A0A087WPW7_MOUSE Loading...

Lymphocyte antigen 6 family member C1

AlphaFold DB , UniProt , Accession A0A087WPW7, Species MOUSE (Mus musculus, Mouse), Gene Ly6c1, Length 78 aa.

						>A0A087WPW7_MOUSE|A0A087WPW7|Ly6c1
MDTSHTTKSCVLILLVALLCAERAQGLQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEGSHSNLRIDYKSPCSP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.8	Very low	62.1	Low	227 Å²	227	114 Å²	114	100%	1.118	64%	0.635	S	S	*	*				0	85.9	0	175.8	162.7	71.1	0	0	106.6
2	D	50.3	Low	63.7	Low	131 Å²	131	113.4 Å²	113.4	70%	0.701	63%	0.629	S	S	*	*			trans	-153.9	15.5	174.5	-82.7	-60.8	0	0	0	112.9	S4 T6	D2-S4 PolarHBondContact O-N 2.72Å; D2-T6 PolarHBondContact O-OG1 3.36Å
3	T	54.4	Low	65.2	Low	121 Å²	121	113.1 Å²	113.1	74%	0.742	62%	0.623	S	S	*	*	H	α-helix	trans	-72.7	-16.1	175.9	49.7	0	0	0	0	112.7	T6 T7	T3-T6 PolarHBondContact O-OG1 3.41Å; T3-T7 PolarHBondContact O-N 3.49Å; T3-T7 PolarHBondContact O-OG1 3.11Å
4	S	55.7	Low	66.5	Low	82 Å²	82	113.1 Å²	113.1	57%	0.573	62%	0.622	S	S	*	*	H	α-helix	trans	-74.6	-31.5	-179.5	-172.8	0	0	0	0	112.8	D2 T7 K8	D2-S4 PolarHBondContact O-N 2.72Å; S4-T7 PolarHBondContact O-OG1 3.37Å; S4-K8 PolarHBondContact O-N 3.07Å
5	H	56.5	Low	67.6	Low	152 Å²	152	111.5 Å²	111.5	70%	0.704	61%	0.611	S	S	*	*	H	α-helix	trans	-75.4	-37.6	-177.8	-132.7	-95.3	0	0	0	111.9	S9	H5-S9 PolarHBondContact O-N 3.43Å; H5-S9 VanDerWaalsContact O-N 3.16Å
6	T	59.4	Low	68.5	Low	91 Å²	91	110.1 Å²	110.1	56%	0.558	61%	0.607	S	S	*	*	H	α-helix	trans	-68.8	-40.7	177.8	7.4	0	0	0	0	111.6	D2 T3 S9 C10	D2-T6 PolarHBondContact O-OG1 3.36Å; T3-T6 PolarHBondContact O-OG1 3.41Å; T6-S9 PolarHBondContact O-N 3.39Å; T6-C10 PolarHBondContact O-N 3.41Å; T6-C10 VanDerWaalsContact O-N 3.11Å; T6-C10 PolarHBondContact O-SG 2.98Å; T6-C10 VanDerWaalsContact O-SG 3.36Å
7	T	61.2	Low	69.2	Low	87 Å²	87	107.1 Å²	107.1	53%	0.534	60%	0.6	S	S	.	*	H	α-helix	trans	-67.4	-42	176.8	15.9	0	0	0	0	112.3	T3 S4 S9 C10 V11	T3-T7 PolarHBondContact O-N 3.49Å; T3-T7 PolarHBondContact O-OG1 3.11Å; S4-T7 PolarHBondContact O-OG1 3.37Å; T7-S9 VanDerWaalsContact C-N 3.32Å; T7-S9 PolarHBondContact O-N 3.36Å; T7-C10 PolarHBondContact O-N 3.16Å; T7-V11 VanDerWaalsContact O-CG2 3.31Å; T7-V11 WeakPolarHBondContact O-CG2 3.34Å; T7-V11 PolarHBondContact O-N 2.98Å; T7-V11 VanDerWaalsContact O-N 3.07Å
8	K	64.2	Low	69.6	Low	147 Å²	147	107.3 Å²	107.3	64%	0.639	60%	0.598	S	S	*	*	H	α-helix	trans	-60.9	-40.7	175.1	-82.8	-172.9	75.3	155.6	0	112.4	S4 L12	S4-K8 PolarHBondContact O-N 3.07Å; K8-L12 VanDerWaalsContact O-CG 3.29Å; K8-L12 WeakPolarHBondContact O-CG 3.5Å; K8-L12 PolarHBondContact O-N 3.42Å; K8-L12 VanDerWaalsContact O-N 3.15Å
9	S	72.7	Confident	69.8	Low	61 Å²	61	107.2 Å²	107.2	43%	0.427	60%	0.596	S	S	.	*	H	α-helix	trans	-64.8	-44.2	178.2	-173.8	0	0	0	0	112	H5 T6 T7 V11 L12 I13	H5-S9 PolarHBondContact O-N 3.43Å; H5-S9 VanDerWaalsContact O-N 3.16Å; T6-S9 PolarHBondContact O-N 3.39Å; T7-S9 VanDerWaalsContact C-N 3.32Å; T7-S9 PolarHBondContact O-N 3.36Å; S9-V11 PolarHBondContact O-N 3.43Å; S9-L12 PolarHBondContact O-N 3.22Å; S9-I13 WeakPolarHBondContact O-CD1 3.38Å; S9-I13 VanDerWaalsContact O-CG1 3.3Å; S9-I13 WeakPolarHBondContact O-CG1 3.3Å; S9-I13 PolarHBondContact O-N 3.37Å
10	C	77.1	Confident	69.7	Low	73 Å²	73	105.9 Å²	105.9	49%	0.493	59%	0.593	S	S	.	*	H	α-helix	trans	-63.9	-39.9	177.7	-68.3	0	0	0	0	113.2	T6 T7 L12 I13 L14	T6-C10 PolarHBondContact O-N 3.41Å; T6-C10 VanDerWaalsContact O-N 3.11Å; T6-C10 PolarHBondContact O-SG 2.98Å; T6-C10 VanDerWaalsContact O-SG 3.36Å; T7-C10 PolarHBondContact O-N 3.16Å; C10-L12 VanDerWaalsContact C-N 3.34Å; C10-L12 PolarHBondContact O-N 3.38Å; C10-I13 PolarHBondContact O-N 3.31Å; C10-L14 PolarHBondContact O-N 3.5Å
11	V	83.1	Confident	69.3	Low	82 Å²	82	103.5 Å²	103.5	50%	0.497	59%	0.588	S	S	.	*	H	α-helix	trans	-63.3	-41.4	176.9	172	0	0	0	0	111.1	T7 S9 L14 L15	T7-V11 VanDerWaalsContact O-CG2 3.31Å; T7-V11 WeakPolarHBondContact O-CG2 3.34Å; T7-V11 PolarHBondContact O-N 2.98Å; T7-V11 VanDerWaalsContact O-N 3.07Å; S9-V11 PolarHBondContact O-N 3.43Å; V11-L14 PolarHBondContact O-N 3.3Å; V11-L15 HydrophobicContact CG1-CD1 3.92Å; V11-L15 WeakPolarHBondContact O-CB 3.31Å; V11-L15 WeakPolarHBondContact O-CG 3.29Å; V11-L15 PolarHBondContact O-N 3.46Å
12	L	81.4	Confident	69.8	Low	107 Å²	107	98.5 Å²	98.5	56%	0.56	56%	0.561	S	S	*	*	H	α-helix	trans	-63.6	-41.7	176.2	-70.4	169.1	0	0	0	111.9	K8 S9 C10 L15 V16	K8-L12 VanDerWaalsContact O-CG 3.29Å; K8-L12 WeakPolarHBondContact O-CG 3.5Å; K8-L12 PolarHBondContact O-N 3.42Å; K8-L12 VanDerWaalsContact O-N 3.15Å; S9-L12 PolarHBondContact O-N 3.22Å; C10-L12 VanDerWaalsContact C-N 3.34Å; C10-L12 PolarHBondContact O-N 3.38Å; L12-L15 PolarHBondContact O-N 3.15Å; L12-V16 WeakPolarHBondContact O-CG2 3.48Å; L12-V16 PolarHBondContact O-N 3.02Å
13	I	83.2	Confident	70.2	Confident	109 Å²	109	103.1 Å²	103.1	56%	0.559	57%	0.569	S	S	*	*	H	α-helix	trans	-64.5	-43.3	177.8	-65.8	162.5	0	0	0	111.1	S9 C10 V16 A17	S9-I13 WeakPolarHBondContact O-CD1 3.38Å; S9-I13 VanDerWaalsContact O-CG1 3.3Å; S9-I13 WeakPolarHBondContact O-CG1 3.3Å; S9-I13 PolarHBondContact O-N 3.37Å; C10-I13 PolarHBondContact O-N 3.31Å; I13-V16 PolarHBondContact O-N 3.06Å; I13-A17 PolarHBondContact O-N 3.03Å
14	L	83.5	Confident	70.4	Confident	114 Å²	114	101.2 Å²	101.2	60%	0.597	57%	0.565	S	S	*	*	H	α-helix	trans	-61.6	-43.4	175.8	-83.5	161.6	0	0	0	112.1	C10 V11 A17 L18	C10-L14 PolarHBondContact O-N 3.5Å; V11-L14 PolarHBondContact O-N 3.3Å; L14-A17 PolarHBondContact O-N 3.31Å; L14-L18 WeakPolarHBondContact O-CG 3.44Å; L14-L18 PolarHBondContact O-N 3Å
15	L	82.6	Confident	70.8	Confident	88 Å²	88	104.5 Å²	104.5	46%	0.461	57%	0.571	S	S	.	*	H	α-helix	trans	-60.3	-48	176.2	-79.7	161.8	0	0	0	111.3	V11 L12 A17 L18 L19	V11-L15 HydrophobicContact CG1-CD1 3.92Å; V11-L15 WeakPolarHBondContact O-CB 3.31Å; V11-L15 WeakPolarHBondContact O-CG 3.29Å; V11-L15 PolarHBondContact O-N 3.46Å; L12-L15 PolarHBondContact O-N 3.15Å; L15-A17 VanDerWaalsContact C-N 3.31Å; L15-A17 PolarHBondContact O-N 3.42Å; L15-L18 PolarHBondContact O-N 3.47Å; L15-L19 WeakPolarHBondContact O-CB 3.48Å; L15-L19 WeakPolarHBondContact O-CD1 3.34Å; L15-L19 PolarHBondContact O-N 3.4Å
16	V	81.7	Confident	71.7	Confident	90 Å²	90	98.8 Å²	98.8	55%	0.545	55%	0.554	S	S	.	*	H	α-helix	trans	-59.8	-42.3	177.7	172.3	0	0	0	0	111.2	L12 I13 L18 L19 C20	L12-V16 WeakPolarHBondContact O-CG2 3.48Å; L12-V16 PolarHBondContact O-N 3.02Å; I13-V16 PolarHBondContact O-N 3.06Å; V16-L18 PolarHBondContact O-N 3.23Å; V16-L19 PolarHBondContact O-N 3.43Å; V16-C20 WeakPolarHBondContact O-CB 3.48Å; V16-C20 PolarHBondContact O-N 3.32Å; V16-C20 PolarHBondContact O-SG 3.02Å
17	A	80.1	Confident	72.7	Confident	59 Å²	59	98 Å²	98	49%	0.488	55%	0.546	S	S	.	.	H	α-helix	trans	-63.4	-39.6	177.6	0	0	0	0	0	112.9	I13 L14 L15 C20 A21	I13-A17 PolarHBondContact O-N 3.03Å; L14-A17 PolarHBondContact O-N 3.31Å; L15-A17 VanDerWaalsContact C-N 3.31Å; L15-A17 PolarHBondContact O-N 3.42Å; A17-C20 PolarHBondContact O-N 2.99Å; A17-A21 PolarHBondContact O-N 3.26Å
18	L	77.6	Confident	73.9	Confident	110 Å²	110	100 Å²	100	58%	0.576	55%	0.549	S	S	*	.	H	α-helix	trans	-67.2	-45.6	176.6	-71.6	166.1	0	0	0	111.9	L14 L15 V16 C20 A21 E22	L14-L18 WeakPolarHBondContact O-CG 3.44Å; L14-L18 PolarHBondContact O-N 3Å; L15-L18 PolarHBondContact O-N 3.47Å; V16-L18 PolarHBondContact O-N 3.23Å; L18-C20 PolarHBondContact O-N 3.02Å; L18-A21 WeakPolarHBondContact O-CB 3.33Å; L18-A21 PolarHBondContact O-N 3.44Å; L18-E22 PolarHBondContact O-N 3.01Å
19	L	72.1	Confident	75	Confident	106 Å²	106	93.1 Å²	93.1	56%	0.555	52%	0.519	S	S	*	.	H	α-helix	trans	-59	-35.6	174.8	-81.5	149.4	0	0	0	112.1	L15 V16 R23	L15-L19 WeakPolarHBondContact O-CB 3.48Å; L15-L19 WeakPolarHBondContact O-CD1 3.34Å; L15-L19 PolarHBondContact O-N 3.4Å; V16-L19 PolarHBondContact O-N 3.43Å; L19-R23 PolarHBondContact O-N 3.35Å
20	C	67.6	Low	75.7	Confident	80 Å²	80	96.2 Å²	96.2	54%	0.541	52%	0.523	S	S	.	.	H	α-helix	trans	-71.7	-33.9	173.8	-71.5	0	0	0	0	112.8	V16 A17 L18 R23 A24	V16-C20 WeakPolarHBondContact O-CB 3.48Å; V16-C20 PolarHBondContact O-N 3.32Å; V16-C20 PolarHBondContact O-SG 3.02Å; A17-C20 PolarHBondContact O-N 2.99Å; L18-C20 PolarHBondContact O-N 3.02Å; C20-R23 PolarHBondContact O-N 2.93Å; C20-A24 PolarHBondContact O-N 3.38Å
21	A	63.3	Low	76.1	Confident	57 Å²	57	95.8 Å²	95.8	47%	0.471	51%	0.513	S	S	.	.	H	α-helix	trans	-69.9	-34.5	176.4	0	0	0	0	0	112.3	A17 L18 R23 A24 Q25	A17-A21 PolarHBondContact O-N 3.26Å; L18-A21 WeakPolarHBondContact O-CB 3.33Å; L18-A21 PolarHBondContact O-N 3.44Å; A21-R23 VanDerWaalsContact C-N 3.27Å; A21-R23 PolarHBondContact O-N 2.96Å; A21-A24 WeakPolarHBondContact O-CB 3.4Å; A21-A24 PolarHBondContact O-N 3.5Å; A21-Q25 PolarHBondContact O-N 3.03Å
22	E	58.5	Low	76.3	Confident	121 Å²	121	92.5 Å²	92.5	57%	0.565	49%	0.494	S	S	*	.	H	α-helix	trans	-63.1	-35.1	172.6	-71	176.5	101	0	0	111.7	L18 A24 Q25	L18-E22 PolarHBondContact O-N 3.01Å; E22-A24 VanDerWaalsContact C-N 3.25Å; E22-A24 PolarHBondContact O-N 3.28Å; E22-Q25 PolarHBondContact O-N 3.4Å
23	R	58.3	Low	76.5	Confident	229 Å²	229	92.9 Å²	92.9	86%	0.864	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.2	-14.3	172.2	-66.6	-157.8	-175.5	-100.1	2.5	114.3	L19 C20 A21	L19-R23 PolarHBondContact O-N 3.35Å; C20-R23 PolarHBondContact O-N 2.93Å; A21-R23 VanDerWaalsContact C-N 3.27Å; A21-R23 PolarHBondContact O-N 2.96Å
24	A	58.9	Low	76.4	Confident	80 Å²	80	89.6 Å²	89.6	66%	0.661	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.1	-6.9	175.9	0	0	0	0	0	113	C20 A21 E22 G26	C20-A24 PolarHBondContact O-N 3.38Å; A21-A24 WeakPolarHBondContact O-CB 3.4Å; A21-A24 PolarHBondContact O-N 3.5Å; E22-A24 VanDerWaalsContact C-N 3.25Å; E22-A24 PolarHBondContact O-N 3.28Å; A24-G26 VanDerWaalsContact C-N 3.29Å; A24-G26 PolarHBondContact O-N 3.34Å
25	Q	65	Low	76.6	Confident	151 Å²	151	85.9 Å²	85.9	71%	0.706	46%	0.464	S	S	*	.	S	Bend	trans	-72.5	91	169.6	-60.4	178.1	16	0	0	107.1	A21 E22	A21-Q25 PolarHBondContact O-N 3.03Å; E22-Q25 PolarHBondContact O-N 3.4Å
26	G	74.7	Confident	76.7	Confident	33 Å²	33	84.9 Å²	84.9	34%	0.34	46%	0.462	S	S	.	.	P	Polyproline II helix	trans	-49.5	148.2	-177.4	0	0	0	0	0	112.5	A24 Q28	A24-G26 VanDerWaalsContact C-N 3.29Å; A24-G26 PolarHBondContact O-N 3.34Å; G26-Q28 PolarHBondContact O-N 3.46Å
27	L	81.1	Confident	76.6	Confident	74 Å²	74	83.8 Å²	83.8	39%	0.387	45%	0.453	S	S	.	.	P	Polyproline II helix	trans	-56.5	130.9	-178.7	-178.4	69.3	0	0	0	110.4	C46 G51	L27-C46 HydrophobicContact CB-CB 4.28Å; L27-C46 WeakPolarHBondContact O-CB 3.29Å; L27-C46 PolarHBondContact O-N 2.03Å; L27-G51 WeakPolarHBondContact CD2-O 3.42Å
28	Q	86.3	Confident	76.6	Confident	129 Å²	129	89.4 Å²	89.4	60%	0.603	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.1	131.2	172.5	-73	-180	53.4	0	0	110.6	G26 V44	G26-Q28 PolarHBondContact O-N 3.46Å; Q28-V44 CarbonylContact C-O 3.6Å; Q28-V44 VanDerWaalsContact CA-O 3.31Å; Q28-V44 WeakPolarHBondContact CA-O 3.38Å
29	C	86.1	Confident	77	Confident	2 Å²	2	87.1 Å²	87.1	1%	0.014	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	151	179.9	-63.3	0	0	0	0	110.3	A43 V44 C46 C53 P75	C29-A43 CarbonylContact O-C 3.57Å; C29-A43 WeakPolarHBondContact O-CA 3.06Å; C29-V44 PolarHBondContact N-O 2.04Å; C29-V44 PolarHBondContact O-N 2.78Å; C29-C46 VanDerWaalsContact SG-SG 3.63Å; C29-C53 VanDerWaalsContact CA-SG 3.5Å; C29-C53 HydrophobicContact CB-CB 3.79Å; C29-C53 WeakPolarHBondContact CB-SG 3.38Å; C29-C53 WeakPolarHBondContact SG-CA 3.07Å; C29-C53 WeakPolarHBondContact SG-CB 3.07Å; C29-C53 CovalentContact SG-SG 2.03Å; C29-C53 PolarHBondContact SG-SG 3.29Å; C29-P75 WeakPolarHBondContact CB-O 3.04Å; C29-P75 PolarHBondContact SG-O 2.95Å
30	Y	87.8	Confident	77.7	Confident	127 Å²	127	87.6 Å²	87.6	50%	0.498	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.1	141.3	174	-65.7	-74	0	0	0	110.6	C41 P42 A43 K73	Y30-C41 HydrophobicContact CD1-CB 4.36Å; Y30-C41 VanDerWaalsContact CD1-O 3.27Å; Y30-C41 WeakPolarHBondContact CD1-O 2.98Å; Y30-P42 CarbonylContact C-O 3.56Å; Y30-P42 WeakPolarHBondContact CA-O 3.31Å; Y30-A43 HydrophobicContact CD1-CB 4.31Å; Y30-A43 HydrophobicContact CE1-CB 4.35Å; Y30-K73 VanDerWaalsContact O-CG 3.29Å; Y30-K73 WeakPolarHBondContact O-CG 3.35Å
31	E	85.8	Confident	78.7	Confident	63 Å²	63	84.9 Å²	84.9	29%	0.294	45%	0.454	S	S	.	.			trans	-125	115	178.5	-175.9	174.3	-140.1	0	0	110.4	Y33 P42 V44 P75	E31-Y33 HydrophobicContact CG-CE2 4.19Å; E31-Y33 PolarHBondContact OE1-OH 3.48Å; E31-P42 PolarHBondContact N-O 2.03Å; E31-P42 VanDerWaalsContact O-CD 3.31Å; E31-P42 WeakPolarHBondContact O-CD 2.94Å; E31-P42 WeakPolarHBondContact O-CG 2.88Å; E31-V44 HydrophobicContact CB-CG1 4.11Å; E31-V44 HydrophobicContact CB-CG2 3.93Å; E31-V44 WeakPolarHBondContact OE2-CG1 3.21Å; E31-P75 HydrophobicContact CB-CB 4.2Å; E31-P75 HydrophobicContact CG-CB 4.14Å; E31-P75 HydrophobicContact CG-CG 4.31Å; E31-P75 WeakPolarHBondContact OE1-CG 3.37Å
32	C	86.5	Confident	79.8	Confident	13 Å²	13	86.3 Å²	86.3	9%	0.088	46%	0.458	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-163.8	151.1	174.7	49.2	0	0	0	0	111.1	V35 C41 K73	C32-V35 HydrophobicContact CB-CG1 4.36Å; C32-V35 HydrophobicContact CB-CG2 3.77Å; C32-C41 HydrophobicContact CB-CB 3.63Å; C32-C41 WeakPolarHBondContact CB-SG 3.38Å; C32-C41 WeakPolarHBondContact SG-CB 3.34Å; C32-C41 CovalentContact SG-SG 2.04Å; C32-C41 PolarHBondContact SG-SG 3.48Å; C32-K73 PolarHBondContact N-O 3.5Å; C32-K73 PolarHBondContact O-N 2.76Å
33	Y	85	Confident	81.2	Confident	116 Å²	116	83.1 Å²	83.1	46%	0.455	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	117	-170.8	-58.6	-58.6	0	0	0	111.1	E31 V35 Y72 P75	E31-Y33 HydrophobicContact CG-CE2 4.19Å; E31-Y33 PolarHBondContact OE1-OH 3.48Å; Y33-V35 PolarHBondContact O-N 2.88Å; Y33-Y72 AromaticContact CD1-CD2 3.52Å; Y33-Y72 HydrophobicContact CD1-CD2 3.52Å; Y33-Y72 HydrophobicContact CD1-CE1 4.19Å; Y33-Y72 AromaticContact CD1-CE2 3.07Å; Y33-Y72 HydrophobicContact CD1-CE2 3.07Å; Y33-Y72 HydrophobicContact CD1-CG 4.23Å; Y33-Y72 AromaticContact CD1-CZ 3.43Å; Y33-Y72 VanDerWaalsContact CD1-CZ 3.43Å; Y33-Y72 HydrophobicContact CE1-CD2 4.32Å; Y33-Y72 HydrophobicContact CE1-CE1 4.05Å; Y33-Y72 AromaticContact CE1-CE2 3.58Å; Y33-Y72 HydrophobicContact CE1-CE2 3.58Å; Y33-Y72 AromaticContact CE1-CZ 3.38Å; Y33-Y72 WeakPolarHBondContact CE1-OH 3.17Å; Y33-Y72 HydrophobicContact CG-CD2 4.39Å; Y33-Y72 HydrophobicContact CG-CE2 4.05Å; Y33-P75 WeakPolarHBondContact OH-CD 3.33Å
34	G	83.1	Confident	82.5	Confident	40 Å²	40	74 Å²	74	41%	0.412	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	64	30.2	172.7	0	0	0	0	0	113.5	D71	G34-D71 PolarHBondContact N-O 3.48Å; G34-D71 VanDerWaalsContact N-O 3.16Å
35	V	85.8	Confident	83.8	Confident	35 Å²	35	74.5 Å²	74.5	21%	0.212	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.4	148.8	178.3	-62.3	0	0	0	0	110	C32 Y33 T39 I70 D71	C32-V35 HydrophobicContact CB-CG1 4.36Å; C32-V35 HydrophobicContact CB-CG2 3.77Å; Y33-V35 PolarHBondContact O-N 2.88Å; V35-T39 HydrophobicContact CB-CG2 4.08Å; V35-T39 HydrophobicContact CG1-CG2 4.41Å; V35-T39 HydrophobicContact CG2-CG2 4.38Å; V35-I70 CarbonylContact O-C 3.55Å; V35-I70 VanDerWaalsContact O-CA 3.26Å; V35-I70 WeakPolarHBondContact O-CA 3.27Å; V35-D71 PolarHBondContact N-O 2.91Å; V35-D71 PolarHBondContact O-N 2.77Å
36	P	85.1	Confident	84.5	Confident	67 Å²	67	67.7 Å²	67.7	44%	0.435	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-54.8	146.8	170.5	-23.6	32	0	0	0	111.6	E38 T39	P36-E38 PolarHBondContact O-N 2.79Å; P36-T39 WeakPolarHBondContact CD-OG1 3.47Å; P36-T39 WeakPolarHBondContact O-CB 3.31Å; P36-T39 PolarHBondContact O-N 3.4Å; P36-T39 PolarHBondContact O-OG1 3.18Å
37	I	79.4	Confident	84.5	Confident	68 Å²	68	78.1 Å²	78.1	35%	0.349	42%	0.415	S	S	.	.	T	Hydrogen-bonded Turn	trans	-50.7	-35.2	-178.4	-102.4	173.6	0	0	0	114.2	T39 R69 D71	I37-T39 PolarHBondContact O-N 3.18Å; I37-R69 HydrophobicContact CD1-CB 4.39Å; I37-R69 HydrophobicContact CD1-CG 3.74Å; I37-R69 PolarHBondContact N-O 3.22Å; I37-D71 HydrophobicContact CG1-CB 4.32Å; I37-D71 WeakPolarHBondContact CG1-OD2 3.32Å
38	E	81.1	Confident	83.9	Confident	176 Å²	176	76.4 Å²	76.4	82%	0.822	41%	0.412	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.9	1.4	-177.3	-55.4	-58.3	147.7	0	0	113	P36	P36-E38 PolarHBondContact O-N 2.79Å
39	T	85.9	Confident	82.9	Confident	63 Å²	63	76.7 Å²	76.7	39%	0.387	43%	0.428	S	S	.	.	S	Bend	trans	-83.4	126.1	-178.3	-47.7	0	0	0	0	110.2	V35 P36 I37 C41	V35-T39 HydrophobicContact CB-CG2 4.08Å; V35-T39 HydrophobicContact CG1-CG2 4.41Å; V35-T39 HydrophobicContact CG2-CG2 4.38Å; P36-T39 WeakPolarHBondContact CD-OG1 3.47Å; P36-T39 WeakPolarHBondContact O-CB 3.31Å; P36-T39 PolarHBondContact O-N 3.4Å; P36-T39 PolarHBondContact O-OG1 3.18Å; I37-T39 PolarHBondContact O-N 3.18Å; T39-C41 PolarHBondContact O-N 3.34Å
40	S	87.1	Confident	82.1	Confident	116 Å²	116	82.2 Å²	82.2	81%	0.811	46%	0.458	S	S	*	.			trans	-66.9	131.6	170.9	-175.3	0	0	0	0	110.5
41	C	87.3	Confident	81.5	Confident	23 Å²	23	76.7 Å²	76.7	16%	0.155	44%	0.439	C	S	.	.			trans	-106.9	142.5	178.3	-56.4	0	0	0	0	110.8	Y30 C32 T39	Y30-C41 HydrophobicContact CD1-CB 4.36Å; Y30-C41 VanDerWaalsContact CD1-O 3.27Å; Y30-C41 WeakPolarHBondContact CD1-O 2.98Å; C32-C41 HydrophobicContact CB-CB 3.63Å; C32-C41 WeakPolarHBondContact CB-SG 3.38Å; C32-C41 WeakPolarHBondContact SG-CB 3.34Å; C32-C41 CovalentContact SG-SG 2.04Å; C32-C41 PolarHBondContact SG-SG 3.48Å; T39-C41 PolarHBondContact O-N 3.34Å
42	P	87.6	Confident	81.2	Confident	87 Å²	87	78.8 Å²	78.8	57%	0.565	45%	0.447	S	S	*	.			trans	-65.5	151	171.6	29.1	-35.5	0	0	0	111	Y30 E31	Y30-P42 CarbonylContact C-O 3.56Å; Y30-P42 WeakPolarHBondContact CA-O 3.31Å; E31-P42 PolarHBondContact N-O 2.03Å; E31-P42 VanDerWaalsContact O-CD 3.31Å; E31-P42 WeakPolarHBondContact O-CD 2.94Å; E31-P42 WeakPolarHBondContact O-CG 2.88Å
43	A	87.3	Confident	81.2	Confident	53 Å²	53	80.7 Å²	80.7	44%	0.438	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.7	141	171.6	0	0	0	0	0	110.5	C29 Y30	C29-A43 CarbonylContact O-C 3.57Å; C29-A43 WeakPolarHBondContact O-CA 3.06Å; Y30-A43 HydrophobicContact CD1-CB 4.31Å; Y30-A43 HydrophobicContact CE1-CB 4.35Å
44	V	85.9	Confident	81.2	Confident	39 Å²	39	77.4 Å²	77.4	24%	0.236	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	145.9	177	-59.9	0	0	0	0	110.7	Q28 C29 E31 P75	Q28-V44 CarbonylContact C-O 3.6Å; Q28-V44 VanDerWaalsContact CA-O 3.31Å; Q28-V44 WeakPolarHBondContact CA-O 3.38Å; C29-V44 PolarHBondContact N-O 2.04Å; C29-V44 PolarHBondContact O-N 2.78Å; E31-V44 HydrophobicContact CB-CG1 4.11Å; E31-V44 HydrophobicContact CB-CG2 3.93Å; E31-V44 WeakPolarHBondContact OE2-CG1 3.21Å; V44-P75 HydrophobicContact CG2-CB 3.5Å; V44-P75 VanDerWaalsContact CG2-CB 3.5Å
45	T	85.4	Confident	81.3	Confident	89 Å²	89	78 Å²	78	55%	0.546	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.4	124.2	178	-51.6	0	0	0	0	110.6
46	C	80.4	Confident	81.1	Confident	9 Å²	9	81.4 Å²	81.4	6%	0.061	47%	0.465	C	S	.	.			trans	-68	134.4	174.5	-67.8	0	0	0	0	111.9	L27 C29 P75 C76	L27-C46 HydrophobicContact CB-CB 4.28Å; L27-C46 WeakPolarHBondContact O-CB 3.29Å; L27-C46 PolarHBondContact O-N 2.03Å; C29-C46 VanDerWaalsContact SG-SG 3.63Å; C46-P75 PolarHBondContact SG-O 3.41Å; C46-P75 VanDerWaalsContact SG-O 3.34Å; C46-C76 WeakPolarHBondContact CA-SG 3.16Å; C46-C76 HydrophobicContact CB-CB 3.89Å; C46-C76 WeakPolarHBondContact CB-SG 3.06Å; C46-C76 WeakPolarHBondContact SG-CB 3.26Å; C46-C76 CovalentContact SG-SG 2.03Å; C46-C76 PolarHBondContact SG-SG 2.81Å
47	R	75	Confident	81	Confident	251 Å²	251	82.8 Å²	82.8	95%	0.947	47%	0.469	S	S	*	.	S	Bend	trans	-77	-25.7	175.1	-65.8	-176.4	-178	152.5	2.1	112.7
48	A	67.9	Low	81.1	Confident	39 Å²	39	83.6 Å²	83.6	32%	0.322	47%	0.473	S	S	.	.			trans	-89.2	130.3	-179	0	0	0	0	0	110.1	D50	A48-D50 VanDerWaalsContact C-N 3.27Å; A48-D50 PolarHBondContact O-N 3.25Å
49	S	65.1	Low	81.2	Confident	135 Å²	135	81.2 Å²	81.2	94%	0.944	46%	0.462	S	S	*	.	S	Bend	trans	-75	-18.4	-179.1	-50.2	0	0	0	0	113.2
50	D	69.6	Low	80.7	Confident	118 Å²	118	82.2 Å²	82.2	63%	0.631	46%	0.464	S	S	*	.	S	Bend	trans	-104.7	-2.9	-179.4	57	-23.8	0	0	0	113.4	A48	A48-D50 VanDerWaalsContact C-N 3.27Å; A48-D50 PolarHBondContact O-N 3.25Å
51	G	74.8	Confident	80.1	Confident	11 Å²	11	83.5 Å²	83.5	11%	0.113	46%	0.46	C	S	.	.			trans	-69.9	158.3	-178.5	0	0	0	0	0	113.2	L27 S77	L27-G51 WeakPolarHBondContact CD2-O 3.42Å; G51-S77 CarbonylContact C-O 3.55Å; G51-S77 WeakPolarHBondContact CA-O 2.97Å
52	F	81	Confident	79.2	Confident	106 Å²	106	88.5 Å²	88.5	47%	0.465	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	157.5	173.7	59.7	-81.7	0	0	0	111.4	I54 S77 P78	F52-I54 HydrophobicContact CD2-CD1 4.22Å; F52-I54 HydrophobicContact CD2-CG1 3.69Å; F52-I54 HydrophobicContact CE2-CD1 3.42Å; F52-I54 VanDerWaalsContact CE2-CD1 3.42Å; F52-I54 HydrophobicContact CE2-CG1 3.37Å; F52-I54 HydrophobicContact CZ-CD1 3.86Å; F52-I54 HydrophobicContact CZ-CG1 4.26Å; F52-S77 PolarHBondContact N-O 3.14Å; F52-S77 PolarHBondContact O-N 2.82Å; F52-P78 WeakPolarHBondContact CE1-O 3.41Å
53	C	85.4	Confident	78.1	Confident	54 Å²	54	87.6 Å²	87.6	37%	0.365	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.2	130.4	179	-48.4	0	0	0	0	110.7	C29	C29-C53 VanDerWaalsContact CA-SG 3.5Å; C29-C53 HydrophobicContact CB-CB 3.79Å; C29-C53 WeakPolarHBondContact CB-SG 3.38Å; C29-C53 WeakPolarHBondContact SG-CA 3.07Å; C29-C53 WeakPolarHBondContact SG-CB 3.07Å; C29-C53 CovalentContact SG-SG 2.03Å; C29-C53 PolarHBondContact SG-SG 3.29Å
54	I	85.4	Confident	77.1	Confident	46 Å²	46	90.2 Å²	90.2	24%	0.236	50%	0.503	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	132.2	175	-57.1	-173	0	0	0	109.9	F52 Q56 S74 S77	F52-I54 HydrophobicContact CD2-CD1 4.22Å; F52-I54 HydrophobicContact CD2-CG1 3.69Å; F52-I54 HydrophobicContact CE2-CD1 3.42Å; F52-I54 VanDerWaalsContact CE2-CD1 3.42Å; F52-I54 HydrophobicContact CE2-CG1 3.37Å; F52-I54 HydrophobicContact CZ-CD1 3.86Å; F52-I54 HydrophobicContact CZ-CG1 4.26Å; I54-Q56 HydrophobicContact CG2-CG 4.22Å; I54-S74 PolarHBondContact O-N 2.86Å; I54-S74 VanDerWaalsContact O-N 3.14Å; I54-S74 PolarHBondContact O-OG 3.14Å; I54-S77 VanDerWaalsContact CD1-CB 3.41Å; I54-S77 WeakPolarHBondContact CD1-OG 3.32Å
55	A	85.5	Confident	75.8	Confident	53 Å²	53	98.1 Å²	98.1	44%	0.438	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	137.7	169	0	0	0	0	0	109.4	Y72 K73	A55-Y72 CarbonylContact C-O 3.52Å; A55-K73 HydrophobicContact CB-CD 3.77Å; A55-K73 HydrophobicContact CB-CG 4.15Å
56	Q	81.7	Confident	74.8	Confident	107 Å²	107	96.9 Å²	96.9	50%	0.5	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	131	174.9	-67.8	179.4	87.1	0	0	108.3	I54 Y72	I54-Q56 HydrophobicContact CG2-CG 4.22Å; Q56-Y72 PolarHBondContact N-O 2.95Å; Q56-Y72 WeakPolarHBondContact O-CA 3.49Å; Q56-Y72 PolarHBondContact O-N 2.73Å
57	N	82.2	Confident	74.4	Confident	96 Å²	96	103.3 Å²	103.3	51%	0.513	57%	0.566	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-103.5	133.8	173.6	44.3	35.3	0	0	0	109.4	I70	N57-I70 WeakPolarHBondContact CA-O 3.41Å
58	I	81.4	Confident	74.4	Confident	84 Å²	84	94.8 Å²	94.8	43%	0.431	54%	0.539	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	125.4	176	-48.9	174.8	0	0	0	107.1	L60 I70	I58-L60 HydrophobicContact CG2-CD1 3.78Å; I58-I70 HydrophobicContact CB-CD1 4.1Å; I58-I70 HydrophobicContact CB-CG1 3.78Å; I58-I70 HydrophobicContact CD1-CD1 4.46Å; I58-I70 PolarHBondContact N-O 2.81Å; I58-I70 VanDerWaalsContact O-CG1 3.32Å; I58-I70 WeakPolarHBondContact O-CG1 3.08Å; I58-I70 PolarHBondContact O-N 2.91Å
59	E	82.6	Confident	75	Confident	126 Å²	126	98.4 Å²	98.4	59%	0.589	54%	0.544	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.6	108	173.4	-72.4	175	-174.8	0	0	108.1	R69	E59-R69 HydrophobicContact CG-CG 3.96Å; E59-R69 IonicContact OE1-CZ 3.19Å; E59-R69 IonicContact OE1-NE 2.81Å; E59-R69 PolarHBondContact OE1-NE 3.07Å; E59-R69 IonicContact OE1-NH2 2.82Å; E59-R69 PolarHBondContact OE1-NH2 3.07Å
60	L	75.2	Confident	75.7	Confident	84 Å²	84	93.2 Å²	93.2	44%	0.44	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.3	119.2	169.3	-97.7	77.6	0	0	0	108.7	I58 E62 L68 I70	I58-L60 HydrophobicContact CG2-CD1 3.78Å; L60-E62 PolarHBondContact O-N 3.34Å; L60-L68 HydrophobicContact CB-CB 4.27Å; L60-L68 PolarHBondContact N-O 3.14Å; L60-L68 PolarHBondContact O-N 3.43Å; L60-I70 HydrophobicContact CD1-CD1 3.83Å; L60-I70 HydrophobicContact CD1-CG1 4.37Å
61	I	75.4	Confident	76.2	Confident	143 Å²	143	89.3 Å²	89.3	73%	0.733	48%	0.484	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.9	94.4	169.1	-54.9	170.9	0	0	0	106.4
62	E	69.2	Low	76.2	Confident	128 Å²	128	92.8 Å²	92.8	60%	0.598	50%	0.495	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.3	119.8	173	-165.2	165	-162.4	0	0	108.5	L60 S64	L60-E62 PolarHBondContact O-N 3.34Å; E62-S64 PolarHBondContact O-N 3.16Å; E62-S64 VanDerWaalsContact O-N 3.14Å
63	G	63	Low	76.1	Confident	68 Å²	68	90.6 Å²	90.6	70%	0.701	49%	0.485	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.1	120.6	-174.4	0	0	0	0	0	111.3
64	S	66.5	Low	75.3	Confident	108 Å²	108	88.8 Å²	88.8	76%	0.755	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	94.3	78.1	-170.9	69.6	0	0	0	0	115.6	E62 S66	E62-S64 PolarHBondContact O-N 3.16Å; E62-S64 VanDerWaalsContact O-N 3.14Å; S64-S66 PolarHBondContact O-N 2.86Å; S64-S66 VanDerWaalsContact O-N 3.14Å
65	H	59.1	Low	74.4	Confident	206 Å²	206	88 Å²	88	95%	0.954	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	67.7	5.8	155.1	-71.3	168.1	0	0	0	120.3
66	S	65	Low	74	Confident	63 Å²	63	87.6 Å²	87.6	44%	0.441	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	117.4	171.4	56.2	0	0	0	0	111.8	S64	S64-S66 PolarHBondContact O-N 2.86Å; S64-S66 VanDerWaalsContact O-N 3.14Å
67	N	72.3	Confident	73.7	Confident	143 Å²	143	84 Å²	84	77%	0.765	45%	0.451	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.7	110.2	168.2	-65.1	-44.4	0	0	0	107.1
68	L	74.9	Confident	72.9	Confident	73 Å²	73	86 Å²	86	38%	0.382	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	119.1	174.2	179	64.2	0	0	0	108.8	L60 I70	L60-L68 HydrophobicContact CB-CB 4.27Å; L60-L68 PolarHBondContact N-O 3.14Å; L60-L68 PolarHBondContact O-N 3.43Å; L68-I70 HydrophobicContact CD1-CG2 4.45Å; L68-I70 HydrophobicContact CD2-CG2 4.17Å; L68-I70 HydrophobicContact CG-CG2 4.02Å
69	R	79.1	Confident	72.5	Confident	115 Å²	115	86.1 Å²	86.1	43%	0.434	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	117.2	175.3	-158.5	166.4	-154.7	-150.6	14.1	109.5	I37 E59	I37-R69 HydrophobicContact CD1-CB 4.39Å; I37-R69 HydrophobicContact CD1-CG 3.74Å; I37-R69 PolarHBondContact N-O 3.22Å; E59-R69 HydrophobicContact CG-CG 3.96Å; E59-R69 IonicContact OE1-CZ 3.19Å; E59-R69 IonicContact OE1-NE 2.81Å; E59-R69 PolarHBondContact OE1-NE 3.07Å; E59-R69 IonicContact OE1-NH2 2.82Å; E59-R69 PolarHBondContact OE1-NH2 3.07Å
70	I	80.6	Confident	72	Confident	26 Å²	26	84 Å²	84	13%	0.133	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	144.1	177.5	58.1	175	0	0	0	110.3	V35 N57 I58 L60 L68	V35-I70 CarbonylContact O-C 3.55Å; V35-I70 VanDerWaalsContact O-CA 3.26Å; V35-I70 WeakPolarHBondContact O-CA 3.27Å; N57-I70 WeakPolarHBondContact CA-O 3.41Å; I58-I70 HydrophobicContact CB-CD1 4.1Å; I58-I70 HydrophobicContact CB-CG1 3.78Å; I58-I70 HydrophobicContact CD1-CD1 4.46Å; I58-I70 PolarHBondContact N-O 2.81Å; I58-I70 VanDerWaalsContact O-CG1 3.32Å; I58-I70 WeakPolarHBondContact O-CG1 3.08Å; I58-I70 PolarHBondContact O-N 2.91Å; L60-I70 HydrophobicContact CD1-CD1 3.83Å; L60-I70 HydrophobicContact CD1-CG1 4.37Å; L68-I70 HydrophobicContact CD1-CG2 4.45Å; L68-I70 HydrophobicContact CD2-CG2 4.17Å; L68-I70 HydrophobicContact CG-CG2 4.02Å
71	D	79.9	Confident	71.8	Confident	35 Å²	35	84 Å²	84	19%	0.187	47%	0.466	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	139.4	173	-114.5	-92.5	0	0	0	110	G34 V35 I37	G34-D71 PolarHBondContact N-O 3.48Å; G34-D71 VanDerWaalsContact N-O 3.16Å; V35-D71 PolarHBondContact N-O 2.91Å; V35-D71 PolarHBondContact O-N 2.77Å; I37-D71 HydrophobicContact CG1-CB 4.32Å; I37-D71 WeakPolarHBondContact CG1-OD2 3.32Å
72	Y	74.7	Confident	71.6	Confident	85 Å²	85	80.5 Å²	80.5	33%	0.333	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	105.8	173.5	-177.8	-82.6	0	0	0	106.8	Y33 A55 Q56	Y33-Y72 AromaticContact CD1-CD2 3.52Å; Y33-Y72 HydrophobicContact CD1-CD2 3.52Å; Y33-Y72 HydrophobicContact CD1-CE1 4.19Å; Y33-Y72 AromaticContact CD1-CE2 3.07Å; Y33-Y72 HydrophobicContact CD1-CE2 3.07Å; Y33-Y72 HydrophobicContact CD1-CG 4.23Å; Y33-Y72 AromaticContact CD1-CZ 3.43Å; Y33-Y72 VanDerWaalsContact CD1-CZ 3.43Å; Y33-Y72 HydrophobicContact CE1-CD2 4.32Å; Y33-Y72 HydrophobicContact CE1-CE1 4.05Å; Y33-Y72 AromaticContact CE1-CE2 3.58Å; Y33-Y72 HydrophobicContact CE1-CE2 3.58Å; Y33-Y72 AromaticContact CE1-CZ 3.38Å; Y33-Y72 WeakPolarHBondContact CE1-OH 3.17Å; Y33-Y72 HydrophobicContact CG-CD2 4.39Å; Y33-Y72 HydrophobicContact CG-CE2 4.05Å; A55-Y72 CarbonylContact C-O 3.52Å; Q56-Y72 PolarHBondContact N-O 2.95Å; Q56-Y72 WeakPolarHBondContact O-CA 3.49Å; Q56-Y72 PolarHBondContact O-N 2.73Å
73	K	78.6	Confident	71.7	Confident	60 Å²	60	77.6 Å²	77.6	26%	0.261	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	102.8	177.2	-148.9	134.7	177.8	175.4	0	108.4	Y30 C32 A55	Y30-K73 VanDerWaalsContact O-CG 3.29Å; Y30-K73 WeakPolarHBondContact O-CG 3.35Å; C32-K73 PolarHBondContact N-O 3.5Å; C32-K73 PolarHBondContact O-N 2.76Å; A55-K73 HydrophobicContact CB-CD 3.77Å; A55-K73 HydrophobicContact CB-CG 4.15Å
74	S	69.9	Low	72.3	Confident	16 Å²	16	78.2 Å²	78.2	11%	0.112	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.5	139.8	174.4	52.1	0	0	0	0	109.3	I54 C76	I54-S74 PolarHBondContact O-N 2.86Å; I54-S74 VanDerWaalsContact O-N 3.14Å; I54-S74 PolarHBondContact O-OG 3.14Å; S74-C76 PolarHBondContact O-N 2.81Å
75	P	66.5	Low	72.7	Confident	28 Å²	28	76.1 Å²	76.1	18%	0.182	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.3	-47.4	-170.6	26.2	-36.1	0	0	0	111.5	C29 E31 Y33 V44 C46	C29-P75 WeakPolarHBondContact CB-O 3.04Å; C29-P75 PolarHBondContact SG-O 2.95Å; E31-P75 HydrophobicContact CB-CB 4.2Å; E31-P75 HydrophobicContact CG-CB 4.14Å; E31-P75 HydrophobicContact CG-CG 4.31Å; E31-P75 WeakPolarHBondContact OE1-CG 3.37Å; Y33-P75 WeakPolarHBondContact OH-CD 3.33Å; V44-P75 HydrophobicContact CG2-CB 3.5Å; V44-P75 VanDerWaalsContact CG2-CB 3.5Å; C46-P75 PolarHBondContact SG-O 3.41Å; C46-P75 VanDerWaalsContact SG-O 3.34Å
76	C	75.4	Confident	73.8	Confident	45 Å²	45	66.1 Å²	66.1	30%	0.304	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.8	123.3	-174.6	-46.4	0	0	0	0	109.8	C46 S74	C46-C76 WeakPolarHBondContact CA-SG 3.16Å; C46-C76 HydrophobicContact CB-CB 3.89Å; C46-C76 WeakPolarHBondContact CB-SG 3.06Å; C46-C76 WeakPolarHBondContact SG-CB 3.26Å; C46-C76 CovalentContact SG-SG 2.03Å; C46-C76 PolarHBondContact SG-SG 2.81Å; S74-C76 PolarHBondContact O-N 2.81Å
77	S	75.6	Confident	74.5	Confident	32 Å²	32	66.3 Å²	66.3	22%	0.224	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	142.8	164.8	-85.3	0	0	0	0	110.4	G51 F52 I54	G51-S77 CarbonylContact C-O 3.55Å; G51-S77 WeakPolarHBondContact CA-O 2.97Å; F52-S77 PolarHBondContact N-O 3.14Å; F52-S77 PolarHBondContact O-N 2.82Å; I54-S77 VanDerWaalsContact CD1-CB 3.41Å; I54-S77 WeakPolarHBondContact CD1-OG 3.32Å
78	P	66.7	Low	74.7	Confident	138 Å²	138	59.4 Å²	59.4	90%	0.896	31%	0.314	S	S	*	.			trans	-66.6	0	166.7	31.9	-34.5	0	0	0	111.7	F52	F52-P78 WeakPolarHBondContact CE1-O 3.41Å

Retrieved 78 of 78 residues in 41.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).