A0A087WQ18_MOUSE Loading...

5'-3' exoribonuclease 1

AlphaFold DB , UniProt , Accession A0A087WQ18, Species MOUSE (Mus musculus, Mouse), Gene Xrn1, Length 40 aa.

						>A0A087WQ18_MOUSE|A0A087WQ18|Xrn1
MAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	76.7	Confident	92.1	Very high	245 Å²	245	119.5 Å²	119.5	100%	1.207	70%	0.7	S	S	*	*				0	128.3	0	-169.4	172.4	-178.5	0	0	107.4
2	A	88.1	Confident	92.6	Very high	99 Å²	99	117 Å²	117	82%	0.818	68%	0.678	S	S	*	*			trans	-109.1	141	-179.8	0	0	0	0	0	109.8
3	V	89.6	Confident	93	Very high	135 Å²	135	115.5 Å²	115.5	82%	0.818	67%	0.666	S	S	*	*			trans	-105	142.4	177.6	-176.6	0	0	0	0	108.6	G5	V3-G5 PolarHBondContact O-N 3.35Å
4	D	89.8	Confident	93.2	Very high	139 Å²	139	115.6 Å²	115.6	74%	0.743	66%	0.657	S	S	*	*			trans	-65	120.6	175.1	-78.6	-26.3	0	0	0	110.6
5	G	92.8	Very high	93.5	Very high	66 Å²	66	111.1 Å²	111.1	68%	0.68	63%	0.629	S	S	*	*			trans	-80.6	-163.7	170.8	0	0	0	0	0	113.2	V3 A7	V3-G5 PolarHBondContact O-N 3.35Å; G5-A7 PolarHBondContact O-N 3Å
6	V	93.5	Very high	93.7	Very high	146 Å²	146	115.9 Å²	115.9	89%	0.885	63%	0.634	S	S	*	*	P	Polyproline II helix	trans	-67.1	130.5	178.1	-177	0	0	0	0	110.3
7	A	94.6	Very high	93.9	Very high	17 Å²	17	111.2 Å²	111.2	14%	0.14	62%	0.618	C	S	.	*	P	Polyproline II helix	trans	-99	159.9	-177.4	0	0	0	0	0	112.6	G5 K11 M12	G5-A7 PolarHBondContact O-N 3Å; A7-K11 HydrophobicContact CB-CB 4.1Å; A7-K11 HydrophobicContact CB-CD 3.99Å; A7-K11 HydrophobicContact CB-CG 4.11Å; A7-M12 HydrophobicContact CB-CG 4.28Å; A7-M12 WeakPolarHBondContact O-CG 3.29Å
8	P	97.6	Very high	94	Very high	98 Å²	98	111.2 Å²	111.2	64%	0.636	61%	0.607	S	S	*	*	P	Polyproline II helix	trans	-59	151.5	171.1	-23.6	33.7	0	0	0	112.3	A10 K11 M12	P8-A10 PolarHBondContact O-N 3.4Å; P8-A10 VanDerWaalsContact O-N 3.11Å; P8-K11 WeakPolarHBondContact O-CA 3.38Å; P8-K11 PolarHBondContact O-N 2.98Å; P8-M12 PolarHBondContact O-N 3.33Å
9	R	96.7	Very high	94.2	Very high	202 Å²	202	115.2 Å²	115.2	76%	0.762	61%	0.612	S	S	*	*	H	α-helix	trans	-55.9	-35.6	-172.5	-165.3	162.8	177.8	96.9	-5.7	113.9	M12 N13	R9-M12 PolarHBondContact O-N 3.22Å; R9-N13 PolarHBondContact O-N 3.06Å
10	A	97.3	Very high	94.3	Very high	71 Å²	71	116.8 Å²	116.8	59%	0.587	61%	0.614	S	S	*	*	H	α-helix	trans	-60.1	-46.1	174.3	0	0	0	0	0	112.3	P8 N13 Q14	P8-A10 PolarHBondContact O-N 3.4Å; P8-A10 VanDerWaalsContact O-N 3.11Å; A10-N13 PolarHBondContact O-N 2.9Å; A10-Q14 PolarHBondContact O-N 3.28Å
11	K	96.8	Very high	94.4	Very high	96 Å²	96	118.6 Å²	118.6	42%	0.417	61%	0.612	S	S	.	*	H	α-helix	trans	-70.3	-34.8	176.9	-172	173.1	-179.4	-174.3	0	111.2	A7 P8 N13 Q14 Q15	A7-K11 HydrophobicContact CB-CB 4.1Å; A7-K11 HydrophobicContact CB-CD 3.99Å; A7-K11 HydrophobicContact CB-CG 4.11Å; P8-K11 WeakPolarHBondContact O-CA 3.38Å; P8-K11 PolarHBondContact O-N 2.98Å; K11-N13 VanDerWaalsContact C-N 3.35Å; K11-N13 PolarHBondContact O-N 3.07Å; K11-Q14 WeakPolarHBondContact O-CB 3.41Å; K11-Q14 PolarHBondContact O-N 3.32Å; K11-Q15 WeakPolarHBondContact O-CG 3.5Å; K11-Q15 PolarHBondContact O-N 3.11Å
12	M	97.5	Very high	95.3	Very high	90 Å²	90	110.4 Å²	110.4	44%	0.443	58%	0.579	S	S	.	*	H	α-helix	trans	-62.2	-39.7	172.4	-67.6	-174	75.4	0	0	112.3	A7 P8 R9 Q14 Q15 R16	A7-M12 HydrophobicContact CB-CG 4.28Å; A7-M12 WeakPolarHBondContact O-CG 3.29Å; P8-M12 PolarHBondContact O-N 3.33Å; R9-M12 PolarHBondContact O-N 3.22Å; M12-Q14 VanDerWaalsContact C-N 3.34Å; M12-Q14 PolarHBondContact O-N 3.46Å; M12-Q15 PolarHBondContact O-N 2.88Å; M12-R16 WeakPolarHBondContact O-CB 3.24Å; M12-R16 PolarHBondContact O-N 2.91Å
13	N	97.7	Very high	95.7	Very high	98 Å²	98	108.1 Å²	108.1	52%	0.524	56%	0.561	S	S	.	*	H	α-helix	trans	-63.6	-40.8	174.6	-78.2	-6.1	0	0	0	111.6	R9 A10 K11 R16 G17	R9-N13 PolarHBondContact O-N 3.06Å; A10-N13 PolarHBondContact O-N 2.9Å; K11-N13 VanDerWaalsContact C-N 3.35Å; K11-N13 PolarHBondContact O-N 3.07Å; N13-R16 PolarHBondContact O-N 3.45Å; N13-G17 PolarHBondContact O-N 3.41Å
14	Q	96.8	Very high	96	Very high	116 Å²	116	107.3 Å²	107.3	54%	0.542	55%	0.546	S	S	.	.	H	α-helix	trans	-64.3	-43.3	173.6	-66.2	177.5	9	0	0	112.1	A10 K11 M12 R16 G17 R18	A10-Q14 PolarHBondContact O-N 3.28Å; K11-Q14 WeakPolarHBondContact O-CB 3.41Å; K11-Q14 PolarHBondContact O-N 3.32Å; M12-Q14 VanDerWaalsContact C-N 3.34Å; M12-Q14 PolarHBondContact O-N 3.46Å; Q14-R16 VanDerWaalsContact C-N 3.34Å; Q14-G17 PolarHBondContact O-N 3.21Å; Q14-R18 WeakPolarHBondContact O-CG 3.25Å; Q14-R18 PolarHBondContact O-N 2.96Å
15	Q	96.7	Very high	96.2	Very high	49 Å²	49	105.6 Å²	105.6	23%	0.229	53%	0.534	C	S	.	.	H	α-helix	trans	-61.1	-43.8	174.7	-74.3	179	5.7	0	0	111	K11 M12 R18 R19	K11-Q15 WeakPolarHBondContact O-CG 3.5Å; K11-Q15 PolarHBondContact O-N 3.11Å; M12-Q15 PolarHBondContact O-N 2.88Å; Q15-R18 PolarHBondContact O-N 3.44Å; Q15-R19 WeakPolarHBondContact O-CB 3.34Å; Q15-R19 VanDerWaalsContact O-CG 3.32Å; Q15-R19 WeakPolarHBondContact O-CG 3.35Å; Q15-R19 PolarHBondContact O-N 2.96Å
16	R	96.6	Very high	96.3	Very high	188 Å²	188	104.7 Å²	104.7	71%	0.709	52%	0.519	S	S	*	.	H	α-helix	trans	-60.4	-47.2	176.9	-173.3	-179.7	-178.4	-170.5	0.7	111.3	M12 N13 Q14 R18 R19 F20	M12-R16 WeakPolarHBondContact O-CB 3.24Å; M12-R16 PolarHBondContact O-N 2.91Å; N13-R16 PolarHBondContact O-N 3.45Å; Q14-R16 VanDerWaalsContact C-N 3.34Å; R16-R18 VanDerWaalsContact C-N 3.33Å; R16-R18 PolarHBondContact O-N 2.91Å; R16-R19 PolarHBondContact O-N 3.33Å; R16-F20 WeakPolarHBondContact O-CB 3.35Å; R16-F20 PolarHBondContact O-N 3.25Å
17	G	97.1	Very high	96.3	Very high	35 Å²	35	102.9 Å²	102.9	36%	0.361	50%	0.501	S	S	.	.	H	α-helix	trans	-63	-37.7	177	0	0	0	0	0	113	N13 Q14 R21	N13-G17 PolarHBondContact O-N 3.41Å; Q14-G17 PolarHBondContact O-N 3.21Å; G17-R21 PolarHBondContact O-N 2.95Å
18	R	96.9	Very high	96.2	Very high	112 Å²	112	105 Å²	105	42%	0.423	51%	0.51	S	S	.	.	H	α-helix	trans	-63.5	-51.1	171.9	-77	-167	-70.6	-93.2	2.7	111.7	Q14 Q15 R16 F20 R21 S22	Q14-R18 WeakPolarHBondContact O-CG 3.25Å; Q14-R18 PolarHBondContact O-N 2.96Å; Q15-R18 PolarHBondContact O-N 3.44Å; R16-R18 VanDerWaalsContact C-N 3.33Å; R16-R18 PolarHBondContact O-N 2.91Å; R18-F20 VanDerWaalsContact C-N 3.28Å; R18-F20 PolarHBondContact O-N 3.28Å; R18-R21 PolarHBondContact O-N 3.41Å; R18-S22 PolarHBondContact O-N 3.42Å; R18-S22 PolarHBondContact O-OG 3.39Å
19	R	96.3	Very high	95.9	Very high	187 Å²	187	107 Å²	107	71%	0.706	51%	0.509	S	S	*	.	H	α-helix	trans	-57.2	-42.3	179.2	-73.6	-179.3	-179.3	-169.7	1.4	112	Q15 R16 S22 A23	Q15-R19 WeakPolarHBondContact O-CB 3.34Å; Q15-R19 VanDerWaalsContact O-CG 3.32Å; Q15-R19 WeakPolarHBondContact O-CG 3.35Å; Q15-R19 PolarHBondContact O-N 2.96Å; R16-R19 PolarHBondContact O-N 3.33Å; R19-S22 PolarHBondContact O-N 3Å; R19-A23 WeakPolarHBondContact O-CB 3.2Å; R19-A23 PolarHBondContact O-N 3.45Å
20	F	96.7	Very high	95.6	Very high	147 Å²	147	101 Å²	101	65%	0.645	49%	0.491	S	S	*	.	H	α-helix	trans	-61.9	-46.2	177.5	-176.7	-100.8	0	0	0	112.4	R16 R18 A23 K24	R16-F20 WeakPolarHBondContact O-CB 3.35Å; R16-F20 PolarHBondContact O-N 3.25Å; R18-F20 VanDerWaalsContact C-N 3.28Å; R18-F20 PolarHBondContact O-N 3.28Å; F20-A23 PolarHBondContact O-N 3.03Å; F20-K24 PolarHBondContact O-N 3.32Å
21	R	96.4	Very high	95.2	Very high	154 Å²	154	102.9 Å²	102.9	58%	0.581	49%	0.486	S	S	*	.	H	α-helix	trans	-61.7	-47.8	176.6	-75.3	-172.3	-71.6	168.3	-3.2	112	G17 R18 A23 K24 E25	G17-R21 PolarHBondContact O-N 2.95Å; R18-R21 PolarHBondContact O-N 3.41Å; R21-A23 VanDerWaalsContact C-N 3.32Å; R21-A23 PolarHBondContact O-N 3.26Å; R21-K24 PolarHBondContact O-N 3.22Å; R21-E25 WeakPolarHBondContact O-CB 3.23Å; R21-E25 WeakPolarHBondContact O-CG 3.32Å; R21-E25 PolarHBondContact O-N 2.98Å
22	S	96.3	Very high	94.8	Very high	74 Å²	74	104.2 Å²	104.2	52%	0.517	49%	0.492	S	S	.	.	H	α-helix	trans	-62.2	-38.6	179.4	-58.1	0	0	0	0	112.8	R18 R19 A26	R18-S22 PolarHBondContact O-N 3.42Å; R18-S22 PolarHBondContact O-OG 3.39Å; R19-S22 PolarHBondContact O-N 3Å; S22-A26 WeakPolarHBondContact O-CB 3.37Å; S22-A26 PolarHBondContact O-N 2.87Å
23	A	95.9	Very high	94.3	Very high	51 Å²	51	100.6 Å²	100.6	42%	0.421	48%	0.476	S	S	.	.	H	α-helix	trans	-64.1	-47.5	175.4	0	0	0	0	0	111.5	R19 F20 R21 E25 A26 E27	R19-A23 WeakPolarHBondContact O-CB 3.2Å; R19-A23 PolarHBondContact O-N 3.45Å; F20-A23 PolarHBondContact O-N 3.03Å; R21-A23 VanDerWaalsContact C-N 3.32Å; R21-A23 PolarHBondContact O-N 3.26Å; A23-E25 PolarHBondContact O-N 3.47Å; A23-A26 WeakPolarHBondContact O-CB 3.33Å; A23-A26 PolarHBondContact O-N 3.2Å; A23-E27 PolarHBondContact O-N 2.95Å
24	K	95.9	Very high	93.7	Very high	117 Å²	117	101.6 Å²	101.6	51%	0.509	48%	0.48	S	S	.	.	H	α-helix	trans	-60.9	-45.1	177.1	-172.6	-179.4	177.2	-178.3	0	111.9	F20 R21 A26 E27 D28	F20-K24 PolarHBondContact O-N 3.32Å; R21-K24 PolarHBondContact O-N 3.22Å; K24-A26 VanDerWaalsContact C-N 3.29Å; K24-A26 PolarHBondContact O-N 2.91Å; K24-E27 PolarHBondContact O-N 2.84Å; K24-D28 WeakPolarHBondContact O-CB 3.46Å; K24-D28 VanDerWaalsContact O-CG 3.31Å; K24-D28 PolarHBondContact O-N 2.91Å
25	E	94.7	Very high	93.1	Very high	104 Å²	104	103.8 Å²	103.8	49%	0.486	49%	0.491	S	S	.	.	H	α-helix	trans	-62.3	-37	176.8	-74.2	172	-163.3	0	0	112.2	R21 A23 K29	R21-E25 WeakPolarHBondContact O-CB 3.23Å; R21-E25 WeakPolarHBondContact O-CG 3.32Å; R21-E25 PolarHBondContact O-N 2.98Å; A23-E25 PolarHBondContact O-N 3.47Å; E25-K29 WeakPolarHBondContact O-CB 3.38Å; E25-K29 WeakPolarHBondContact O-CG 3.38Å; E25-K29 PolarHBondContact O-N 3.17Å
26	A	93.8	Very high	92.5	Very high	46 Å²	46	108.8 Å²	108.8	38%	0.38	51%	0.511	S	S	.	.	H	α-helix	trans	-66.6	-46.5	175.5	0	0	0	0	0	111.5	S22 A23 K24 D28 K29 I30	S22-A26 WeakPolarHBondContact O-CB 3.37Å; S22-A26 PolarHBondContact O-N 2.87Å; A23-A26 WeakPolarHBondContact O-CB 3.33Å; A23-A26 PolarHBondContact O-N 3.2Å; K24-A26 VanDerWaalsContact C-N 3.29Å; K24-A26 PolarHBondContact O-N 2.91Å; A26-D28 VanDerWaalsContact C-N 3.35Å; A26-D28 PolarHBondContact O-N 3.42Å; A26-K29 PolarHBondContact O-N 3.5Å; A26-I30 VanDerWaalsContact O-CG1 3.25Å; A26-I30 WeakPolarHBondContact O-CG1 3.48Å; A26-I30 PolarHBondContact O-N 3.26Å
27	E	93.4	Very high	91.5	Very high	109 Å²	109	103 Å²	103	51%	0.509	51%	0.51	S	S	.	.	H	α-helix	trans	-58.4	-46.1	174.8	-73	-179.4	-167.1	0	0	112	A23 K24 K29 I30 K31	A23-E27 PolarHBondContact O-N 2.95Å; K24-E27 PolarHBondContact O-N 2.84Å; E27-K29 VanDerWaalsContact C-N 3.31Å; E27-K29 PolarHBondContact O-N 3.3Å; E27-I30 PolarHBondContact O-N 2.86Å; E27-K31 WeakPolarHBondContact O-CG 3.44Å; E27-K31 PolarHBondContact O-N 3.45Å
28	D	93.3	Very high	90.3	Very high	61 Å²	61	107.5 Å²	107.5	33%	0.326	52%	0.522	S	S	.	.	H	α-helix	trans	-65.4	-36.1	179.5	-71.3	-19.8	0	0	0	111.6	K24 A26 K32	K24-D28 WeakPolarHBondContact O-CB 3.46Å; K24-D28 VanDerWaalsContact O-CG 3.31Å; K24-D28 PolarHBondContact O-N 2.91Å; A26-D28 VanDerWaalsContact C-N 3.35Å; A26-D28 PolarHBondContact O-N 3.42Å; D28-K32 WeakPolarHBondContact O-CB 3.37Å; D28-K32 VanDerWaalsContact O-CG 3.23Å; D28-K32 WeakPolarHBondContact O-CG 3.5Å; D28-K32 PolarHBondContact O-N 3.36Å
29	K	91	Very high	88.6	Confident	139 Å²	139	108.9 Å²	108.9	60%	0.604	54%	0.543	S	S	*	.	H	α-helix	trans	-66	-44	173.8	-79.1	173.8	-177.3	179.8	0	111.7	E25 A26 E27 K32 A33	E25-K29 WeakPolarHBondContact O-CB 3.38Å; E25-K29 WeakPolarHBondContact O-CG 3.38Å; E25-K29 PolarHBondContact O-N 3.17Å; A26-K29 PolarHBondContact O-N 3.5Å; E27-K29 VanDerWaalsContact C-N 3.31Å; E27-K29 PolarHBondContact O-N 3.3Å; K29-K32 PolarHBondContact O-N 2.78Å; K29-A33 WeakPolarHBondContact O-CB 3.49Å; K29-A33 PolarHBondContact O-N 3.4Å
30	I	90.1	Very high	86.9	Confident	77 Å²	77	108.6 Å²	108.6	40%	0.395	55%	0.554	S	S	.	*	H	α-helix	trans	-61.2	-47.9	177.3	-68.9	163.9	0	0	0	110	A26 E27 K32 A33 I34 L40	A26-I30 VanDerWaalsContact O-CG1 3.25Å; A26-I30 WeakPolarHBondContact O-CG1 3.48Å; A26-I30 PolarHBondContact O-N 3.26Å; E27-I30 PolarHBondContact O-N 2.86Å; I30-K32 VanDerWaalsContact C-N 3.34Å; I30-K32 PolarHBondContact O-N 3.28Å; I30-A33 PolarHBondContact O-N 3.33Å; I30-I34 HydrophobicContact CG2-CD1 3.77Å; I30-I34 VanDerWaalsContact O-CG1 3.29Å; I30-I34 WeakPolarHBondContact O-CG1 3.41Å; I30-I34 PolarHBondContact O-N 2.91Å; I30-L40 HydrophobicContact CB-CD1 4.16Å; I30-L40 HydrophobicContact CG1-CD1 3.81Å; I30-L40 HydrophobicContact CG2-CD1 3.9Å
31	K	89.6	Confident	86.4	Confident	111 Å²	111	106.7 Å²	106.7	48%	0.483	55%	0.55	S	S	.	.	H	α-helix	trans	-57.3	-47	176.5	-73	172.2	-174.8	167.6	0	111.7	E27 A33 I34 E35	E27-K31 WeakPolarHBondContact O-CG 3.44Å; E27-K31 PolarHBondContact O-N 3.45Å; K31-A33 PolarHBondContact O-N 2.92Å; K31-I34 PolarHBondContact O-N 2.94Å; K31-E35 WeakPolarHBondContact O-CG 3.45Å; K31-E35 PolarHBondContact O-N 3.49Å
32	K	88.7	Confident	85.9	Confident	124 Å²	124	104.2 Å²	104.2	54%	0.539	55%	0.548	S	S	.	.	H	α-helix	trans	-65.1	-35.9	178.1	-74.5	174	-177.6	179.8	0	113.2	D28 K29 I30 K36	D28-K32 WeakPolarHBondContact O-CB 3.37Å; D28-K32 VanDerWaalsContact O-CG 3.23Å; D28-K32 WeakPolarHBondContact O-CG 3.5Å; D28-K32 PolarHBondContact O-N 3.36Å; K29-K32 PolarHBondContact O-N 2.78Å; I30-K32 VanDerWaalsContact C-N 3.34Å; I30-K32 PolarHBondContact O-N 3.28Å; K32-K36 WeakPolarHBondContact O-CB 3.33Å; K32-K36 VanDerWaalsContact O-CG 3.24Å; K32-K36 WeakPolarHBondContact O-CG 3.47Å; K32-K36 PolarHBondContact O-N 2.95Å
33	A	86.2	Confident	85.3	Confident	13 Å²	13	105.8 Å²	105.8	11%	0.107	55%	0.55	C	S	.	.	H	α-helix	trans	-66.4	-44.2	176.3	0	0	0	0	0	110.8	K29 I30 K31 K36 G37 E38 L40	K29-A33 WeakPolarHBondContact O-CB 3.49Å; K29-A33 PolarHBondContact O-N 3.4Å; I30-A33 PolarHBondContact O-N 3.33Å; K31-A33 PolarHBondContact O-N 2.92Å; A33-K36 CarbonylContact O-C 3.6Å; A33-K36 PolarHBondContact O-N 3.19Å; A33-G37 PolarHBondContact O-N 3.11Å; A33-G37 VanDerWaalsContact O-N 3.11Å; A33-E38 PolarHBondContact O-N 3.29Å; A33-L40 HydrophobicContact CB-CD2 4.31Å; A33-L40 HydrophobicContact CB-CG 4.11Å
34	I	85.1	Confident	84.7	Confident	119 Å²	119	109.1 Å²	109.1	61%	0.61	56%	0.557	S	S	*	*	H	α-helix	trans	-61.1	-46.6	174.7	-65.3	165.4	0	0	0	111	I30 K31 K36 G37	I30-I34 HydrophobicContact CG2-CD1 3.77Å; I30-I34 VanDerWaalsContact O-CG1 3.29Å; I30-I34 WeakPolarHBondContact O-CG1 3.41Å; I30-I34 PolarHBondContact O-N 2.91Å; K31-I34 PolarHBondContact O-N 2.94Å; I34-K36 PolarHBondContact O-N 2.93Å; I34-G37 PolarHBondContact O-N 3.34Å
35	E	84.4	Confident	84	Confident	163 Å²	163	108.6 Å²	108.6	76%	0.762	56%	0.56	S	S	*	*	H	α-helix	trans	-60.4	-34.2	177.4	-77.3	175.7	177.6	0	0	112.7	K31 G37	K31-E35 WeakPolarHBondContact O-CG 3.45Å; K31-E35 PolarHBondContact O-N 3.49Å; E35-G37 VanDerWaalsContact C-N 3.31Å
36	K	84.2	Confident	83.3	Confident	153 Å²	153	108.9 Å²	108.9	67%	0.665	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.4	-4.6	177.9	-71.1	176.8	179.4	-171.3	0	113.7	K32 A33 I34 E38	K32-K36 WeakPolarHBondContact O-CB 3.33Å; K32-K36 VanDerWaalsContact O-CG 3.24Å; K32-K36 WeakPolarHBondContact O-CG 3.47Å; K32-K36 PolarHBondContact O-N 2.95Å; A33-K36 CarbonylContact O-C 3.6Å; A33-K36 PolarHBondContact O-N 3.19Å; I34-K36 PolarHBondContact O-N 2.93Å; K36-E38 HydrophobicContact CB-CG 4.45Å; K36-E38 PolarHBondContact O-N 3.3Å
37	G	76.6	Confident	82.5	Confident	66 Å²	66	113.4 Å²	113.4	68%	0.68	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	70.6	15.7	-176.6	0	0	0	0	0	114	A33 I34 E35	A33-G37 PolarHBondContact O-N 3.11Å; A33-G37 VanDerWaalsContact O-N 3.11Å; I34-G37 PolarHBondContact O-N 3.34Å; E35-G37 VanDerWaalsContact C-N 3.31Å
38	E	71.1	Confident	81.7	Confident	131 Å²	131	113.7 Å²	113.7	61%	0.612	58%	0.584	S	S	*	*			trans	-85.4	116.6	174.6	-71.8	177.2	163.4	0	0	108.5	A33 K36 L40	A33-E38 PolarHBondContact O-N 3.29Å; K36-E38 HydrophobicContact CB-CG 4.45Å; K36-E38 PolarHBondContact O-N 3.3Å; E38-L40 PolarHBondContact O-N 3.2Å
39	T	61.8	Low	80.7	Confident	141 Å²	141	118.1 Å²	118.1	87%	0.865	61%	0.605	S	S	*	*			trans	-67.7	120.8	167.6	40.9	0	0	0	0	108.9
40	L	60.3	Low	79.8	Confident	180 Å²	180	116.2 Å²	116.2	94%	0.942	61%	0.606	S	S	*	*			trans	-53.8	0	174.6	-82.1	154.5	0	0	0	113.2	I30 A33 E38	I30-L40 HydrophobicContact CB-CD1 4.16Å; I30-L40 HydrophobicContact CG1-CD1 3.81Å; I30-L40 HydrophobicContact CG2-CD1 3.9Å; A33-L40 HydrophobicContact CB-CD2 4.31Å; A33-L40 HydrophobicContact CB-CG 4.11Å; E38-L40 PolarHBondContact O-N 3.2Å

Retrieved 40 of 40 residues in 46.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).