11 VanDerWaalsContact O-N 3.11Å; Y9-E11 PolarHBondContact OH-OE1 3.34Å; E11-C13 PolarHBondContact O-N 3.17Å
12	S	76	Confident	71.4	Confident	54 Å²	54	113.3 Å²	113.3	38%	0.378	60%	0.604	S	S	.	*			trans	-70.2	106.7	-174.7	-67	0	0	0	0	105.3	K10 P14 G41	K10-S12 PolarHBondContact O-N 2.88Å; K10-S12 PolarHBondContact O-OG 3.43Å; S12-P14 VanDerWaalsContact O-N 3.11Å; S12-G41 WeakPolarHBondContact OG-CA 3.23Å
13	C	85.9	Confident	74	Confident	115 Å²	115	111.2 Å²	111.2	78%	0.777	59%	0.594	S	S	*	*			trans	-48.5	123.3	179.4	-63.9	0	0	0	0	108.3	E11 S15	E11-C13 PolarHBondContact O-N 3.17Å; C13-S15 PolarHBondContact O-N 3.44Å
14	P	93.1	Very high	76.1	Confident	90 Å²	90	104.2 Å²	104.2	58%	0.584	57%	0.571	S	S	*	*			trans	-61.7	132.3	-177.4	24.9	-33.7	0	0	0	109.2	S12 S39 V40	S12-P14 VanDerWaalsContact O-N 3.11Å; P14-S39 WeakPolarHBondContact CA-O 3.29Å; P14-V40 HydrophobicContact CB-CG2 3.96Å
15	S	94.6	Very high	78.4	Confident	70 Å²	70	107.7 Å²	107.7	49%	0.49	58%	0.575	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-104.3	140	167.8	71.9	0	0	0	0	109.2	C13 S39	C13-S15 PolarHBondContact O-N 3.44Å; S15-S39 PolarHBondContact N-O 3.28Å; S15-S39 PolarHBondContact O-N 3.14Å; S15-S39 WeakPolarHBondContact OG-CB 3.26Å
16	V	95.8	Very high	80.3	Confident	95 Å²	95	108.7 Å²	108.7	58%	0.576	57%	0.57	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-135	134.8	-175	-179.7	0	0	0	0	109.2	V36 L37 V38	V16-V36 HydrophobicContact CG1-CG1 3.45Å; V16-V36 VanDerWaalsContact CG1-CG1 3.45Å; V16-L37 WeakPolarHBondContact CA-O 3.4Å; V16-V38 HydrophobicContact CG2-CG1 4.33Å; V16-V38 HydrophobicContact CG2-CG2 4.29Å
17	S	96.6	Very high	82.2	Confident	59 Å²	59	110.9 Å²	110.9	41%	0.413	57%	0.574	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-139.7	157.7	171.3	63.6	0	0	0	0	111.3	P19 L37	S17-P19 VanDerWaalsContact C-CD 3.45Å; S17-P19 VanDerWaalsContact O-CD 3.25Å; S17-P19 WeakPolarHBondContact O-CD 3.38Å; S17-L37 PolarHBondContact N-O 3.38Å; S17-L37 PolarHBondContact O-N 3.42Å
18	I	96.4	Very high	83.8	Confident	94 Å²	94	113.9 Å²	113.9	48%	0.482	58%	0.583	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-115.5	82.7	177.3	-52.6	179.1	0	0	0	107.8	S20 Y34 V36	I18-S20 VanDerWaalsContact C-N 3.31Å; I18-S20 PolarHBondContact O-N 3.1Å; I18-Y34 HydrophobicContact CG2-CD1 3.99Å; I18-Y34 HydrophobicContact CG2-CG 4.49Å; I18-V36 HydrophobicContact CG1-CG2 4.41Å
19	P	96.1	Very high	85.6	Confident	79 Å²	79	113.6 Å²	113.6	51%	0.513	58%	0.575	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-67	-27.7	-176.6	24.4	-37.3	0	0	0	114.1	S17 K35 L37	S17-P19 VanDerWaalsContact C-CD 3.45Å; S17-P19 VanDerWaalsContact O-CD 3.25Å; S17-P19 WeakPolarHBondContact O-CD 3.38Å; P19-K35 WeakPolarHBondContact CD-O 3.48Å; P19-L37 HydrophobicContact CG-CB 4.42Å
20	S	95.4	Very high	87.3	Confident	50 Å²	50	113.6 Å²	113.6	35%	0.35	57%	0.574	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-157.7	168.8	-178	69.6	0	0	0	0	113.2	I18 K35	I18-S20 VanDerWaalsContact C-N 3.31Å; I18-S20 PolarHBondContact O-N 3.1Å; S20-K35 PolarHBondContact O-N 3.42Å
21	S	95.1	Very high	89	Confident	65 Å²	65	107.9 Å²	107.9	46%	0.455	55%	0.549	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.1	142.4	170.4	62	0	0	0	0	110.5	V33	S21-V33 CarbonylContact C-O 3.52Å; S21-V33 VanDerWaalsContact CA-O 3.3Å; S21-V33 WeakPolarHBondContact CA-O 3.21Å
22	D	94.3	Very high	90.5	Very high	76 Å²	76	104.4 Å²	104.4	41%	0.406	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.4	128.7	-177	-64.1	-79.9	0	0	0	110.4	H24 V33	D22-H24 PolarHBondContact O-N 2.89Å; D22-H24 PolarHBondContact O-ND1 2.96Å; D22-V33 PolarHBondContact N-O 2.82Å; D22-V33 PolarHBondContact O-N 3.29Å
23	E	92.8	Very high	91.5	Very high	124 Å²	124	102.5 Å²	102.5	58%	0.579	52%	0.523	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77.5	115	171.7	-172	-178.6	109.3	0	0	109.5
24	H	90.4	Very high	92.1	Very high	83 Å²	83	100.3 Å²	100.3	38%	0.384	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.9	128.6	172	-72.8	75.9	0	0	0	109.9	D22 R30 F31 V33	D22-H24 PolarHBondContact O-N 2.89Å; D22-H24 PolarHBondContact O-ND1 2.96Å; H24-R30 WeakPolarHBondContact O-CA 3.34Å; H24-F31 HydrophobicContact CB-CD1 4.44Å; H24-F31 HydrophobicContact CB-CD2 3.73Å; H24-F31 HydrophobicContact CB-CE1 4.09Å; H24-F31 HydrophobicContact CB-CE2 3.31Å; H24-F31 HydrophobicContact CB-CG 4.28Å; H24-F31 HydrophobicContact CB-CZ 3.52Å; H24-F31 AromaticContact CG-CE2 3.88Å; H24-F31 PolarHBondContact N-O 2.97Å; H24-F31 PolarHBondContact O-N 3.48Å; H24-V33 HydrophobicContact CB-CG2 4.39Å; H24-V33 WeakPolarHBondContact ND1-CG2 3.35Å
25	R	87.9	Confident	92.2	Very high	193 Å²	193	98.9 Å²	98.9	73%	0.728	48%	0.483	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.3	116.6	178.3	-169.9	171.9	178.8	-179.9	0	109.7	R30	R25-R30 HydrophobicContact CG-CG 4.22Å
26	E	82.6	Confident	92.4	Very high	121 Å²	121	96 Å²	96	57%	0.565	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119.3	108.2	173.7	-165.8	-177.3	178.3	0	0	109.1	K28 K29 F31	E26-K28 PolarHBondContact O-N 2.82Å; E26-K29 PolarHBondContact N-O 2.93Å; E26-K29 PolarHBondContact O-N 3.28Å; E26-F31 HydrophobicContact CB-CE1 4.14Å
27	K	84.3	Confident	92.5	Very high	189 Å²	189	93.4 Å²	93.4	82%	0.822	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	53	-110.6	-177.5	-56.4	175.3	-177.3	174.6	0	111.8
28	K	85.1	Confident	92.5	Very high	214 Å²	214	91.7 Å²	91.7	93%	0.93	43%	0.432	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.8	-5.6	177.8	-84.7	-176	175.1	-179.7	0	113.8	E26	E26-K28 PolarHBondContact O-N 2.82Å
29	K	83.6	Confident	92.4	Very high	138 Å²	138	87.8 Å²	87.8	60%	0.6	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104	135.1	-176.7	-158.1	171.7	-175.8	173.8	0	110.3	E26	E26-K29 PolarHBondContact N-O 2.93Å; E26-K29 PolarHBondContact O-N 3.28Å
30	R	89.2	Confident	92.3	Very high	171 Å²	171	86.7 Å²	86.7	65%	0.645	41%	0.405	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.3	138.2	171.5	-64	-177.5	-65.3	165.8	0.6	108.4	H24 R25	H24-R30 WeakPolarHBondContact O-CA 3.34Å; R25-R30 HydrophobicContact CG-CG 4.22Å
31	F	91.9	Very high	92	Very high	54 Å²	54	86.5 Å²	86.5	24%	0.237	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.4	139.4	172.1	55	-87.8	0	0	0	110.3	H24 E26 V33 R50	H24-F31 HydrophobicContact CB-CD1 4.44Å; H24-F31 HydrophobicContact CB-CD2 3.73Å; H24-F31 HydrophobicContact CB-CE1 4.09Å; H24-F31 HydrophobicContact CB-CE2 3.31Å; H24-F31 HydrophobicContact CB-CG 4.28Å; H24-F31 HydrophobicContact CB-CZ 3.52Å; H24-F31 AromaticContact CG-CE2 3.88Å; H24-F31 PolarHBondContact N-O 2.97Å; H24-F31 PolarHBondContact O-N 3.48Å; E26-F31 HydrophobicContact CB-CE1 4.14Å; F31-V33 HydrophobicContact CD2-CG2 3.62Å; F31-V33 HydrophobicContact CE2-CG2 3.68Å; F31-R50 HydrophobicContact CD2-CG 4.17Å
32	T	94.7	Very high	91.8	Very high	59 Å²	59	95.5 Å²	95.5	36%	0.362	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	131.2	173.5	-52.3	0	0	0	0	109.3	Y34	T32-Y34 HydrophobicContact CG2-CE1 4.35Å; T32-Y34 HydrophobicContact CG2-CE2 4.27Å
33	V	96.5	Very high	91.7	Very high	13 Å²	13	95.4 Å²	95.4	8%	0.079	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	123.4	173	-179.2	0	0	0	0	107.9	S21 D22 H24 F31 F48 R50	S21-V33 CarbonylContact C-O 3.52Å; S21-V33 VanDerWaalsContact CA-O 3.3Å; S21-V33 WeakPolarHBondContact CA-O 3.21Å; D22-V33 PolarHBondContact N-O 2.82Å; D22-V33 PolarHBondContact O-N 3.29Å; H24-V33 HydrophobicContact CB-CG2 4.39Å; H24-V33 WeakPolarHBondContact ND1-CG2 3.35Å; F31-V33 HydrophobicContact CD2-CG2 3.62Å; F31-V33 HydrophobicContact CE2-CG2 3.68Å; V33-F48 HydrophobicContact CG1-CB 3.72Å; V33-F48 HydrophobicContact CG1-CD1 4.05Å; V33-F48 HydrophobicContact CG1-CG 4.38Å; V33-R50 HydrophobicContact CG2-CG 4.27Å
34	Y	97.3	Very high	91.9	Very high	70 Å²	70	95.7 Å²	95.7	28%	0.275	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.4	131.5	175.8	-62.4	-84.3	0	0	0	109.4	I18 T32 F48 R49 F54	I18-Y34 HydrophobicContact CG2-CD1 3.99Å; I18-Y34 HydrophobicContact CG2-CG 4.49Å; T32-Y34 HydrophobicContact CG2-CE1 4.35Å; T32-Y34 HydrophobicContact CG2-CE2 4.27Å; Y34-F48 WeakPolarHBondContact O-CA 3.44Å; Y34-R49 PolarHBondContact N-O 3.01Å; Y34-R49 PolarHBondContact O-N 3.04Å; Y34-R49 VanDerWaalsContact O-N 3.14Å; Y34-F54 HydrophobicContact CD2-CE2 4.03Å; Y34-F54 HydrophobicContact CG-CE2 4.37Å
35	K	96.9	Very high	92.3	Very high	60 Å²	60	97.5 Å²	97.5	26%	0.261	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	103.9	173.2	-176.1	177.6	179.8	-176.6	0	107.7	P19 S20 F46 F48	P19-K35 WeakPolarHBondContact CD-O 3.48Å; S20-K35 PolarHBondContact O-N 3.42Å; K35-F46 HydrophobicContact CD-CD1 4.09Å; K35-F46 HydrophobicContact CD-CE1 4.2Å; K35-F46 VanDerWaalsContact CE-CZ 3.45Å; K35-F46 HydrophobicContact CG-CD1 3.63Å; K35-F46 HydrophobicContact CG-CE1 4.13Å; K35-F46 HydrophobicContact CG-CG 4.2Å; K35-F48 HydrophobicContact CB-CD1 4.48Å; K35-F48 HydrophobicContact CB-CE1 4.23Å; K35-F48 HydrophobicContact CD-CE1 4.31Å; K35-F48 HydrophobicContact CG-CE1 3.95Å; K35-F48 HydrophobicContact CG-CZ 4.44Å
36	V	97.4	Very high	92.7	Very high	10 Å²	10	93 Å²	93	6%	0.061	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	122.3	-178.5	-173.3	0	0	0	0	108.7	V16 I18 V38 F46 V47 F54	V16-V36 HydrophobicContact CG1-CG1 3.45Å; V16-V36 VanDerWaalsContact CG1-CG1 3.45Å; I18-V36 HydrophobicContact CG1-CG2 4.41Å; V36-V38 HydrophobicContact CG1-CG2 3.98Å; V36-F46 CarbonylContact O-C 3.57Å; V36-F46 WeakPolarHBondContact O-CA 3.5Å; V36-V47 HydrophobicContact CB-CB 4.38Å; V36-V47 WeakPolarHBondContact CB-O 3.47Å; V36-V47 PolarHBondContact N-O 2.83Å; V36-V47 PolarHBondContact O-N 3.18Å; V36-F54 HydrophobicContact CG2-CZ 3.77Å
37	L	97.4	Very high	93.4	Very high	39 Å²	39	89 Å²	89	20%	0.204	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	122.4	169	179.7	61.6	0	0	0	108.4	V16 S17 P19 E44 F46	V16-L37 WeakPolarHBondContact CA-O 3.4Å; S17-L37 PolarHBondContact N-O 3.38Å; S17-L37 PolarHBondContact O-N 3.42Å; P19-L37 HydrophobicContact CG-CB 4.42Å; L37-E44 HydrophobicContact CD1-CB 4.22Å; L37-F46 HydrophobicContact CB-CD1 4.28Å; L37-F46 HydrophobicContact CB-CE1 3.97Å; L37-F46 HydrophobicContact CD1-CD1 4.17Å; L37-F46 HydrophobicContact CD1-CE1 3.76Å; L37-F46 HydrophobicContact CD1-CZ 4.17Å; L37-F46 HydrophobicContact CG-CE1 4.37Å
38	V	96.9	Very high	94	Very high	23 Å²	23	85.6 Å²	85.6	14%	0.139	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	123.9	175.6	-177.7	0	0	0	0	108	V16 V36 V40 E44 W45 V47	V16-V38 HydrophobicContact CG2-CG1 4.33Å; V16-V38 HydrophobicContact CG2-CG2 4.29Å; V36-V38 HydrophobicContact CG1-CG2 3.98Å; V38-V40 HydrophobicContact CG1-CG2 4.11Å; V38-E44 VanDerWaalsContact O-CA 3.3Å; V38-E44 WeakPolarHBondContact O-CA 3.5Å; V38-W45 HydrophobicContact CB-CZ2 4.35Å; V38-W45 HydrophobicContact CG1-CH2 4.38Å; V38-W45 HydrophobicContact CG1-CZ2 3.83Å; V38-W45 PolarHBondContact N-O 3.17Å; V38-W45 PolarHBondContact O-N 3.46Å; V38-V47 HydrophobicContact CG2-CG2 4.1Å
39	S	95.3	Very high	94.6	Very high	12 Å²	12	80.8 Å²	80.8	8%	0.084	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	123	177	-51	0	0	0	0	109.4	P14 S15 S43 E44	P14-S39 WeakPolarHBondContact CA-O 3.29Å; S15-S39 PolarHBondContact N-O 3.28Å; S15-S39 PolarHBondContact O-N 3.14Å; S15-S39 WeakPolarHBondContact OG-CB 3.26Å; S39-S43 WeakPolarHBondContact CA-O 3.45Å; S39-E44 WeakPolarHBondContact CB-OE1 3.42Å; S39-E44 WeakPolarHBondContact OG-CG 3.36Å; S39-E44 PolarHBondContact OG-OE1 3.12Å
40	V	94.1	Very high	95.2	Very high	56 Å²	56	79.3 Å²	79.3	34%	0.339	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.1	104.6	176.3	-173.1	0	0	0	0	107.9	P14 V38 R42 S43 W45	P14-V40 HydrophobicContact CB-CG2 3.96Å; V38-V40 HydrophobicContact CG1-CG2 4.11Å; V40-R42 PolarHBondContact O-N 3.22Å; V40-R42 VanDerWaalsContact O-N 3.08Å; V40-S43 PolarHBondContact N-O 2.96Å; V40-S43 PolarHBondContact O-N 3Å; V40-W45 HydrophobicContact CB-CH2 3.97Å; V40-W45 HydrophobicContact CB-CZ3 4.3Å; V40-W45 HydrophobicContact CG2-CH2 3.55Å; V40-W45 HydrophobicContact CG2-CZ2 4.25Å; V40-W45 HydrophobicContact CG2-CZ3 4.26Å
41	G	89.1	Confident	95.5	Very high	47 Å²	47	78.7 Å²	78.7	49%	0.485	37%	0.366	S	S	.	.	T	Hydrogen-bonded Turn	trans	63.9	-108.8	-176.3	0	0	0	0	0	111.6	S12	S12-G41 WeakPolarHBondContact OG-CA 3.23Å
42	R	90.6	Very high	95.6	Very high	254 Å²	254	79 Å²	79	96%	0.958	38%	0.378	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.9	-0.8	178.7	-61.5	-177.1	-176	179.1	2.1	113.5	V40	V40-R42 PolarHBondContact O-N 3.22Å; V40-R42 VanDerWaalsContact O-N 3.08Å
43	S	93	Very high	95.7	Very high	73 Å²	73	79.2 Å²	79.2	51%	0.51	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	129	-176.9	-63.4	0	0	0	0	109.6	S39 V40	S39-S43 WeakPolarHBondContact CA-O 3.45Å; V40-S43 PolarHBondContact N-O 2.96Å; V40-S43 PolarHBondContact O-N 3Å
44	E	96.6	Very high	95.7	Very high	130 Å²	130	81.9 Å²	81.9	61%	0.607	39%	0.386	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-129.4	139.1	177.3	-53.2	-164.3	139.2	0	0	110.1	L37 V38 S39	L37-E44 HydrophobicContact CD1-CB 4.22Å; V38-E44 VanDerWaalsContact O-CA 3.3Å; V38-E44 WeakPolarHBondContact O-CA 3.5Å; S39-E44 WeakPolarHBondContact CB-OE1 3.42Å; S39-E44 WeakPolarHBondContact OG-CG 3.36Å; S39-E44 PolarHBondContact OG-OE1 3.12Å
45	W	97.8	Very high	95.6	Very high	121 Å²	121	82 Å²	82	46%	0.458	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.3	159.6	176.3	59.5	92.9	0	0	0	111.8	V38 V40	V38-W45 HydrophobicContact CB-CZ2 4.35Å; V38-W45 HydrophobicContact CG1-CH2 4.38Å; V38-W45 HydrophobicContact CG1-CZ2 3.83Å; V38-W45 PolarHBondContact N-O 3.17Å; V38-W45 PolarHBondContact O-N 3.46Å; V40-W45 HydrophobicContact CB-CH2 3.97Å; V40-W45 HydrophobicContact CB-CZ3 4.3Å; V40-W45 HydrophobicContact CG2-CH2 3.55Å; V40-W45 HydrophobicContact CG2-CZ2 4.25Å; V40-W45 HydrophobicContact CG2-CZ3 4.26Å
46	F	97.6	Very high	95.6	Very high	99 Å²	99	86.9 Å²	86.9	43%	0.434	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	136.7	174.2	-67.2	-64.3	0	0	0	111.4	K35 V36 L37 F48	K35-F46 HydrophobicContact CD-CD1 4.09Å; K35-F46 HydrophobicContact CD-CE1 4.2Å; K35-F46 VanDerWaalsContact CE-CZ 3.45Å; K35-F46 HydrophobicContact CG-CD1 3.63Å; K35-F46 HydrophobicContact CG-CE1 4.13Å; K35-F46 HydrophobicContact CG-CG 4.2Å; V36-F46 CarbonylContact O-C 3.57Å; V36-F46 WeakPolarHBondContact O-CA 3.5Å; L37-F46 HydrophobicContact CB-CD1 4.28Å; L37-F46 HydrophobicContact CB-CE1 3.97Å; L37-F46 HydrophobicContact CD1-CD1 4.17Å; L37-F46 HydrophobicContact CD1-CE1 3.76Å; L37-F46 HydrophobicContact CD1-CZ 4.17Å; L37-F46 HydrophobicContact CG-CE1 4.37Å; F46-F48 HydrophobicContact CB-CE2 4.09Å; F46-F48 HydrophobicContact CB-CZ 4.24Å
47	V	97	Very high	95.5	Very high	38 Å²	38	91.4 Å²	91.4	23%	0.23	44%	0.436	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	131.8	168.2	-170.2	0	0	0	0	108.2	V36 V38 R49	V36-V47 HydrophobicContact CB-CB 4.38Å; V36-V47 WeakPolarHBondContact CB-O 3.47Å; V36-V47 PolarHBondContact N-O 2.83Å; V36-V47 PolarHBondContact O-N 3.18Å; V38-V47 HydrophobicContact CG2-CG2 4.1Å; V47-R49 HydrophobicContact CG1-CG 3.9Å
48	F	96.1	Very high	95.4	Very high	117 Å²	117	96.4 Å²	96.4	51%	0.513	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	118.4	178.6	-63.4	-84.5	0	0	0	109.1	V33 Y34 K35 F46	V33-F48 HydrophobicContact CG1-CB 3.72Å; V33-F48 HydrophobicContact CG1-CD1 4.05Å; V33-F48 HydrophobicContact CG1-CG 4.38Å; Y34-F48 WeakPolarHBondContact O-CA 3.44Å; K35-F48 HydrophobicContact CB-CD1 4.48Å; K35-F48 HydrophobicContact CB-CE1 4.23Å; K35-F48 HydrophobicContact CD-CE1 4.31Å; K35-F48 HydrophobicContact CG-CE1 3.95Å; K35-F48 HydrophobicContact CG-CZ 4.44Å; F46-F48 HydrophobicContact CB-CE2 4.09Å; F46-F48 HydrophobicContact CB-CZ 4.24Å
49	R	97	Very high	95.3	Very high	113 Å²	113	98 Å²	98	43%	0.426	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.2	147	-177.3	-65.4	-64.1	-179	-178.2	-1.8	111.9	Y34 V47 E53 F54	Y34-R49 PolarHBondContact N-O 3.01Å; Y34-R49 PolarHBondContact O-N 3.04Å; Y34-R49 VanDerWaalsContact O-N 3.14Å; V47-R49 HydrophobicContact CG1-CG 3.9Å; R49-E53 WeakPolarHBondContact CA-OE2 3.3Å; R49-E53 VanDerWaalsContact CD-OE1 3.23Å; R49-E53 WeakPolarHBondContact CD-OE1 3.43Å; R49-E53 IonicContact CZ-OE1 3.66Å; R49-E53 IonicContact NE-OE1 3.86Å; R49-E53 IonicContact NH1-OE1 2.71Å; R49-E53 PolarHBondContact NH1-OE1 2.9Å; R49-F54 HydrophobicContact CB-CD2 4.43Å; R49-F54 HydrophobicContact CB-CE2 3.7Å; R49-F54 HydrophobicContact CB-CZ 3.76Å; R49-F54 HydrophobicContact CG-CZ 4.33Å
50	R	96.3	Very high	95.3	Very high	106 Å²	106	101 Å²	101	40%	0.4	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	160.5	169.1	-62.7	179.7	-61.3	163.9	3.5	110.7	F31 V33 A52 E53 F54	F31-R50 HydrophobicContact CD2-CG 4.17Å; V33-R50 HydrophobicContact CG2-CG 4.27Å; R50-A52 VanDerWaalsContact C-N 3.28Å; R50-A52 PolarHBondContact O-N 2.82Å; R50-E53 PolarHBondContact N-OE2 2.71Å; R50-E53 WeakPolarHBondContact O-CB 3.46Å; R50-E53 PolarHBondContact O-N 2.82Å; R50-F54 WeakPolarHBondContact O-CD2 3.18Å
51	Y	95.2	Very high	95.3	Very high	158 Å²	158	101.7 Å²	101.7	62%	0.62	49%	0.486	S	S	*	.	H	α-helix	trans	-52.1	-43.5	177.3	-176.2	-97.3	0	0	0	113.5	E53 F54 D55	Y51-E53 PolarHBondContact O-N 3.13Å; Y51-E53 VanDerWaalsContact O-N 3.13Å; Y51-F54 WeakPolarHBondContact O-CB 3.24Å; Y51-F54 PolarHBondContact O-N 2.89Å; Y51-D55 HydrophobicContact CE1-CB 4.28Å; Y51-D55 PolarHBondContact O-N 2.87Å
52	A	95.9	Very high	95.5	Very high	60 Å²	60	105.7 Å²	105.7	50%	0.496	49%	0.486	S	S	.	.	H	α-helix	trans	-60.6	-25	-179.7	0	0	0	0	0	113.8	R50 K56	R50-A52 VanDerWaalsContact C-N 3.28Å; R50-A52 PolarHBondContact O-N 2.82Å; A52-K56 WeakPolarHBondContact O-CB 3.45Å; A52-K56 PolarHBondContact O-N 2.8Å; A52-K56 VanDerWaalsContact O-N 3.12Å
53	E	96	Very high	95.6	Very high	65 Å²	65	98.1 Å²	98.1	30%	0.304	47%	0.465	S	S	.	.	H	α-helix	trans	-75	-36.9	175.7	-62.1	178	86.7	0	0	111.3	R49 R50 Y51 L57	R49-E53 WeakPolarHBondContact CA-OE2 3.3Å; R49-E53 VanDerWaalsContact CD-OE1 3.23Å; R49-E53 WeakPolarHBondContact CD-OE1 3.43Å; R49-E53 IonicContact CZ-OE1 3.66Å; R49-E53 IonicContact NE-OE1 3.86Å; R49-E53 IonicContact NH1-OE1 2.71Å; R49-E53 PolarHBondContact NH1-OE1 2.9Å; R50-E53 PolarHBondContact N-OE2 2.71Å; R50-E53 WeakPolarHBondContact O-CB 3.46Å; R50-E53 PolarHBondContact O-N 2.82Å; Y51-E53 PolarHBondContact O-N 3.13Å; Y51-E53 VanDerWaalsContact O-N 3.13Å; E53-L57 PolarHBondContact O-N 2.81Å
54	F	96	Very high	95.5	Very high	69 Å²	69	102.6 Å²	102.6	30%	0.303	47%	0.472	S	S	.	.	H	α-helix	trans	-68.2	-41.4	172.2	-65.3	-69	0	0	0	111.9	Y34 V36 R49 R50 Y51 K56 L57 Y58	Y34-F54 HydrophobicContact CD2-CE2 4.03Å; Y34-F54 HydrophobicContact CG-CE2 4.37Å; V36-F54 HydrophobicContact CG2-CZ 3.77Å; R49-F54 HydrophobicContact CB-CD2 4.43Å; R49-F54 HydrophobicContact CB-CE2 3.7Å; R49-F54 HydrophobicContact CB-CZ 3.76Å; R49-F54 HydrophobicContact CG-CZ 4.33Å; R50-F54 WeakPolarHBondContact O-CD2 3.18Å; Y51-F54 WeakPolarHBondContact O-CB 3.24Å; Y51-F54 PolarHBondContact O-N 2.89Å; F54-K56 VanDerWaalsContact C-N 3.34Å; F54-K56 PolarHBondContact O-N 3.14Å; F54-L57 WeakPolarHBondContact O-CB 3.37Å; F54-L57 PolarHBondContact O-N 2.88Å; F54-Y58 WeakPolarHBondContact O-CB 3.25Å; F54-Y58 PolarHBondContact O-N 3.38Å
55	D	95.8	Very high	95.2	Very high	71 Å²	71	101.6 Å²	101.6	38%	0.38	47%	0.47	S	S	.	.	H	α-helix	trans	-60.7	-43.2	176.8	-179.7	53.5	0	0	0	111.6	Y51 L57 Y58 N59	Y51-D55 HydrophobicContact CE1-CB 4.28Å; Y51-D55 PolarHBondContact O-N 2.87Å; D55-L57 VanDerWaalsContact C-N 3.34Å; D55-L57 PolarHBondContact O-N 3.35Å; D55-Y58 PolarHBondContact O-N 2.56Å; D55-N59 PolarHBondContact O-N 2.9Å; D55-N59 PolarHBondContact O-ND2 3.02Å; D55-N59 PolarHBondContact OD1-ND2 2.87Å; D55-N59 VanDerWaalsContact OD1-ND2 3.1Å
56	K	96.3	Very high	94.7	Very high	164 Å²	164	101.1 Å²	101.1	71%	0.713	48%	0.48	S	S	*	.	H	α-helix	trans	-59.8	-43.6	173.9	-173.8	178.9	179.4	-177.9	0	112.2	A52 F54 S60	A52-K56 WeakPolarHBondContact O-CB 3.45Å; A52-K56 PolarHBondContact O-N 2.8Å; A52-K56 VanDerWaalsContact O-N 3.12Å; F54-K56 VanDerWaalsContact C-N 3.34Å; F54-K56 PolarHBondContact O-N 3.14Å; K56-S60 PolarHBondContact O-N 2.96Å; K56-S60 VanDerWaalsContact O-N 3.14Å
57	L	95.8	Very high	93.9	Very high	105 Å²	105	101.4 Å²	101.4	55%	0.55	49%	0.494	S	S	.	.	H	α-helix	trans	-63.7	-45.9	176.9	177.9	64.1	0	0	0	111.2	E53 F54 D55 N59 S60 V61	E53-L57 PolarHBondContact O-N 2.81Å; F54-L57 WeakPolarHBondContact O-CB 3.37Å; F54-L57 PolarHBondContact O-N 2.88Å; D55-L57 VanDerWaalsContact C-N 3.34Å; D55-L57 PolarHBondContact O-N 3.35Å; L57-N59 PolarHBondContact O-N 2.86Å; L57-S60 PolarHBondContact O-N 3.11Å; L57-V61 HydrophobicContact CD1-CG2 4.03Å; L57-V61 HydrophobicContact CG-CG2 4.38Å; L57-V61 WeakPolarHBondContact O-CG2 3.32Å; L57-V61 PolarHBondContact O-N 2.88Å
58	Y	94.7	Very high	92.3	Very high	144 Å²	144	107.1 Å²	107.1	57%	0.565	53%	0.528	S	S	*	.	H	α-helix	trans	-58	-49.7	179.3	173.3	-97.4	0	0	0	111.5	F54 D55 S60 V61 R62	F54-Y58 WeakPolarHBondContact O-CB 3.25Å; F54-Y58 PolarHBondContact O-N 3.38Å; D55-Y58 PolarHBondContact O-N 2.56Å; Y58-S60 VanDerWaalsContact C-N 3.34Å; Y58-S60 PolarHBondContact O-N 2.92Å; Y58-V61 PolarHBondContact O-N 2.74Å; Y58-R62 WeakPolarHBondContact O-CB 3.2Å; Y58-R62 PolarHBondContact O-N 3.33Å
59	N	95.6	Very high	92.1	Very high	55 Å²	55	106.6 Å²	106.6	29%	0.294	53%	0.529	S	S	.	.	H	α-helix	trans	-61.9	-43.2	179.3	-70.9	-55.9	0	0	0	111.3	D55 L57 V61 R62 D63	D55-N59 PolarHBondContact O-N 2.9Å; D55-N59 PolarHBondContact O-ND2 3.02Å; D55-N59 PolarHBondContact OD1-ND2 2.87Å; D55-N59 VanDerWaalsContact OD1-ND2 3.1Å; L57-N59 PolarHBondContact O-N 2.86Å; N59-V61 PolarHBondContact O-N 3.01Å; N59-R62 PolarHBondContact O-N 3.42Å; N59-D63 WeakPolarHBondContact O-CB 3.43Å; N59-D63 PolarHBondContact O-N 2.72Å
60	S	95.1	Very high	91.9	Very high	77 Å²	77	106.3 Å²	106.3	54%	0.538	54%	0.535	S	S	.	.	H	α-helix	trans	-61.6	-41.5	176.2	-175.8	0	0	0	0	113.5	K56 L57 Y58 Y64	K56-S60 PolarHBondContact O-N 2.96Å; K56-S60 VanDerWaalsContact O-N 3.14Å; L57-S60 PolarHBondContact O-N 3.11Å; Y58-S60 VanDerWaalsContact C-N 3.34Å; Y58-S60 PolarHBondContact O-N 2.92Å; S60-Y64 PolarHBondContact O-N 3.03Å; S60-Y64 VanDerWaalsContact O-N 3.17Å
61	V	93.6	Very high	91.6	Very high	69 Å²	69	106.3 Å²	106.3	42%	0.418	54%	0.542	S	S	.	.	H	α-helix	trans	-72.2	-41.4	179.3	171.7	0	0	0	0	110.7	L57 Y58 N59 Y64 I65	L57-V61 HydrophobicContact CD1-CG2 4.03Å; L57-V61 HydrophobicContact CG-CG2 4.38Å; L57-V61 WeakPolarHBondContact O-CG2 3.32Å; L57-V61 PolarHBondContact O-N 2.88Å; Y58-V61 PolarHBondContact O-N 2.74Å; N59-V61 PolarHBondContact O-N 3.01Å; V61-Y64 PolarHBondContact O-N 3.27Å; V61-I65 HydrophobicContact CG1-CD1 3.74Å; V61-I65 HydrophobicContact CG1-CG1 4.41Å; V61-I65 WeakPolarHBondContact O-CG1 3.36Å; V61-I65 PolarHBondContact O-N 3.06Å
62	R	94	Very high	91.4	Very high	131 Å²	131	103.2 Å²	103.2	49%	0.494	54%	0.538	S	S	.	.	H	α-helix	trans	-58.4	-48.9	175.2	178.5	-174.8	176.3	-154	-2.7	110.8	Y58 N59 Y64 I65 V66	Y58-R62 WeakPolarHBondContact O-CB 3.2Å; Y58-R62 PolarHBondContact O-N 3.33Å; N59-R62 PolarHBondContact O-N 3.42Å; R62-Y64 VanDerWaalsContact C-N 3.3Å; R62-Y64 PolarHBondContact O-N 2.91Å; R62-I65 PolarHBondContact O-N 2.83Å; R62-V66 HydrophobicContact CG-CG2 4.27Å; R62-V66 WeakPolarHBondContact O-CB 3.44Å; R62-V66 VanDerWaalsContact O-CG2 3.26Å; R62-V66 WeakPolarHBondContact O-CG2 3.34Å; R62-V66 PolarHBondContact O-N 2.85Å
63	D	92.2	Very high	91.1	Very high	95 Å²	95	105.9 Å²	105.9	51%	0.508	54%	0.54	S	S	.	.	H	α-helix	trans	-62.3	-40.9	-179.4	-68.3	-15.2	0	0	0	111.1	N59 S67	N59-D63 WeakPolarHBondContact O-CB 3.43Å; N59-D63 PolarHBondContact O-N 2.72Å; D63-S67 VanDerWaalsContact O-CB 3.29Å; D63-S67 WeakPolarHBondContact O-CB 3.34Å; D63-S67 PolarHBondContact O-N 2.63Å; D63-S67 PolarHBondContact O-OG 3.03Å
64	Y	91.5	Very high	90.8	Very high	168 Å²	168	108.7 Å²	108.7	66%	0.659	56%	0.556	S	S	*	*	H	α-helix	trans	-60.6	-49.7	174.6	178	-96	0	0	0	112	S60 V61 R62 S67 V68	S60-Y64 PolarHBondContact O-N 3.03Å; S60-Y64 VanDerWaalsContact O-N 3.17Å; V61-Y64 PolarHBondContact O-N 3.27Å; R62-Y64 VanDerWaalsContact C-N 3.3Å; R62-Y64 PolarHBondContact O-N 2.91Å; Y64-S67 PolarHBondContact O-N 3.08Å; Y64-V68 HydrophobicContact CE1-CG2 4.46Å; Y64-V68 WeakPolarHBondContact O-CG2 3.3Å; Y64-V68 PolarHBondContact O-N 2.91Å
65	I	90.6	Very high	90.4	Very high	109 Å²	109	111.5 Å²	111.5	56%	0.559	57%	0.574	S	S	*	*	H	α-helix	trans	-66.3	-40.1	-178.1	-67.7	170.1	0	0	0	111.5	V61 R62 S67 V68	V61-I65 HydrophobicContact CG1-CD1 3.74Å; V61-I65 HydrophobicContact CG1-CG1 4.41Å; V61-I65 WeakPolarHBondContact O-CG1 3.36Å; V61-I65 PolarHBondContact O-N 3.06Å; R62-I65 PolarHBondContact O-N 2.83Å; I65-S67 VanDerWaalsContact C-N 3.26Å; I65-S67 PolarHBondContact O-N 3.04Å; I65-V68 PolarHBondContact O-N 2.89Å
66	V	87.3	Confident	90	Very high	111 Å²	111	114.6 Å²	114.6	67%	0.673	59%	0.589	S	S	*	*	H	α-helix	trans	-71.5	-22.8	179.9	172.6	0	0	0	0	112.2	R62	R62-V66 HydrophobicContact CG-CG2 4.27Å; R62-V66 WeakPolarHBondContact O-CB 3.44Å; R62-V66 VanDerWaalsContact O-CG2 3.26Å; R62-V66 WeakPolarHBondContact O-CG2 3.34Å; R62-V66 PolarHBondContact O-N 2.85Å
67	S	79.3	Confident	89.5	Confident	104 Å²	104	110.5 Å²	110.5	73%	0.727	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.1	-6.7	178.4	-56.9	0	0	0	0	114.1	D63 Y64 I65	D63-S67 VanDerWaalsContact O-CB 3.29Å; D63-S67 WeakPolarHBondContact O-CB 3.34Å; D63-S67 PolarHBondContact O-N 2.63Å; D63-S67 PolarHBondContact O-OG 3.03Å; Y64-S67 PolarHBondContact O-N 3.08Å; I65-S67 VanDerWaalsContact C-N 3.26Å; I65-S67 PolarHBondContact O-N 3.04Å
68	V	64.1	Low	88.9	Confident	158 Å²	158	111 Å²	111	96%	0.958	58%	0.581	S	S	*	*			trans	-98.4	0	177.9	173.5	0	0	0	0	109.7	Y64 I65	Y64-V68 HydrophobicContact CE1-CG2 4.46Å; Y64-V68 WeakPolarHBondContact O-CG2 3.3Å; Y64-V68 PolarHBondContact O-N 2.91Å; I65-V68 PolarHBondContact O-N 2.89Å

Retrieved 68 of 68 residues in 17.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).