A0A087WPX9_MOUSE Loading...

WD repeat and FYVE domain containing 1

AlphaFold DB , UniProt , Accession A0A087WPX9, Species MOUSE (Mus musculus, Mouse), Gene Wdfy1, Length 110 aa.

						>A0A087WPX9_MOUSE|A0A087WPX9|Wdfy1
MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRVWLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMPTRTACLLSSSAWLPSG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.3	Very low	51.7	Low	245 Å²	245	151.9 Å²	151.9	100%	1.207	83%	0.833	S	S	*	*				0	126.6	0	-80	172.3	178.7	0	0	107.8
2	A	41.6	Very low	53.6	Low	97 Å²	97	148.1 Å²	148.1	80%	0.802	83%	0.825	S	S	*	*			trans	28.8	117.6	169.4	0	0	0	0	0	120.4
3	A	46.8	Very low	55.8	Low	97 Å²	97	153.1 Å²	153.1	80%	0.802	82%	0.824	S	S	*	*			trans	-86.2	122.3	155.1	0	0	0	0	0	108.6	I5	A3-I5 PolarHBondContact O-N 3.36Å
4	E	49	Very low	57.9	Low	161 Å²	161	151.6 Å²	151.6	75%	0.752	83%	0.826	S	S	*	*			trans	-77.5	111.3	175	-74.8	177.1	130.2	0	0	110.4	H6	E4-H6 PolarHBondContact O-N 3.1Å; E4-H6 VanDerWaalsContact O-N 3.1Å; E4-H6 PolarHBondContact O-ND1 3.08Å; E4-H6 VanDerWaalsContact O-ND1 3.08Å
5	I	55.2	Low	59.9	Low	162 Å²	162	149.1 Å²	149.1	83%	0.831	82%	0.817	S	S	*	*			trans	-74.8	97.2	171.5	-58	171.9	0	0	0	107.4	A3 S7	A3-I5 PolarHBondContact O-N 3.36Å; I5-S7 VanDerWaalsContact C-N 3.34Å; I5-S7 PolarHBondContact O-N 3Å
6	H	49.8	Very low	61.4	Low	155 Å²	155	148.5 Å²	148.5	72%	0.718	81%	0.812	S	S	*	*			trans	-74.3	90.1	170.4	-68.5	77.5	0	0	0	108.7	E4 R8	E4-H6 PolarHBondContact O-N 3.1Å; E4-H6 VanDerWaalsContact O-N 3.1Å; E4-H6 PolarHBondContact O-ND1 3.08Å; E4-H6 VanDerWaalsContact O-ND1 3.08Å; H6-R8 PolarHBondContact O-N 2.99Å
7	S	55.4	Low	62.8	Low	110 Å²	110	149.6 Å²	149.6	77%	0.769	82%	0.815	S	S	*	*			trans	-63.8	100.6	168.1	-176.8	0	0	0	0	108.4	I5	I5-S7 VanDerWaalsContact C-N 3.34Å; I5-S7 PolarHBondContact O-N 3Å
8	R	56.3	Low	63.9	Low	224 Å²	224	144.3 Å²	144.3	85%	0.845	79%	0.791	S	S	*	*			trans	-60.7	128.2	170.5	-84.8	-177.5	172.9	177.8	-1.6	107.9	H6 Q10	H6-R8 PolarHBondContact O-N 2.99Å; R8-Q10 PolarHBondContact O-N 2.93Å
9	P	55.2	Low	65.1	Low	122 Å²	122	144.6 Å²	144.6	79%	0.792	78%	0.784	S	S	*	*			trans	-62.4	109.3	166.4	24.9	-29.4	0	0	0	107	S11	P9-S11 PolarHBondContact O-N 2.81Å
10	Q	60.3	Low	66.3	Low	190 Å²	190	140.3 Å²	140.3	89%	0.888	76%	0.76	S	S	*	*			trans	-64	89.9	165.6	-94.3	-178.9	-35.3	0	0	106.7	R8 S12	R8-Q10 PolarHBondContact O-N 2.93Å; Q10-S12 PolarHBondContact O-N 3.17Å
11	S	60.3	Low	67.3	Low	108 Å²	108	140.2 Å²	140.2	76%	0.755	75%	0.754	S	S	*	*			trans	-68	77.5	163.3	177.2	0	0	0	0	107.2	P9 R13	P9-S11 PolarHBondContact O-N 2.81Å; S11-R13 PolarHBondContact O-N 2.84Å; S11-R13 VanDerWaalsContact O-N 3.17Å
12	S	73.8	Confident	69.4	Low	106 Å²	106	129.8 Å²	129.8	74%	0.741	71%	0.71	S	S	*	*			trans	-70.6	109.2	166.8	63.9	0	0	0	0	106.5	Q10	Q10-S12 PolarHBondContact O-N 3.17Å
13	R	82.8	Confident	71.6	Confident	213 Å²	213	126.6 Å²	126.6	80%	0.804	68%	0.678	S	S	*	*			trans	-57.4	136.7	170.3	-73.2	-179.2	176.3	152.8	-1.5	108.5	S11 V15	S11-R13 PolarHBondContact O-N 2.84Å; S11-R13 VanDerWaalsContact O-N 3.17Å; R13-V15 PolarHBondContact O-N 3.21Å
14	P	84.4	Confident	73.7	Confident	132 Å²	132	129.6 Å²	129.6	86%	0.857	68%	0.676	S	S	*	*			trans	-60.6	125.5	173	25.5	-32	0	0	0	108.6
15	V	87.8	Confident	75.7	Confident	114 Å²	114	126.3 Å²	126.3	69%	0.691	66%	0.663	S	S	*	*			trans	-108.6	134.9	175.3	-179.3	0	0	0	0	107.7	R13 L17	R13-V15 PolarHBondContact O-N 3.21Å; V15-L17 PolarHBondContact O-N 3.13Å; V15-L17 VanDerWaalsContact O-N 3.13Å
16	L	84.8	Confident	77.4	Confident	140 Å²	140	120.9 Å²	120.9	73%	0.733	64%	0.643	S	S	*	*			trans	-64.9	111.6	172.7	177.3	64.7	0	0	0	109.2	S18	L16-S18 WeakPolarHBondContact CD1-O 3.38Å
17	L	84.1	Confident	79.4	Confident	167 Å²	167	117.3 Å²	117.3	87%	0.874	63%	0.631	S	S	*	*			trans	-87.8	-37.3	-179.7	-62.7	179.7	0	0	0	112.7	V15	V15-L17 PolarHBondContact O-N 3.13Å; V15-L17 VanDerWaalsContact O-N 3.13Å
18	S	83.3	Confident	81.1	Confident	55 Å²	55	114.7 Å²	114.7	39%	0.385	61%	0.611	S	S	.	*			trans	-155.6	146.1	-176.3	-166.8	0	0	0	0	110.5	L16	L16-S18 WeakPolarHBondContact CD1-O 3.38Å
19	K	87.2	Confident	82.7	Confident	149 Å²	149	105 Å²	105	65%	0.648	58%	0.579	S	S	*	*			trans	-118.5	126.9	171.9	-172.2	-173.6	-177	-164	0	107.6	E21	K19-E21 HydrophobicContact CD-CG 4.23Å; K19-E21 WeakPolarHBondContact CD-OE1 3.11Å; K19-E21 WeakPolarHBondContact CE-OE1 3.44Å; K19-E21 HydrophobicContact CG-CG 4.27Å; K19-E21 IonicContact NZ-OE1 2.65Å; K19-E21 PolarHBondContact NZ-OE1 3.2Å
20	I	88.4	Confident	84.4	Confident	59 Å²	59	102.3 Å²	102.3	30%	0.303	57%	0.567	S	S	.	*			trans	-109	118.5	179.3	-50.3	177.2	0	0	0	107	W51 Y59	I20-W51 HydrophobicContact CD1-CB 4.28Å; I20-W51 HydrophobicContact CD1-CG 4.37Å; I20-W51 HydrophobicContact CG2-CD2 3.42Å; I20-W51 VanDerWaalsContact CG2-CD2 3.42Å; I20-W51 HydrophobicContact CG2-CE3 3.2Å; I20-W51 HydrophobicContact CG2-CG 4.09Å; I20-W51 HydrophobicContact CG2-CH2 3.71Å; I20-W51 HydrophobicContact CG2-CZ2 3.93Å; I20-W51 HydrophobicContact CG2-CZ3 3.34Å; I20-Y59 HydrophobicContact CD1-CD1 3.76Å; I20-Y59 HydrophobicContact CD1-CD2 3.58Å; I20-Y59 HydrophobicContact CD1-CE1 4.3Å; I20-Y59 HydrophobicContact CD1-CE2 4.14Å; I20-Y59 HydrophobicContact CD1-CG 3.35Å; I20-Y59 HydrophobicContact CG1-CD2 3.8Å; I20-Y59 HydrophobicContact CG1-CG 3.87Å
21	E	87.1	Confident	85.8	Confident	138 Å²	138	95.4 Å²	95.4	65%	0.645	54%	0.536	S	S	*	.			trans	-110	142.3	179.7	-62.5	-175.1	170.5	0	0	110	K19	K19-E21 HydrophobicContact CD-CG 4.23Å; K19-E21 WeakPolarHBondContact CD-OE1 3.11Å; K19-E21 WeakPolarHBondContact CE-OE1 3.44Å; K19-E21 HydrophobicContact CG-CG 4.27Å; K19-E21 IonicContact NZ-OE1 2.65Å; K19-E21 PolarHBondContact NZ-OE1 3.2Å
22	G	83.8	Confident	87.1	Confident	26 Å²	26	96.2 Å²	96.2	27%	0.268	53%	0.531	S	S	.	.			trans	155	-15.7	170.4	0	0	0	0	0	116.2	R49	G22-R49 PolarHBondContact O-NH1 2.83Å; G22-R49 PolarHBondContact O-NH2 2.76Å
23	H	88.8	Confident	87.6	Confident	31 Å²	31	91.6 Å²	91.6	14%	0.144	50%	0.498	C	S	.	.			trans	-67.4	143.8	166.2	-83.1	-66	0	0	0	110.4	V27 T41 S43 D45 T47	H23-V27 HydrophobicContact CB-CG2 4.15Å; H23-T41 PolarHBondContact CD2-OG1 2.91Å; H23-T41 WeakPolarHBondContact NE2-CB 3.3Å; H23-T41 PolarHBondContact NE2-OG1 2.94Å; H23-S43 WeakPolarHBondContact ND1-CB 3.22Å; H23-D45 IonicContact CE1-OD2 3.98Å; H23-D45 IonicContact CG-OD2 3.66Å; H23-D45 IonicContact ND1-OD1 3.52Å; H23-D45 IonicContact ND1-OD2 2.88Å; H23-D45 PolarHBondContact ND1-OD2 3.34Å; H23-T47 PolarHBondContact CE1-OG1 3.48Å; H23-T47 PolarHBondContact ND1-OG1 2.65Å
24	Q	89.4	Confident	87	Confident	160 Å²	160	84.5 Å²	84.5	75%	0.748	48%	0.479	S	S	*	.	S	Bend	trans	-90.2	-8.2	-178.9	-64.9	-58	116.2	0	0	112.7	D45	Q24-D45 HydrophobicContact CB-CB 4.18Å; Q24-D45 PolarHBondContact N-OD2 2.99Å
25	D	91.1	Very high	86.5	Confident	92 Å²	92	87.1 Å²	87.1	49%	0.492	48%	0.477	S	S	.	.	S	Bend	trans	-146.4	-177.9	-179.4	-144.1	-36	0	0	0	111	V27 S43 E44 D45	D25-V27 PolarHBondContact O-N 3.47Å; D25-S43 PolarHBondContact O-OG 3.5Å; D25-S43 VanDerWaalsContact O-OG 3.11Å; D25-E44 HydrophobicContact CB-CB 4.16Å; D25-D45 HydrophobicContact CB-CB 3.88Å
26	A	91.4	Very high	85.7	Confident	48 Å²	48	85.8 Å²	85.8	40%	0.397	46%	0.464	S	S	.	.			trans	-52.4	135.1	-180	0	0	0	0	0	111.8	S43 E44	A26-S43 CarbonylContact O-C 3.56Å; A26-S43 WeakPolarHBondContact O-CA 3.44Å; A26-S43 VanDerWaalsContact O-CB 3.25Å; A26-S43 WeakPolarHBondContact O-CB 3.35Å; A26-S43 PolarHBondContact O-OG 2.8Å; A26-E44 HydrophobicContact CB-CG 4.23Å; A26-E44 PolarHBondContact O-N 3.22Å
27	V	91.3	Very high	85.6	Confident	79 Å²	79	84.1 Å²	84.1	48%	0.479	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.8	114.9	173.3	179.1	0	0	0	0	107.7	H23 D25 A29 T41 A42	H23-V27 HydrophobicContact CB-CG2 4.15Å; D25-V27 PolarHBondContact O-N 3.47Å; V27-A29 WeakPolarHBondContact CG1-O 3.41Å; V27-T41 HydrophobicContact CG1-CG2 4.39Å; V27-A42 CarbonylContact C-O 3.53Å; V27-A42 WeakPolarHBondContact CA-O 3.45Å; V27-A42 WeakPolarHBondContact CG1-O 3.28Å
28	T	91.5	Very high	85.7	Confident	56 Å²	56	76.3 Å²	76.3	34%	0.344	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	-25	-176.5	59.1	0	0	0	0	112.4	A42 E44 C71	T28-A42 PolarHBondContact N-O 3.45Å; T28-E44 HydrophobicContact CG2-CG 3.4Å; T28-C71 PolarHBondContact OG1-O 2.78Å
29	A	89.6	Confident	85.9	Confident	21 Å²	21	74.5 Å²	74.5	17%	0.174	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.2	148.6	-179.8	0	0	0	0	0	112.4	V27 T41 A42 M74	V27-A29 WeakPolarHBondContact CG1-O 3.41Å; A29-T41 CarbonylContact O-C 3.56Å; A29-T41 VanDerWaalsContact O-CA 3.3Å; A29-T41 WeakPolarHBondContact O-CA 3.26Å; A29-A42 PolarHBondContact N-O 3.44Å; A29-A42 PolarHBondContact O-N 2.83Å; A29-M74 HydrophobicContact CB-CB 4.14Å; A29-M74 HydrophobicContact CB-CG 3.79Å; A29-M74 HydrophobicContact CB-SD 3.48Å; A29-M74 WeakPolarHBondContact CB-SD 3.34Å
30	A	90.5	Very high	86	Confident	65 Å²	65	67.5 Å²	67.5	54%	0.537	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.3	136.2	173.9	0	0	0	0	0	110.6	I40 T41	A30-I40 CarbonylContact C-O 3.59Å; A30-I40 VanDerWaalsContact CA-O 3.28Å; A30-I40 WeakPolarHBondContact CA-O 3.09Å; A30-T41 HydrophobicContact CB-CG2 4.11Å
31	L	90.2	Very high	86.1	Confident	44 Å²	44	65.3 Å²	65.3	23%	0.23	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	137	-179.8	-64.4	176.1	0	0	0	110.3	V39 I40 M74	L31-V39 CarbonylContact O-C 3.48Å; L31-V39 WeakPolarHBondContact O-CA 3.18Å; L31-I40 HydrophobicContact CB-CB 4.48Å; L31-I40 PolarHBondContact N-O 3.09Å; L31-I40 PolarHBondContact O-N 3.12Å; L31-M74 HydrophobicContact CD1-CB 3.88Å; L31-M74 HydrophobicContact CD1-CE 3.71Å; L31-M74 HydrophobicContact CG-CE 4.27Å
32	L	87.3	Confident	86.3	Confident	126 Å²	126	58.8 Å²	58.8	66%	0.66	33%	0.33	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.6	138.8	174.2	-62.7	177.7	0	0	0	110.2	P34 V39	L32-P34 WeakPolarHBondContact O-CD 3.28Å; L32-V39 HydrophobicContact CD2-CG1 4.49Å; L32-V39 HydrophobicContact CD2-CG2 3.83Å
33	I	83.8	Confident	86.6	Confident	8 Å²	8	57.5 Å²	57.5	4%	0.041	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	101.3	169.6	-52.6	175	0	0	0	107.1	K35 E36 G38 I40 V50 T97	I33-K35 PolarHBondContact O-N 2.76Å; I33-E36 HydrophobicContact CG2-CB 3.98Å; I33-E36 HydrophobicContact CG2-CG 3.9Å; I33-G38 PolarHBondContact N-O 2.77Å; I33-I40 HydrophobicContact CD1-CD1 3.83Å; I33-I40 HydrophobicContact CD1-CG1 3.6Å; I33-I40 HydrophobicContact CG1-CD1 3.77Å; I33-I40 HydrophobicContact CG1-CG1 3.57Å; I33-V50 HydrophobicContact CD1-CG1 3.86Å; I33-T97 HydrophobicContact CD1-CG2 3.75Å; I33-T97 HydrophobicContact CG1-CG2 4.32Å; I33-T97 HydrophobicContact CG2-CG2 4.47Å
34	P	71.6	Confident	86.7	Confident	65 Å²	65	60.9 Å²	60.9	42%	0.422	33%	0.333	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.4	139.8	174.6	25.8	-31.5	0	0	0	109.5	L32 Y76 H78	L32-P34 WeakPolarHBondContact O-CD 3.28Å; P34-Y76 HydrophobicContact CG-CE1 4.43Å; P34-H78 VanDerWaalsContact CG-ND1 3.26Å; P34-H78 WeakPolarHBondContact CG-ND1 3.19Å
35	K	73.1	Confident	86.7	Confident	186 Å²	186	54.5 Å²	54.5	81%	0.809	30%	0.304	S	S	*	.	T	Hydrogen-bonded Turn	trans	87.4	-26	-178.8	-52.2	-178.3	176	-174.2	0	117.3	I33	I33-K35 PolarHBondContact O-N 2.76Å
36	E	71.9	Confident	86.6	Confident	87 Å²	87	56.4 Å²	56.4	41%	0.407	31%	0.305	S	S	.	.	T	Hydrogen-bonded Turn	trans	-107.4	7.9	-173.3	-54	-69.9	166.1	0	0	113.1	I33 G38 L52 R81	I33-E36 HydrophobicContact CG2-CB 3.98Å; I33-E36 HydrophobicContact CG2-CG 3.9Å; E36-G38 PolarHBondContact O-N 2.82Å; E36-G38 VanDerWaalsContact O-N 3.12Å; E36-L52 HydrophobicContact CB-CD2 4.48Å; E36-R81 IonicContact OE1-NH1 3.42Å; E36-R81 PolarHBondContact OE1-NH1 2.99Å
37	D	81.4	Confident	86.4	Confident	104 Å²	104	54.1 Å²	54.1	56%	0.556	29%	0.286	S	S	*	.	T	Hydrogen-bonded Turn	trans	43.5	46	-171.7	-82.4	-2.8	0	0	0	112.3	K53	D37-K53 HydrophobicContact CB-CB 4.01Å; D37-K53 HydrophobicContact CB-CD 4.23Å; D37-K53 WeakPolarHBondContact O-CB 3.4Å; D37-K53 PolarHBondContact O-N 2.92Å; D37-K53 VanDerWaalsContact O-N 3.1Å
38	G	86	Confident	86.2	Confident	3 Å²	3	50.4 Å²	50.4	3%	0.031	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	157.6	-173.7	0	0	0	0	0	113.6	I33 E36 W51	I33-G38 PolarHBondContact N-O 2.77Å; E36-G38 PolarHBondContact O-N 2.82Å; E36-G38 VanDerWaalsContact O-N 3.12Å; G38-W51 CarbonylContact C-O 3.6Å; G38-W51 WeakPolarHBondContact CA-O 3.33Å
39	V	89.4	Confident	86	Confident	18 Å²	18	49.2 Å²	49.2	11%	0.109	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	136.8	174.5	-169.4	0	0	0	0	108.9	L31 L32 T41 V50 W51 Y59	L31-V39 CarbonylContact O-C 3.48Å; L31-V39 WeakPolarHBondContact O-CA 3.18Å; L32-V39 HydrophobicContact CD2-CG1 4.49Å; L32-V39 HydrophobicContact CD2-CG2 3.83Å; V39-T41 HydrophobicContact CG1-CG2 3.98Å; V39-V50 CarbonylContact O-C 3.57Å; V39-V50 WeakPolarHBondContact O-CA 3.49Å; V39-W51 HydrophobicContact CB-CB 4.35Å; V39-W51 PolarHBondContact N-O 3.1Å; V39-W51 PolarHBondContact O-N 2.82Å; V39-Y59 HydrophobicContact CG2-CE1 3.89Å
40	I	88.9	Confident	86	Confident	1 Å²	1	48.2 Å²	48.2	1%	0.005	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	129.7	170.1	-48.7	-173.3	0	0	0	107.2	A30 L31 I33 I48 R49 V50 M74 I83 T97	A30-I40 CarbonylContact C-O 3.59Å; A30-I40 VanDerWaalsContact CA-O 3.28Å; A30-I40 WeakPolarHBondContact CA-O 3.09Å; L31-I40 HydrophobicContact CB-CB 4.48Å; L31-I40 PolarHBondContact N-O 3.09Å; L31-I40 PolarHBondContact O-N 3.12Å; I33-I40 HydrophobicContact CD1-CD1 3.83Å; I33-I40 HydrophobicContact CD1-CG1 3.6Å; I33-I40 HydrophobicContact CG1-CD1 3.77Å; I33-I40 HydrophobicContact CG1-CG1 3.57Å; I40-I48 HydrophobicContact CG2-CG2 3.67Å; I40-R49 CarbonylContact C-O 3.55Å; I40-R49 WeakPolarHBondContact CA-O 3.11Å; I40-V50 HydrophobicContact CG1-CG2 4.2Å; I40-V50 HydrophobicContact CG2-CG2 4.28Å; I40-M74 HydrophobicContact CG2-CE 3.88Å; I40-I83 HydrophobicContact CD1-CD1 3.28Å; I40-I83 HydrophobicContact CD1-CG1 4.05Å; I40-T97 HydrophobicContact CD1-CG2 3.93Å
41	T	90.9	Very high	85.8	Confident	14 Å²	14	45.4 Å²	45.4	9%	0.086	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-125	145.6	177.5	55.8	0	0	0	0	110	H23 V27 A29 A30 V39 I48 R49 W51	H23-T41 PolarHBondContact CD2-OG1 2.91Å; H23-T41 WeakPolarHBondContact NE2-CB 3.3Å; H23-T41 PolarHBondContact NE2-OG1 2.94Å; V27-T41 HydrophobicContact CG1-CG2 4.39Å; A29-T41 CarbonylContact O-C 3.56Å; A29-T41 VanDerWaalsContact O-CA 3.3Å; A29-T41 WeakPolarHBondContact O-CA 3.26Å; A30-T41 HydrophobicContact CB-CG2 4.11Å; V39-T41 HydrophobicContact CG1-CG2 3.98Å; T41-I48 CarbonylContact O-C 3.45Å; T41-I48 VanDerWaalsContact O-CA 3.31Å; T41-I48 WeakPolarHBondContact O-CA 3.48Å; T41-R49 PolarHBondContact N-O 2.86Å; T41-R49 PolarHBondContact O-N 3.4Å; T41-W51 PolarHBondContact OG1-NE1 3.37Å
42	A	90	Very high	85.6	Confident	0 Å²	0	45.7 Å²	45.7	0%	0	22%	0.221	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	150.1	165.5	0	0	0	0	0	110	V27 T28 A29 T47 I48 C71 M74	V27-A42 CarbonylContact C-O 3.53Å; V27-A42 WeakPolarHBondContact CA-O 3.45Å; V27-A42 WeakPolarHBondContact CG1-O 3.28Å; T28-A42 PolarHBondContact N-O 3.45Å; A29-A42 PolarHBondContact N-O 3.44Å; A29-A42 PolarHBondContact O-N 2.83Å; A42-T47 WeakPolarHBondContact CA-O 3.49Å; A42-I48 HydrophobicContact CB-CG1 4.25Å; A42-C71 HydrophobicContact CB-CB 3.75Å; A42-M74 HydrophobicContact CB-CG 4.27Å; A42-M74 HydrophobicContact CB-SD 3.24Å; A42-M74 WeakPolarHBondContact CB-SD 3.38Å
43	S	90.1	Very high	85.5	Confident	0 Å²	0	44.2 Å²	44.2	0%	0	21%	0.209	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-137.3	159.9	-175.7	168.9	0	0	0	0	111.8	H23 D25 A26 D45 R46 T47	H23-S43 WeakPolarHBondContact ND1-CB 3.22Å; D25-S43 PolarHBondContact O-OG 3.5Å; D25-S43 VanDerWaalsContact O-OG 3.11Å; A26-S43 CarbonylContact O-C 3.56Å; A26-S43 WeakPolarHBondContact O-CA 3.44Å; A26-S43 VanDerWaalsContact O-CB 3.25Å; A26-S43 WeakPolarHBondContact O-CB 3.35Å; A26-S43 PolarHBondContact O-OG 2.8Å; S43-D45 WeakPolarHBondContact CB-OD1 3.18Å; S43-D45 PolarHBondContact O-N 3.23Å; S43-D45 PolarHBondContact OG-N 3.25Å; S43-D45 VanDerWaalsContact OG-N 3.16Å; S43-D45 PolarHBondContact OG-OD1 2.99Å; S43-R46 PolarHBondContact O-N 3.26Å; S43-R46 VanDerWaalsContact O-N 3.16Å; S43-T47 PolarHBondContact N-O 2.78Å; S43-T47 VanDerWaalsContact N-O 3.14Å
44	E	91	Very high	85.5	Confident	101 Å²	101	50.1 Å²	50.1	47%	0.472	23%	0.231	S	C	.	.	T	Hydrogen-bonded Turn	trans	-61.8	-16.5	169.8	-60.2	-166	-174.1	0	0	112.5	D25 A26 T28 R46	D25-E44 HydrophobicContact CB-CB 4.16Å; A26-E44 HydrophobicContact CB-CG 4.23Å; A26-E44 PolarHBondContact O-N 3.22Å; T28-E44 HydrophobicContact CG2-CG 3.4Å; E44-R46 PolarHBondContact O-N 3.42Å
45	D	89.4	Confident	85.9	Confident	27 Å²	27	55.7 Å²	55.7	14%	0.144	26%	0.257	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65	1.5	170.7	70.4	11.4	0	0	0	113.7	H23 Q24 D25 S43 T47	H23-D45 IonicContact CE1-OD2 3.98Å; H23-D45 IonicContact CG-OD2 3.66Å; H23-D45 IonicContact ND1-OD1 3.52Å; H23-D45 IonicContact ND1-OD2 2.88Å; H23-D45 PolarHBondContact ND1-OD2 3.34Å; Q24-D45 HydrophobicContact CB-CB 4.18Å; Q24-D45 PolarHBondContact N-OD2 2.99Å; D25-D45 HydrophobicContact CB-CB 3.88Å; S43-D45 WeakPolarHBondContact CB-OD1 3.18Å; S43-D45 PolarHBondContact O-N 3.23Å; S43-D45 PolarHBondContact OG-N 3.25Å; S43-D45 VanDerWaalsContact OG-N 3.16Å; S43-D45 PolarHBondContact OG-OD1 2.99Å; D45-T47 VanDerWaalsContact C-N 3.27Å; D45-T47 HydrophobicContact CB-CG2 4.42Å; D45-T47 WeakPolarHBondContact OD1-CA 3.35Å; D45-T47 WeakPolarHBondContact OD1-CB 3.34Å; D45-T47 WeakPolarHBondContact OD1-CG2 3.48Å; D45-T47 PolarHBondContact OD1-N 2.81Å; D45-T47 PolarHBondContact OD1-OG1 2.77Å; D45-T47 PolarHBondContact OD2-OG1 3.49Å
46	R	88.6	Confident	86.2	Confident	131 Å²	131	50.8 Å²	50.8	49%	0.494	25%	0.246	S	C	.	.	S	Bend	trans	66.1	25.8	-176.9	-54.3	-179	-69.9	-105.7	-4.4	113	S43 E44 M67 P70	S43-R46 PolarHBondContact O-N 3.26Å; S43-R46 VanDerWaalsContact O-N 3.16Å; E44-R46 PolarHBondContact O-N 3.42Å; R46-M67 PolarHBondContact O-N 2.89Å; R46-P70 HydrophobicContact CG-CG 4.05Å
47	T	86.8	Confident	86.6	Confident	0 Å²	0	48.2 Å²	48.2	0%	0	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	142.9	-179.7	79.4	0	0	0	0	111.1	H23 A42 S43 D45 Y64 H65	H23-T47 PolarHBondContact CE1-OG1 3.48Å; H23-T47 PolarHBondContact ND1-OG1 2.65Å; A42-T47 WeakPolarHBondContact CA-O 3.49Å; S43-T47 PolarHBondContact N-O 2.78Å; S43-T47 VanDerWaalsContact N-O 3.14Å; D45-T47 VanDerWaalsContact C-N 3.27Å; D45-T47 HydrophobicContact CB-CG2 4.42Å; D45-T47 WeakPolarHBondContact OD1-CA 3.35Å; D45-T47 WeakPolarHBondContact OD1-CB 3.34Å; D45-T47 WeakPolarHBondContact OD1-CG2 3.48Å; D45-T47 PolarHBondContact OD1-N 2.81Å; D45-T47 PolarHBondContact OD1-OG1 2.77Å; D45-T47 PolarHBondContact OD2-OG1 3.49Å; T47-Y64 HydrophobicContact CG2-CD1 4.49Å; T47-Y64 HydrophobicContact CG2-CE1 3.6Å; T47-Y64 HydrophobicContact CG2-CE2 3.68Å; T47-Y64 WeakPolarHBondContact CG2-OH 3.24Å; T47-H65 WeakPolarHBondContact CA-O 3.06Å
48	I	88.4	Confident	86.5	Confident	1 Å²	1	48.9 Å²	48.9	1%	0.005	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-106	128.4	162.2	-56.8	168.1	0	0	0	106.8	I40 T41 A42 H65 M67 V85 M93 L100	I40-I48 HydrophobicContact CG2-CG2 3.67Å; T41-I48 CarbonylContact O-C 3.45Å; T41-I48 VanDerWaalsContact O-CA 3.31Å; T41-I48 WeakPolarHBondContact O-CA 3.48Å; A42-I48 HydrophobicContact CB-CG1 4.25Å; I48-H65 PolarHBondContact N-O 3.07Å; I48-H65 PolarHBondContact O-N 3.04Å; I48-H65 VanDerWaalsContact O-N 3.1Å; I48-M67 HydrophobicContact CD1-CE 4.28Å; I48-M67 HydrophobicContact CD1-CG 4.15Å; I48-M67 HydrophobicContact CD1-SD 3.54Å; I48-M67 VanDerWaalsContact CD1-SD 3.54Å; I48-M67 HydrophobicContact CG1-CE 3.69Å; I48-M67 HydrophobicContact CG1-CG 4.32Å; I48-M67 HydrophobicContact CG1-SD 3.66Å; I48-V85 HydrophobicContact CD1-CB 4.41Å; I48-V85 HydrophobicContact CD1-CG1 4.34Å; I48-V85 HydrophobicContact CD1-CG2 3.72Å; I48-M93 HydrophobicContact CD1-CE 3.54Å; I48-L100 HydrophobicContact CG2-CD1 4.4Å
49	R	87.7	Confident	86.4	Confident	32 Å²	32	51.6 Å²	51.6	12%	0.121	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	144.6	175.3	-66.9	-176.2	-178.3	-150.9	11.1	111	G22 I40 T41 W51 I63 Y64	G22-R49 PolarHBondContact O-NH1 2.83Å; G22-R49 PolarHBondContact O-NH2 2.76Å; I40-R49 CarbonylContact C-O 3.55Å; I40-R49 WeakPolarHBondContact CA-O 3.11Å; T41-R49 PolarHBondContact N-O 2.86Å; T41-R49 PolarHBondContact O-N 3.4Å; R49-W51 HydrophobicContact CB-CZ2 3.98Å; R49-W51 HydrophobicContact CG-CZ2 4.41Å; R49-I63 WeakPolarHBondContact CA-O 3.48Å; R49-Y64 HydrophobicContact CG-CD2 4.49Å
50	V	88.1	Confident	85.9	Confident	0 Å²	0	56 Å²	56	0%	0	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	130.4	169.6	-179.3	0	0	0	0	107.8	I33 V39 I40 L52 S62 I63 L100 L101	I33-V50 HydrophobicContact CD1-CG1 3.86Å; V39-V50 CarbonylContact O-C 3.57Å; V39-V50 WeakPolarHBondContact O-CA 3.49Å; I40-V50 HydrophobicContact CG1-CG2 4.2Å; I40-V50 HydrophobicContact CG2-CG2 4.28Å; V50-L52 HydrophobicContact CG1-CD2 4.36Å; V50-S62 PolarHBondContact O-N 3.21Å; V50-S62 PolarHBondContact O-OG 3.41Å; V50-I63 HydrophobicContact CB-CB 4.27Å; V50-I63 HydrophobicContact CB-CD1 3.84Å; V50-I63 HydrophobicContact CG1-CD1 4.17Å; V50-I63 HydrophobicContact CG2-CB 4.44Å; V50-I63 HydrophobicContact CG2-CD1 4.25Å; V50-I63 PolarHBondContact N-O 3Å; V50-L100 HydrophobicContact CG2-CB 3.82Å; V50-L100 HydrophobicContact CG2-CD1 3.71Å; V50-L100 HydrophobicContact CG2-CG 4.32Å; V50-L101 HydrophobicContact CG1-CD2 4.35Å
51	W	87.5	Confident	85.1	Confident	6 Å²	6	59.2 Å²	59.2	2%	0.023	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	116.4	-177.5	-52.6	94.2	0	0	0	107.7	I20 G38 V39 T41 R49 Y59 W60 P61	I20-W51 HydrophobicContact CD1-CB 4.28Å; I20-W51 HydrophobicContact CD1-CG 4.37Å; I20-W51 HydrophobicContact CG2-CD2 3.42Å; I20-W51 VanDerWaalsContact CG2-CD2 3.42Å; I20-W51 HydrophobicContact CG2-CE3 3.2Å; I20-W51 HydrophobicContact CG2-CG 4.09Å; I20-W51 HydrophobicContact CG2-CH2 3.71Å; I20-W51 HydrophobicContact CG2-CZ2 3.93Å; I20-W51 HydrophobicContact CG2-CZ3 3.34Å; G38-W51 CarbonylContact C-O 3.6Å; G38-W51 WeakPolarHBondContact CA-O 3.33Å; V39-W51 HydrophobicContact CB-CB 4.35Å; V39-W51 PolarHBondContact N-O 3.1Å; V39-W51 PolarHBondContact O-N 2.82Å; T41-W51 PolarHBondContact OG1-NE1 3.37Å; R49-W51 HydrophobicContact CB-CZ2 3.98Å; R49-W51 HydrophobicContact CG-CZ2 4.41Å; W51-Y59 HydrophobicContact CB-CD1 3.98Å; W51-W60 WeakPolarHBondContact CA-O 3.47Å; W51-P61 HydrophobicContact CE3-CB 3.75Å; W51-P61 HydrophobicContact CE3-CG 4.32Å; W51-P61 HydrophobicContact CH2-CB 3.95Å; W51-P61 HydrophobicContact CH2-CG 4.46Å; W51-P61 HydrophobicContact CZ3-CB 3.42Å; W51-P61 VanDerWaalsContact CZ3-CB 3.42Å; W51-P61 HydrophobicContact CZ3-CG 3.75Å
52	L	86.4	Confident	83.8	Confident	50 Å²	50	60.7 Å²	60.7	26%	0.262	30%	0.299	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.7	133.1	173.6	-63.3	178	0	0	0	109	E36 V50 Y59 W60 L101	E36-L52 HydrophobicContact CB-CD2 4.48Å; V50-L52 HydrophobicContact CG1-CD2 4.36Å; L52-Y59 WeakPolarHBondContact O-CA 3.47Å; L52-W60 PolarHBondContact N-O 2.95Å; L52-W60 PolarHBondContact O-N 3.14Å; L52-L101 HydrophobicContact CD1-CD2 3.78Å; L52-L101 HydrophobicContact CD2-CD2 4.22Å; L52-L101 HydrophobicContact CG-CD2 4.34Å
53	K	84.9	Confident	82.6	Confident	94 Å²	94	61.2 Å²	61.2	41%	0.409	30%	0.302	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.8	128	173.1	-168.1	-179.2	177.8	-168.7	0	109.1	D37 Y59	D37-K53 HydrophobicContact CB-CB 4.01Å; D37-K53 HydrophobicContact CB-CD 4.23Å; D37-K53 WeakPolarHBondContact O-CB 3.4Å; D37-K53 PolarHBondContact O-N 2.92Å; D37-K53 VanDerWaalsContact O-N 3.1Å; K53-Y59 HydrophobicContact CB-CD1 4.03Å; K53-Y59 HydrophobicContact CB-CE1 3.68Å; K53-Y59 HydrophobicContact CG-CE1 4.31Å; K53-Y59 HydrophobicContact CG-CE2 4.38Å
54	R	82.8	Confident	81.7	Confident	133 Å²	133	67.4 Å²	67.4	50%	0.502	33%	0.326	S	S	.	.	P	Polyproline II helix	trans	-90.4	168.9	171	-65.4	-165.7	-175.5	174.9	2	110.9	S56 G57 Q58 W60	R54-S56 PolarHBondContact O-N 2.7Å; R54-S56 VanDerWaalsContact O-N 3.09Å; R54-G57 PolarHBondContact O-N 3.48Å; R54-Q58 PolarHBondContact N-O 2.86Å; R54-W60 HydrophobicContact CG-CG 4.25Å; R54-W60 VanDerWaalsContact CZ-CD2 3.42Å; R54-W60 VanDerWaalsContact CZ-CG 3.5Å; R54-W60 VanDerWaalsContact NE-CD1 3.28Å; R54-W60 VanDerWaalsContact NE-CG 3.29Å
55	D	80.6	Confident	81.1	Confident	181 Å²	181	66.3 Å²	66.3	97%	0.968	32%	0.321	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57	-26.5	176.7	-56.8	-37.9	0	0	0	113.2	G57	D55-G57 PolarHBondContact O-N 2.79Å
56	S	80.1	Confident	80.7	Confident	83 Å²	83	69.2 Å²	69.2	58%	0.58	34%	0.34	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.8	-3.8	174.2	63.8	0	0	0	0	114.2	R54 Q58	R54-S56 PolarHBondContact O-N 2.7Å; R54-S56 VanDerWaalsContact O-N 3.09Å; S56-Q58 PolarHBondContact O-N 2.85Å
57	G	78.6	Confident	80.4	Confident	34 Å²	34	63.4 Å²	63.4	35%	0.351	32%	0.319	S	S	.	.	S	Bend	trans	78.2	-1.8	-174.8	0	0	0	0	0	114.3	R54 D55	R54-G57 PolarHBondContact O-N 3.48Å; D55-G57 PolarHBondContact O-N 2.79Å
58	Q	81	Confident	80.3	Confident	117 Å²	117	67.7 Å²	67.7	55%	0.547	35%	0.354	S	S	.	.			trans	-86.2	141.6	175.7	-70.3	-177.5	-17.8	0	0	111.5	R54 S56	R54-Q58 PolarHBondContact N-O 2.86Å; S56-Q58 PolarHBondContact O-N 2.85Å
59	Y	83.1	Confident	80.3	Confident	61 Å²	61	68.4 Å²	68.4	24%	0.239	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.8	131.4	170.8	-73	-89.4	0	0	0	110	I20 V39 W51 L52 K53	I20-Y59 HydrophobicContact CD1-CD1 3.76Å; I20-Y59 HydrophobicContact CD1-CD2 3.58Å; I20-Y59 HydrophobicContact CD1-CE1 4.3Å; I20-Y59 HydrophobicContact CD1-CE2 4.14Å; I20-Y59 HydrophobicContact CD1-CG 3.35Å; I20-Y59 HydrophobicContact CG1-CD2 3.8Å; I20-Y59 HydrophobicContact CG1-CG 3.87Å; V39-Y59 HydrophobicContact CG2-CE1 3.89Å; W51-Y59 HydrophobicContact CB-CD1 3.98Å; L52-Y59 WeakPolarHBondContact O-CA 3.47Å; K53-Y59 HydrophobicContact CB-CD1 4.03Å; K53-Y59 HydrophobicContact CB-CE1 3.68Å; K53-Y59 HydrophobicContact CG-CE1 4.31Å; K53-Y59 HydrophobicContact CG-CE2 4.38Å
60	W	79.1	Confident	80.2	Confident	110 Å²	110	68.7 Å²	68.7	42%	0.417	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	134.3	176.5	-77.5	72.9	0	0	0	110.2	W51 L52 R54 S62	W51-W60 WeakPolarHBondContact CA-O 3.47Å; L52-W60 PolarHBondContact N-O 2.95Å; L52-W60 PolarHBondContact O-N 3.14Å; R54-W60 HydrophobicContact CG-CG 4.25Å; R54-W60 VanDerWaalsContact CZ-CD2 3.42Å; R54-W60 VanDerWaalsContact CZ-CG 3.5Å; R54-W60 VanDerWaalsContact NE-CD1 3.28Å; R54-W60 VanDerWaalsContact NE-CG 3.29Å; W60-S62 PolarHBondContact O-N 2.95Å
61	P	71.2	Confident	80.2	Confident	68 Å²	68	68.8 Å²	68.8	44%	0.442	37%	0.366	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.4	106.8	171.5	25.1	-26	0	0	0	107.1	W51	W51-P61 HydrophobicContact CE3-CB 3.75Å; W51-P61 HydrophobicContact CE3-CG 4.32Å; W51-P61 HydrophobicContact CH2-CB 3.95Å; W51-P61 HydrophobicContact CH2-CG 4.46Å; W51-P61 HydrophobicContact CZ3-CB 3.42Å; W51-P61 VanDerWaalsContact CZ3-CB 3.42Å; W51-P61 HydrophobicContact CZ3-CG 3.75Å
62	S	65	Low	80.2	Confident	45 Å²	45	72.1 Å²	72.1	32%	0.315	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.7	-33.1	178.8	53.3	0	0	0	0	111.3	V50 W60	V50-S62 PolarHBondContact O-N 3.21Å; V50-S62 PolarHBondContact O-OG 3.41Å; W60-S62 PolarHBondContact O-N 2.95Å
63	I	64.5	Low	80.2	Confident	11 Å²	11	72.4 Å²	72.4	6%	0.056	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.5	139.6	-165.4	-59.4	128.7	0	0	0	113	R49 V50 L100 L101	R49-I63 WeakPolarHBondContact CA-O 3.48Å; V50-I63 HydrophobicContact CB-CB 4.27Å; V50-I63 HydrophobicContact CB-CD1 3.84Å; V50-I63 HydrophobicContact CG1-CD1 4.17Å; V50-I63 HydrophobicContact CG2-CB 4.44Å; V50-I63 HydrophobicContact CG2-CD1 4.25Å; V50-I63 PolarHBondContact N-O 3Å; I63-L100 HydrophobicContact CD1-CB 4.38Å; I63-L100 VanDerWaalsContact CD1-O 3.23Å; I63-L100 WeakPolarHBondContact CD1-O 3.16Å; I63-L100 WeakPolarHBondContact CG1-O 3.25Å; I63-L100 HydrophobicContact CG2-CB 3.93Å; I63-L100 HydrophobicContact CG2-CD2 4.11Å; I63-L100 WeakPolarHBondContact CG2-O 3.28Å; I63-L101 HydrophobicContact CD1-CB 4.3Å; I63-L101 HydrophobicContact CD1-CD2 3.74Å; I63-L101 HydrophobicContact CD1-CG 4.15Å
64	Y	70.2	Confident	80.4	Confident	130 Å²	130	69.5 Å²	69.5	51%	0.51	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	122.2	175.4	-157.2	-88.2	0	0	0	109.2	T47 R49 T66	T47-Y64 HydrophobicContact CG2-CD1 4.49Å; T47-Y64 HydrophobicContact CG2-CE1 3.6Å; T47-Y64 HydrophobicContact CG2-CE2 3.68Å; T47-Y64 WeakPolarHBondContact CG2-OH 3.24Å; R49-Y64 HydrophobicContact CG-CD2 4.49Å; Y64-T66 VanDerWaalsContact CE1-OG1 3.31Å; Y64-T66 WeakPolarHBondContact CE1-OG1 3.48Å
65	H	78.1	Confident	80.7	Confident	78 Å²	78	65.7 Å²	65.7	36%	0.361	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	123.2	163.4	-161.6	79	0	0	0	109.5	T47 I48 L100	T47-H65 WeakPolarHBondContact CA-O 3.06Å; I48-H65 PolarHBondContact N-O 3.07Å; I48-H65 PolarHBondContact O-N 3.04Å; I48-H65 VanDerWaalsContact O-N 3.1Å; H65-L100 HydrophobicContact CB-CD2 3.92Å
66	T	81.1	Confident	81	Confident	88 Å²	88	58.7 Å²	58.7	54%	0.54	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.4	125.7	177.8	-45.6	0	0	0	0	109.1	Y64	Y64-T66 VanDerWaalsContact CE1-OG1 3.31Å; Y64-T66 WeakPolarHBondContact CE1-OG1 3.48Å
67	M	83.1	Confident	81.3	Confident	9 Å²	9	59.1 Å²	59.1	4%	0.044	34%	0.338	C	S	.	.			trans	-93	158.7	174.9	-64	178.6	-67.6	0	0	110.7	R46 I48 S69 C71 V85 Q87 M93	R46-M67 PolarHBondContact O-N 2.89Å; I48-M67 HydrophobicContact CD1-CE 4.28Å; I48-M67 HydrophobicContact CD1-CG 4.15Å; I48-M67 HydrophobicContact CD1-SD 3.54Å; I48-M67 VanDerWaalsContact CD1-SD 3.54Å; I48-M67 HydrophobicContact CG1-CE 3.69Å; I48-M67 HydrophobicContact CG1-CG 4.32Å; I48-M67 HydrophobicContact CG1-SD 3.66Å; M67-S69 VanDerWaalsContact C-N 3.26Å; M67-S69 WeakPolarHBondContact CB-O 3.45Å; M67-S69 PolarHBondContact O-N 2.95Å; M67-C71 HydrophobicContact CE-CB 3.8Å; M67-C71 HydrophobicContact SD-CB 4.44Å; M67-V85 HydrophobicContact SD-CG1 3.65Å; M67-Q87 HydrophobicContact SD-CG 4.48Å; M67-M93 HydrophobicContact CG-CE 4.02Å; M67-M93 HydrophobicContact CG-SD 4.44Å; M67-M93 HydrophobicContact SD-CE 4.27Å
68	A	84.9	Confident	81.4	Confident	90 Å²	90	63.2 Å²	63.2	74%	0.744	35%	0.348	S	S	*	.	S	Bend	trans	-72.2	-23.9	176.4	0	0	0	0	0	112.3
69	S	87.8	Confident	81.5	Confident	16 Å²	16	64.9 Å²	64.9	11%	0.112	36%	0.36	C	S	.	.	S	Bend	trans	-148.1	157.2	-175.3	175.5	0	0	0	0	110.4	M67 Q87 N89	M67-S69 VanDerWaalsContact C-N 3.26Å; M67-S69 WeakPolarHBondContact CB-O 3.45Å; M67-S69 PolarHBondContact O-N 2.95Å; S69-Q87 VanDerWaalsContact N-OE1 3.17Å; S69-N89 PolarHBondContact OG-N 2.96Å
70	P	86.6	Confident	81.4	Confident	38 Å²	38	63.9 Å²	63.9	25%	0.247	36%	0.363	C	S	.	.			trans	-56.5	153.5	176.3	-26	36.2	0	0	0	112.9	R46 Q87 D88	R46-P70 HydrophobicContact CG-CG 4.05Å; P70-Q87 WeakPolarHBondContact O-CA 3.49Å; P70-D88 PolarHBondContact O-N 3.47Å
71	C	87.6	Confident	81.4	Confident	3 Å²	3	63.5 Å²	63.5	2%	0.02	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.3	122.3	178.9	172.9	0	0	0	0	110.6	T28 A42 M67 M74 V85	T28-C71 PolarHBondContact OG1-O 2.78Å; A42-C71 HydrophobicContact CB-CB 3.75Å; M67-C71 HydrophobicContact CE-CB 3.8Å; M67-C71 HydrophobicContact SD-CB 4.44Å; C71-M74 WeakPolarHBondContact SG-CG 3.31Å; C71-V85 HydrophobicContact CB-CG1 3.97Å; C71-V85 WeakPolarHBondContact SG-CG1 3.48Å
72	S	87.8	Confident	82.1	Confident	76 Å²	76	66 Å²	66	53%	0.531	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	-28.2	171.9	28.1	0	0	0	0	113.3	G86 D88	S72-G86 PolarHBondContact N-O 3.45Å; S72-G86 PolarHBondContact OG-O 2.89Å; S72-D88 WeakPolarHBondContact CB-OD1 3.16Å; S72-D88 PolarHBondContact OG-OD1 3.24Å
73	A	86.1	Confident	83.2	Confident	56 Å²	56	63.9 Å²	63.9	46%	0.463	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152	147.1	-177.9	0	0	0	0	0	112.5	V85 G86	A73-V85 WeakPolarHBondContact O-CA 3.27Å; A73-G86 PolarHBondContact N-O 2.93Å; A73-G86 PolarHBondContact O-N 3.32Å
74	M	89.1	Confident	84.3	Confident	32 Å²	32	67.2 Å²	67.2	16%	0.158	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	143	172.9	-63.8	179.2	56	0	0	111.6	A29 L31 I40 A42 C71 I83 F84 V85	A29-M74 HydrophobicContact CB-CB 4.14Å; A29-M74 HydrophobicContact CB-CG 3.79Å; A29-M74 HydrophobicContact CB-SD 3.48Å; A29-M74 WeakPolarHBondContact CB-SD 3.34Å; L31-M74 HydrophobicContact CD1-CB 3.88Å; L31-M74 HydrophobicContact CD1-CE 3.71Å; L31-M74 HydrophobicContact CG-CE 4.27Å; I40-M74 HydrophobicContact CG2-CE 3.88Å; A42-M74 HydrophobicContact CB-CG 4.27Å; A42-M74 HydrophobicContact CB-SD 3.24Å; A42-M74 WeakPolarHBondContact CB-SD 3.38Å; C71-M74 WeakPolarHBondContact SG-CG 3.31Å; M74-I83 HydrophobicContact CE-CG2 3.97Å; M74-F84 CarbonylContact C-O 3.6Å; M74-F84 WeakPolarHBondContact CA-O 3.44Å; M74-V85 HydrophobicContact CG-CG1 4.3Å; M74-V85 HydrophobicContact CG-CG2 4.23Å
75	A	89	Confident	85.2	Confident	54 Å²	54	61 Å²	61	45%	0.446	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	133.9	171.2	0	0	0	0	0	110.3	I83 F84	A75-I83 CarbonylContact O-C 3.58Å; A75-I83 WeakPolarHBondContact O-CA 3.48Å; A75-F84 HydrophobicContact CB-CB 4.47Å; A75-F84 PolarHBondContact N-O 2.89Å; A75-F84 PolarHBondContact O-N 3.18Å
76	Y	86.6	Confident	85.8	Confident	33 Å²	33	58.1 Å²	58.1	13%	0.129	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	127.6	176.1	-179.9	-118.8	0	0	0	111.2	P34 H78 R82 I83 T97	P34-Y76 HydrophobicContact CG-CE1 4.43Å; Y76-H78 AromaticContact CD1-CE1 3.56Å; Y76-H78 AromaticContact CD1-CG 3.98Å; Y76-H78 AromaticContact CD1-ND1 3.41Å; Y76-H78 WeakPolarHBondContact CD1-ND1 3.17Å; Y76-H78 HydrophobicContact CE1-CB 4.37Å; Y76-H78 AromaticContact CE1-CE1 3.86Å; Y76-H78 AromaticContact CE1-CG 3.95Å; Y76-H78 AromaticContact CE1-ND1 3.28Å; Y76-H78 VanDerWaalsContact CE1-ND1 3.28Å; Y76-H78 WeakPolarHBondContact CE1-ND1 3.36Å; Y76-R82 VanDerWaalsContact CD2-O 3.22Å; Y76-R82 WeakPolarHBondContact CD2-O 3.37Å; Y76-I83 HydrophobicContact CD2-CG1 3.53Å; Y76-I83 HydrophobicContact CE2-CG1 4.02Å; Y76-T97 WeakPolarHBondContact CE2-OG1 3.25Å
77	H	87.4	Confident	86.2	Confident	93 Å²	93	54.8 Å²	54.8	43%	0.431	31%	0.306	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	108.1	173.2	-169.5	-94	0	0	0	109.4	D79 S80 R81 R82	H77-D79 PolarHBondContact O-N 3.11Å; H77-S80 WeakPolarHBondContact ND1-CB 3.19Å; H77-S80 PolarHBondContact ND1-N 3.16Å; H77-S80 PolarHBondContact ND1-OG 3.18Å; H77-R81 WeakPolarHBondContact O-CA 3.49Å; H77-R81 PolarHBondContact O-N 3.21Å; H77-R82 PolarHBondContact N-O 3.1Å; H77-R82 PolarHBondContact O-N 2.81Å
78	H	80.2	Confident	86.5	Confident	119 Å²	119	59.3 Å²	59.3	55%	0.551	33%	0.331	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.4	-44.9	-171.9	-66.4	-76.1	0	0	0	113.7	P34 Y76 R81	P34-H78 VanDerWaalsContact CG-ND1 3.26Å; P34-H78 WeakPolarHBondContact CG-ND1 3.19Å; Y76-H78 AromaticContact CD1-CE1 3.56Å; Y76-H78 AromaticContact CD1-CG 3.98Å; Y76-H78 AromaticContact CD1-ND1 3.41Å; Y76-H78 WeakPolarHBondContact CD1-ND1 3.17Å; Y76-H78 HydrophobicContact CE1-CB 4.37Å; Y76-H78 AromaticContact CE1-CE1 3.86Å; Y76-H78 AromaticContact CE1-CG 3.95Å; Y76-H78 AromaticContact CE1-ND1 3.28Å; Y76-H78 VanDerWaalsContact CE1-ND1 3.28Å; Y76-H78 WeakPolarHBondContact CE1-ND1 3.36Å; H78-R81 PolarHBondContact O-N 3.29Å
79	D	82.5	Confident	86.6	Confident	152 Å²	152	59.4 Å²	59.4	81%	0.813	32%	0.318	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.2	-44.8	-173.5	-175.5	49.1	0	0	0	111.9	H77 R81	H77-D79 PolarHBondContact O-N 3.11Å; D79-R81 VanDerWaalsContact C-N 3.34Å; D79-R81 PolarHBondContact O-N 3.16Å
80	S	81.6	Confident	86.6	Confident	41 Å²	41	61.9 Å²	61.9	29%	0.287	35%	0.347	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.9	-3.4	179.8	71.3	0	0	0	0	114.2	H77 R82	H77-S80 WeakPolarHBondContact ND1-CB 3.19Å; H77-S80 PolarHBondContact ND1-N 3.16Å; H77-S80 PolarHBondContact ND1-OG 3.18Å; S80-R82 PolarHBondContact O-N 3.24Å
81	R	79.9	Confident	86.7	Confident	101 Å²	101	62 Å²	62	38%	0.381	35%	0.351	S	S	.	.	T	Hydrogen-bonded Turn	trans	47.3	43.4	-172.9	-57.4	-175	-178.1	-152.6	0.6	112.3	E36 H77 H78 D79 T97	E36-R81 IonicContact OE1-NH1 3.42Å; E36-R81 PolarHBondContact OE1-NH1 2.99Å; H77-R81 WeakPolarHBondContact O-CA 3.49Å; H77-R81 PolarHBondContact O-N 3.21Å; H78-R81 PolarHBondContact O-N 3.29Å; D79-R81 VanDerWaalsContact C-N 3.34Å; D79-R81 PolarHBondContact O-N 3.16Å; R81-T97 PolarHBondContact O-N 2.88Å; R81-T97 PolarHBondContact O-OG1 2.82Å
82	R	85.9	Confident	86.7	Confident	122 Å²	122	66.4 Å²	66.4	46%	0.46	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	141	178.7	-72.1	-175.3	-179.7	-163.7	-0.1	110.5	Y76 H77 S80 F84 R96	Y76-R82 VanDerWaalsContact CD2-O 3.22Å; Y76-R82 WeakPolarHBondContact CD2-O 3.37Å; H77-R82 PolarHBondContact N-O 3.1Å; H77-R82 PolarHBondContact O-N 2.81Å; S80-R82 PolarHBondContact O-N 3.24Å; R82-F84 HydrophobicContact CB-CE2 4.17Å; R82-F84 HydrophobicContact CB-CZ 4.39Å; R82-R96 HydrophobicContact CG-CG 4.25Å
83	I	86.9	Confident	86.6	Confident	0 Å²	0	64.4 Å²	64.4	0%	0	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	132.7	175.6	-53.1	150.7	0	0	0	106.3	I40 M74 A75 Y76 V85 P94 T95 L100	I40-I83 HydrophobicContact CD1-CD1 3.28Å; I40-I83 HydrophobicContact CD1-CG1 4.05Å; M74-I83 HydrophobicContact CE-CG2 3.97Å; A75-I83 CarbonylContact O-C 3.58Å; A75-I83 WeakPolarHBondContact O-CA 3.48Å; Y76-I83 HydrophobicContact CD2-CG1 3.53Å; Y76-I83 HydrophobicContact CE2-CG1 4.02Å; I83-V85 HydrophobicContact CG2-CG2 3.86Å; I83-P94 WeakPolarHBondContact O-CA 3.41Å; I83-T95 HydrophobicContact CB-CG2 3.82Å; I83-T95 HydrophobicContact CD1-CG2 4.13Å; I83-T95 HydrophobicContact CG2-CG2 4.39Å; I83-T95 PolarHBondContact N-O 2.87Å; I83-T95 PolarHBondContact O-N 2.87Å; I83-T95 VanDerWaalsContact O-O 3.12Å; I83-L100 HydrophobicContact CD1-CD1 3.55Å
84	F	88.6	Confident	86.4	Confident	81 Å²	81	65.8 Å²	65.8	36%	0.355	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	130.3	171.5	-60.2	-86.3	0	0	0	107.7	M74 A75 R82 V92 P94	M74-F84 CarbonylContact C-O 3.6Å; M74-F84 WeakPolarHBondContact CA-O 3.44Å; A75-F84 HydrophobicContact CB-CB 4.47Å; A75-F84 PolarHBondContact N-O 2.89Å; A75-F84 PolarHBondContact O-N 3.18Å; R82-F84 HydrophobicContact CB-CE2 4.17Å; R82-F84 HydrophobicContact CB-CZ 4.39Å; F84-V92 HydrophobicContact CB-CG1 4.32Å; F84-V92 HydrophobicContact CD1-CG1 4.44Å; F84-P94 HydrophobicContact CD1-CB 3.96Å; F84-P94 HydrophobicContact CE1-CB 3.92Å
85	V	88.5	Confident	85.9	Confident	0 Å²	0	65.1 Å²	65.1	0%	0	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	116.6	-179.2	-173.8	0	0	0	0	108.8	I48 M67 C71 A73 M74 I83 V92 M93	I48-V85 HydrophobicContact CD1-CB 4.41Å; I48-V85 HydrophobicContact CD1-CG1 4.34Å; I48-V85 HydrophobicContact CD1-CG2 3.72Å; M67-V85 HydrophobicContact SD-CG1 3.65Å; C71-V85 HydrophobicContact CB-CG1 3.97Å; C71-V85 WeakPolarHBondContact SG-CG1 3.48Å; A73-V85 WeakPolarHBondContact O-CA 3.27Å; M74-V85 HydrophobicContact CG-CG1 4.3Å; M74-V85 HydrophobicContact CG-CG2 4.23Å; I83-V85 HydrophobicContact CG2-CG2 3.86Å; V85-V92 CarbonylContact O-C 3.56Å; V85-V92 WeakPolarHBondContact O-CA 3.35Å; V85-M93 PolarHBondContact N-O 3.34Å; V85-M93 PolarHBondContact O-N 3.1Å
86	G	90.1	Very high	85.2	Confident	17 Å²	17	69.4 Å²	69.4	18%	0.175	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	129.2	171.1	0	0	0	0	0	109.7	S72 A73	S72-G86 PolarHBondContact N-O 3.45Å; S72-G86 PolarHBondContact OG-O 2.89Å; A73-G86 PolarHBondContact N-O 2.93Å; A73-G86 PolarHBondContact O-N 3.32Å
87	Q	90.3	Very high	84.2	Confident	18 Å²	18	68 Å²	68	8%	0.084	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	153.8	177.3	-71.9	171.5	87.3	0	0	110.6	M67 S69 P70 N89 G90 A91	M67-Q87 HydrophobicContact SD-CG 4.48Å; S69-Q87 VanDerWaalsContact N-OE1 3.17Å; P70-Q87 WeakPolarHBondContact O-CA 3.49Å; Q87-N89 WeakPolarHBondContact CB-OD1 3.23Å; Q87-N89 PolarHBondContact O-N 3.24Å; Q87-G90 PolarHBondContact O-N 3.19Å; Q87-A91 WeakPolarHBondContact CB-O 3.15Å; Q87-A91 PolarHBondContact N-O 3Å
88	D	88.4	Confident	82.9	Confident	104 Å²	104	66 Å²	66	56%	0.556	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.5	-18.8	-177.5	-64	-12.1	0	0	0	113.6	P70 S72 G90	P70-D88 PolarHBondContact O-N 3.47Å; S72-D88 WeakPolarHBondContact CB-OD1 3.16Å; S72-D88 PolarHBondContact OG-OD1 3.24Å; D88-G90 PolarHBondContact O-N 3.37Å
89	N	88.5	Confident	81.8	Confident	91 Å²	91	63.7 Å²	63.7	49%	0.487	36%	0.358	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.3	3.8	170.9	67.1	4.2	0	0	0	113.8	S69 Q87 A91	S69-N89 PolarHBondContact OG-N 2.96Å; Q87-N89 WeakPolarHBondContact CB-OD1 3.23Å; Q87-N89 PolarHBondContact O-N 3.24Å; N89-A91 VanDerWaalsContact C-N 3.29Å; N89-A91 PolarHBondContact O-N 3.21Å; N89-A91 WeakPolarHBondContact OD1-CB 2.98Å; N89-A91 PolarHBondContact OD1-N 2.83Å
90	G	87	Confident	80.5	Confident	69 Å²	69	56.7 Å²	56.7	71%	0.711	32%	0.32	S	S	*	.	S	Bend	trans	81.6	1.9	-178.4	0	0	0	0	0	114.4	Q87 D88	Q87-G90 PolarHBondContact O-N 3.19Å; D88-G90 PolarHBondContact O-N 3.37Å
91	A	88.5	Confident	79.3	Confident	40 Å²	40	56.9 Å²	56.9	33%	0.331	32%	0.318	S	S	.	.			trans	-84.1	145	176.6	0	0	0	0	0	111.5	Q87 N89	Q87-A91 WeakPolarHBondContact CB-O 3.15Å; Q87-A91 PolarHBondContact N-O 3Å; N89-A91 VanDerWaalsContact C-N 3.29Å; N89-A91 PolarHBondContact O-N 3.21Å; N89-A91 WeakPolarHBondContact OD1-CB 2.98Å; N89-A91 PolarHBondContact OD1-N 2.83Å
92	V	88.1	Confident	77.9	Confident	96 Å²	96	56.7 Å²	56.7	58%	0.582	33%	0.332	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.7	122.6	168.4	-179.6	0	0	0	0	108.6	F84 V85 P94	F84-V92 HydrophobicContact CB-CG1 4.32Å; F84-V92 HydrophobicContact CD1-CG1 4.44Å; V85-V92 CarbonylContact O-C 3.56Å; V85-V92 WeakPolarHBondContact O-CA 3.35Å; V92-P94 VanDerWaalsContact O-CD 3.28Å; V92-P94 WeakPolarHBondContact O-CD 3.48Å
93	M	84.8	Confident	76.2	Confident	33 Å²	33	54.9 Å²	54.9	16%	0.163	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	108.6	176.1	-172.7	-177.6	74.1	0	0	109.9	I48 M67 V85 T95	I48-M93 HydrophobicContact CD1-CE 3.54Å; M67-M93 HydrophobicContact CG-CE 4.02Å; M67-M93 HydrophobicContact CG-SD 4.44Å; M67-M93 HydrophobicContact SD-CE 4.27Å; V85-M93 PolarHBondContact N-O 3.34Å; V85-M93 PolarHBondContact O-N 3.1Å; M93-T95 HydrophobicContact CE-CG2 4.44Å
94	P	82.7	Confident	74.3	Confident	86 Å²	86	56.8 Å²	56.8	56%	0.558	35%	0.352	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.2	125.7	167.6	31.2	-31.8	0	0	0	109.7	I83 F84 V92	I83-P94 WeakPolarHBondContact O-CA 3.41Å; F84-P94 HydrophobicContact CD1-CB 3.96Å; F84-P94 HydrophobicContact CE1-CB 3.92Å; V92-P94 VanDerWaalsContact O-CD 3.28Å; V92-P94 WeakPolarHBondContact O-CD 3.48Å
95	T	79.3	Confident	72.2	Confident	17 Å²	17	56.9 Å²	56.9	10%	0.104	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	151.8	172.1	-172.3	0	0	0	0	111	I83 M93 L100	I83-T95 HydrophobicContact CB-CG2 3.82Å; I83-T95 HydrophobicContact CD1-CG2 4.13Å; I83-T95 HydrophobicContact CG2-CG2 4.39Å; I83-T95 PolarHBondContact N-O 2.87Å; I83-T95 PolarHBondContact O-N 2.87Å; I83-T95 VanDerWaalsContact O-O 3.12Å; M93-T95 HydrophobicContact CE-CG2 4.44Å; T95-L100 HydrophobicContact CG2-CD1 4.19Å; T95-L100 HydrophobicContact CG2-CG 4.47Å
96	R	72.9	Confident	69.9	Low	144 Å²	144	68 Å²	68	54%	0.543	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.7	138.3	172.9	-66	-177.1	81.6	-177	3.8	108.5	R82 A98 C99 L100	R82-R96 HydrophobicContact CG-CG 4.25Å; R96-A98 PolarHBondContact O-N 2.93Å; R96-C99 HydrophobicContact CB-CB 4.13Å; R96-C99 WeakPolarHBondContact O-CA 3.41Å; R96-C99 WeakPolarHBondContact O-CB 3.2Å; R96-C99 PolarHBondContact O-N 3.2Å; R96-L100 PolarHBondContact O-N 2.56Å; R96-L100 VanDerWaalsContact O-N 3.1Å
97	T	66.4	Low	67.6	Low	3 Å²	3	74 Å²	74	2%	0.018	44%	0.436	C	S	.	.	H	α-helix	trans	-56	-36.9	173.7	-43.1	0	0	0	0	111	I33 I40 Y76 R81 C99 L100 L101	I33-T97 HydrophobicContact CD1-CG2 3.75Å; I33-T97 HydrophobicContact CG1-CG2 4.32Å; I33-T97 HydrophobicContact CG2-CG2 4.47Å; I40-T97 HydrophobicContact CD1-CG2 3.93Å; Y76-T97 WeakPolarHBondContact CE2-OG1 3.25Å; R81-T97 PolarHBondContact O-N 2.88Å; R81-T97 PolarHBondContact O-OG1 2.82Å; T97-C99 VanDerWaalsContact C-N 3.33Å; T97-C99 PolarHBondContact O-N 2.78Å; T97-L100 WeakPolarHBondContact O-CB 3.05Å; T97-L100 PolarHBondContact O-N 3.01Å; T97-L101 HydrophobicContact CG2-CD1 4.21Å; T97-L101 VanDerWaalsContact O-CG 3.27Å; T97-L101 WeakPolarHBondContact O-CG 3.15Å; T97-L101 PolarHBondContact O-N 3.28Å
98	A	60.5	Low	65	Low	51 Å²	51	78.3 Å²	78.3	42%	0.421	47%	0.466	S	S	.	.	H	α-helix	trans	-65.9	-30.1	174.6	0	0	0	0	0	113.8	R96 L101 S102	R96-A98 PolarHBondContact O-N 2.93Å; A98-L101 CarbonylContact O-C 3.57Å; A98-L101 PolarHBondContact O-N 3.24Å; A98-S102 VanDerWaalsContact O-CB 3.25Å; A98-S102 WeakPolarHBondContact O-CB 3.28Å; A98-S102 PolarHBondContact O-N 3.05Å
99	C	57.2	Low	62.7	Low	72 Å²	72	78.9 Å²	78.9	49%	0.486	48%	0.478	S	S	.	.	H	α-helix	trans	-74	-36.7	176	-167	0	0	0	0	110.9	R96 T97 L101 S103	R96-C99 HydrophobicContact CB-CB 4.13Å; R96-C99 WeakPolarHBondContact O-CA 3.41Å; R96-C99 WeakPolarHBondContact O-CB 3.2Å; R96-C99 PolarHBondContact O-N 3.2Å; T97-C99 VanDerWaalsContact C-N 3.33Å; T97-C99 PolarHBondContact O-N 2.78Å; C99-L101 VanDerWaalsContact C-N 3.34Å; C99-S103 PolarHBondContact O-N 3.34Å
100	L	55.3	Low	60.4	Low	4 Å²	4	81.6 Å²	81.6	2%	0.021	53%	0.528	C	S	.	.	H	α-helix	trans	-57.6	-55.2	166.7	-63.5	172.4	0	0	0	107.5	I48 V50 I63 H65 I83 T95 R96 T97 S102 S103	I48-L100 HydrophobicContact CG2-CD1 4.4Å; V50-L100 HydrophobicContact CG2-CB 3.82Å; V50-L100 HydrophobicContact CG2-CD1 3.71Å; V50-L100 HydrophobicContact CG2-CG 4.32Å; I63-L100 HydrophobicContact CD1-CB 4.38Å; I63-L100 VanDerWaalsContact CD1-O 3.23Å; I63-L100 WeakPolarHBondContact CD1-O 3.16Å; I63-L100 WeakPolarHBondContact CG1-O 3.25Å; I63-L100 HydrophobicContact CG2-CB 3.93Å; I63-L100 HydrophobicContact CG2-CD2 4.11Å; I63-L100 WeakPolarHBondContact CG2-O 3.28Å; H65-L100 HydrophobicContact CB-CD2 3.92Å; I83-L100 HydrophobicContact CD1-CD1 3.55Å; T95-L100 HydrophobicContact CG2-CD1 4.19Å; T95-L100 HydrophobicContact CG2-CG 4.47Å; R96-L100 PolarHBondContact O-N 2.56Å; R96-L100 VanDerWaalsContact O-N 3.1Å; T97-L100 WeakPolarHBondContact O-CB 3.05Å; T97-L100 PolarHBondContact O-N 3.01Å; L100-S102 VanDerWaalsContact C-N 3.34Å; L100-S102 PolarHBondContact O-N 3.24Å; L100-S103 PolarHBondContact O-N 2.85Å
101	L	56	Low	59.1	Low	45 Å²	45	82.3 Å²	82.3	24%	0.236	52%	0.519	C	S	.	.	H	α-helix	trans	-57.8	-37.4	-179.4	-65	162.7	0	0	0	114.7	V50 L52 I63 T97 A98 C99 S104	V50-L101 HydrophobicContact CG1-CD2 4.35Å; L52-L101 HydrophobicContact CD1-CD2 3.78Å; L52-L101 HydrophobicContact CD2-CD2 4.22Å; L52-L101 HydrophobicContact CG-CD2 4.34Å; I63-L101 HydrophobicContact CD1-CB 4.3Å; I63-L101 HydrophobicContact CD1-CD2 3.74Å; I63-L101 HydrophobicContact CD1-CG 4.15Å; T97-L101 HydrophobicContact CG2-CD1 4.21Å; T97-L101 VanDerWaalsContact O-CG 3.27Å; T97-L101 WeakPolarHBondContact O-CG 3.15Å; T97-L101 PolarHBondContact O-N 3.28Å; A98-L101 CarbonylContact O-C 3.57Å; A98-L101 PolarHBondContact O-N 3.24Å; C99-L101 VanDerWaalsContact C-N 3.34Å; L101-S104 VanDerWaalsContact O-CB 3.28Å; L101-S104 WeakPolarHBondContact O-CB 3.31Å; L101-S104 PolarHBondContact O-N 2.76Å; L101-S104 PolarHBondContact O-OG 3.21Å
102	S	50.9	Low	57.6	Low	97 Å²	97	84.5 Å²	84.5	68%	0.678	53%	0.529	S	S	*	.	H	α-helix	trans	-78	-19.1	-176.9	-173.6	0	0	0	0	114.1	A98 L100 S104	A98-S102 VanDerWaalsContact O-CB 3.25Å; A98-S102 WeakPolarHBondContact O-CB 3.28Å; A98-S102 PolarHBondContact O-N 3.05Å; L100-S102 VanDerWaalsContact C-N 3.34Å; L100-S102 PolarHBondContact O-N 3.24Å; S102-S104 PolarHBondContact O-N 2.81Å
103	S	48.9	Very low	55.9	Low	84 Å²	84	83.8 Å²	83.8	59%	0.587	53%	0.526	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.4	1.7	171.5	-77.2	0	0	0	0	112.8	C99 L100 A105	C99-S103 PolarHBondContact O-N 3.34Å; L100-S103 PolarHBondContact O-N 2.85Å; S103-A105 PolarHBondContact O-N 3.1Å
104	S	46.9	Very low	54.2	Low	41 Å²	41	86.8 Å²	86.8	29%	0.287	55%	0.547	S	S	.	.			trans	-68.3	73	166.7	71.2	0	0	0	0	111.2	L101 S102 W106	L101-S104 VanDerWaalsContact O-CB 3.28Å; L101-S104 WeakPolarHBondContact O-CB 3.31Å; L101-S104 PolarHBondContact O-N 2.76Å; L101-S104 PolarHBondContact O-OG 3.21Å; S102-S104 PolarHBondContact O-N 2.81Å; S104-W106 PolarHBondContact O-N 3.43Å
105	A	44.8	Very low	52.4	Low	82 Å²	82	86.9 Å²	86.9	68%	0.678	55%	0.546	S	S	*	.			trans	-63.7	127.7	150.7	0	0	0	0	0	106.3	S103	S103-A105 PolarHBondContact O-N 3.1Å
106	W	40.7	Very low	50.6	Low	235 Å²	235	91.5 Å²	91.5	89%	0.89	58%	0.576	S	S	*	*			trans	92.7	61.7	-171.2	-54.7	96.7	0	0	0	116.3	S104	S104-W106 PolarHBondContact O-N 3.43Å
107	L	41.8	Very low	49	Very low	141 Å²	141	87.8 Å²	87.8	74%	0.738	58%	0.578	S	S	*	*			trans	-81.1	117.1	133.1	-79.2	132.9	0	0	0	106.9	S109	L107-S109 PolarHBondContact O-N 3.48Å; L107-S109 VanDerWaalsContact O-N 3.1Å
108	P	35.6	Very low	47.7	Very low	110 Å²	110	94.3 Å²	94.3	71%	0.714	62%	0.621	S	S	*	*			trans	-64.4	112.8	156.9	27.7	-27.2	0	0	0	105.8	G110	P108-G110 PolarHBondContact O-N 3.12Å; P108-G110 VanDerWaalsContact O-N 3.12Å
109	S	39.8	Very low	46.6	Very low	116 Å²	116	97.9 Å²	97.9	81%	0.811	64%	0.638	S	S	*	*			trans	-48.4	115.1	165.8	34.9	0	0	0	0	108.8	L107	L107-S109 PolarHBondContact O-N 3.48Å; L107-S109 VanDerWaalsContact O-N 3.1Å
110	G	41.3	Very low	45.6	Very low	148 Å²	148	100.3 Å²	100.3	100%	1.526	65%	0.651	S	S	*	*			trans	-71.1	0	156.4	0	0	0	0	0	110.1	P108	P108-G110 PolarHBondContact O-N 3.12Å; P108-G110 VanDerWaalsContact O-N 3.12Å

Retrieved 110 of 110 residues in 18.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).