A0A087WQ37_MOUSE Loading...

Ciliary microtubule inner protein 5

AlphaFold DB , UniProt , Accession A0A087WQ37, Species MOUSE (Mus musculus, Mouse), Gene Cimip5, Length 118 aa.

						>A0A087WQ37_MOUSE|A0A087WQ37|Cimip5
MGSQHRGLPRTTSAGYKPPPTRQLASISAALGDGPAASRALAGGCQGTPALGVQQDQLWRELVEAEARGQRRWAENWGFLKDYDPLGNKKEPQELPASVPFFSDTFPCSTNREVGSRV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.3	Very low	50.3	Low	252 Å²	252	158.7 Å²	158.7	100%	1.241	85%	0.849	S	S	*	*				0	105.8	0	-72.3	-67.2	-165.7	0	0	107.7
2	G	41.1	Very low	51.1	Low	78 Å²	78	155.3 Å²	155.3	80%	0.804	84%	0.838	S	S	*	*			trans	-167	83.8	-174.8	0	0	0	0	0	112.1
3	S	47.2	Very low	51.6	Low	92 Å²	92	152.5 Å²	152.5	64%	0.643	84%	0.838	S	S	*	*			trans	4.4	118.2	161.2	-177.8	0	0	0	0	118.9	H5	S3-H5 PolarHBondContact OG-CD2 3.47Å; S3-H5 VanDerWaalsContact OG-CD2 3.24Å; S3-H5 PolarHBondContact OG-NE2 3.01Å
4	Q	44.6	Very low	51.7	Low	190 Å²	190	148.2 Å²	148.2	89%	0.888	83%	0.832	S	S	*	*			trans	-89	112.7	157	-64.7	-160.6	22.7	0	0	109.7
5	H	49.7	Very low	51.8	Low	174 Å²	174	143.4 Å²	143.4	81%	0.806	83%	0.829	S	S	*	*			trans	-89.4	102.1	161.1	-80.5	-80.4	0	0	0	108.9	S3 G7	S3-H5 PolarHBondContact OG-CD2 3.47Å; S3-H5 VanDerWaalsContact OG-CD2 3.24Å; S3-H5 PolarHBondContact OG-NE2 3.01Å; H5-G7 VanDerWaalsContact C-N 3.27Å; H5-G7 PolarHBondContact O-N 3.1Å
6	R	50.1	Low	51.9	Low	239 Å²	239	148 Å²	148	90%	0.902	83%	0.83	S	S	*	*			trans	-72.7	84.4	167	-173	-175.5	-86	-154.1	-3.2	108.1
7	G	49	Very low	52.8	Low	66 Å²	66	150.5 Å²	150.5	68%	0.68	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-72.4	125.5	171.2	0	0	0	0	0	110.6	H5	H5-G7 VanDerWaalsContact C-N 3.27Å; H5-G7 PolarHBondContact O-N 3.1Å
8	L	59.8	Low	53.3	Low	163 Å²	163	148.2 Å²	148.2	85%	0.853	82%	0.823	S	S	*	*	P	Polyproline II helix	trans	-58	140.8	170.5	-69.1	159.4	0	0	0	110	R10	L8-R10 PolarHBondContact O-N 3.04Å
9	P	57.1	Low	53.7	Low	120 Å²	120	146.2 Å²	146.2	78%	0.779	82%	0.818	S	S	*	*	P	Polyproline II helix	trans	-65	124.3	179.1	25.4	-31.4	0	0	0	110.5	T11	P9-T11 PolarHBondContact O-N 2.82Å
10	R	53.9	Low	53.9	Low	231 Å²	231	145.3 Å²	145.3	87%	0.872	82%	0.818	S	S	*	*			trans	-67.4	113.3	174.3	-173.8	179.2	-177.7	101.6	-2.2	108.9	L8 T12	L8-R10 PolarHBondContact O-N 3.04Å; R10-T12 PolarHBondContact O-N 3.04Å; R10-T12 VanDerWaalsContact O-N 3.09Å
11	T	54.8	Low	53.9	Low	141 Å²	141	144.7 Å²	144.7	87%	0.865	82%	0.818	S	S	*	*			trans	-66.7	106.2	174.4	-46.4	0	0	0	0	109.3	P9	P9-T11 PolarHBondContact O-N 2.82Å
12	T	59.3	Low	54.1	Low	118 Å²	118	144 Å²	144	72%	0.724	80%	0.802	S	S	*	*	P	Polyproline II helix	trans	-82.4	121	176.3	58.8	0	0	0	0	109.2	R10 A14	R10-T12 PolarHBondContact O-N 3.04Å; R10-T12 VanDerWaalsContact O-N 3.09Å; T12-A14 PolarHBondContact O-N 3.27Å
13	S	57.5	Low	54.6	Low	119 Å²	119	149 Å²	149	83%	0.832	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-54.5	123	173	174.2	0	0	0	0	110.7	G15	S13-G15 PolarHBondContact O-N 3.21Å
14	A	52.8	Low	54.6	Low	92 Å²	92	153 Å²	153	76%	0.76	82%	0.817	S	S	*	*	P	Polyproline II helix	trans	-67.8	119.4	176.2	0	0	0	0	0	109.6	T12 Y16	T12-A14 PolarHBondContact O-N 3.27Å; A14-Y16 PolarHBondContact O-N 3.38Å
15	G	53.4	Low	54.3	Low	76 Å²	76	147.8 Å²	147.8	78%	0.784	81%	0.807	S	S	*	*			trans	-66.7	97.7	-180	0	0	0	0	0	111.9	S13 K17	S13-G15 PolarHBondContact O-N 3.21Å; G15-K17 PolarHBondContact O-N 3.45Å
16	Y	53.9	Low	54.1	Low	217 Å²	217	145 Å²	145	85%	0.851	81%	0.807	S	S	*	*			trans	-77.5	106.9	165.5	-150.4	-94.9	0	0	0	108.3	A14	A14-Y16 PolarHBondContact O-N 3.38Å
17	K	66.4	Low	53.8	Low	191 Å²	191	141.1 Å²	141.1	83%	0.83	80%	0.803	S	S	*	*	P	Polyproline II helix	trans	-86.3	121.4	170.7	-69.4	-176.6	-180	179.1	0	108.3	G15	G15-K17 PolarHBondContact O-N 3.45Å
18	P	62.8	Low	53.3	Low	108 Å²	108	143.7 Å²	143.7	70%	0.701	81%	0.81	S	S	*	*	P	Polyproline II helix	trans	-64.5	146.5	169.6	26.7	-31.6	0	0	0	109.9
19	P	61.3	Low	52.5	Low	111 Å²	111	140.4 Å²	140.4	72%	0.721	81%	0.806	S	S	*	*	P	Polyproline II helix	trans	-63.8	144.8	-179.5	26.1	-32.7	0	0	0	110.7	T21	P19-T21 PolarHBondContact O-N 3.33Å
20	P	56.1	Low	51.5	Low	127 Å²	127	139.4 Å²	139.4	83%	0.825	81%	0.808	S	S	*	*	P	Polyproline II helix	trans	-64.4	125	178.5	25.7	-31.6	0	0	0	109.9	R22	P20-R22 PolarHBondContact O-N 3.26Å; P20-R22 VanDerWaalsContact O-N 3.15Å
21	T	53.8	Low	50.9	Low	134 Å²	134	137 Å²	137	82%	0.822	81%	0.812	S	S	*	*	P	Polyproline II helix	trans	-56.8	116.6	174.7	-44.6	0	0	0	0	109.1	P19 Q23	P19-T21 PolarHBondContact O-N 3.33Å; T21-Q23 PolarHBondContact O-N 3.22Å
22	R	52.1	Low	50	Low	236 Å²	236	134 Å²	134	89%	0.891	81%	0.808	S	S	*	*			trans	-61.3	106.4	174.4	-164.7	173.7	-176.2	153.6	-0.7	107.8	P20 L24	P20-R22 PolarHBondContact O-N 3.26Å; P20-R22 VanDerWaalsContact O-N 3.15Å; R22-L24 PolarHBondContact O-N 3.45Å; R22-L24 VanDerWaalsContact O-N 3.15Å
23	Q	52	Low	49.1	Very low	184 Å²	184	136.5 Å²	136.5	86%	0.86	82%	0.818	S	S	*	*	P	Polyproline II helix	trans	-56.4	116.8	173.6	-71	-176.9	-16.5	0	0	108.4	T21 A25	T21-Q23 PolarHBondContact O-N 3.22Å; Q23-A25 PolarHBondContact O-N 3.49Å
24	L	46.2	Very low	48.1	Very low	176 Å²	176	133.9 Å²	133.9	92%	0.921	81%	0.809	S	S	*	*	P	Polyproline II helix	trans	-62.4	121.1	167.3	-93.3	148.3	0	0	0	107.2	R22 S26	R22-L24 PolarHBondContact O-N 3.45Å; R22-L24 VanDerWaalsContact O-N 3.15Å; L24-S26 PolarHBondContact O-N 3.22Å
25	A	38.4	Very low	48	Very low	80 Å²	80	135.7 Å²	135.7	66%	0.661	81%	0.813	S	S	*	*	P	Polyproline II helix	trans	-52.5	129.9	-170.1	0	0	0	0	0	112.4	Q23 I27	Q23-A25 PolarHBondContact O-N 3.49Å; A25-I27 PolarHBondContact O-N 3.25Å; A25-I27 VanDerWaalsContact O-N 3.14Å
26	S	46.1	Very low	47.5	Very low	117 Å²	117	136.8 Å²	136.8	82%	0.818	82%	0.815	S	S	*	*			trans	-55.3	109.8	155.4	-58.4	0	0	0	0	108.8	L24 S28	L24-S26 PolarHBondContact O-N 3.22Å; S26-S28 PolarHBondContact O-N 2.97Å
27	I	42.2	Very low	46.7	Very low	157 Å²	157	131.1 Å²	131.1	81%	0.805	81%	0.813	S	S	*	*			trans	-93	86.2	168.8	-48.7	165.6	0	0	0	106.6	A25	A25-I27 PolarHBondContact O-N 3.25Å; A25-I27 VanDerWaalsContact O-N 3.14Å
28	S	39.9	Very low	46	Very low	119 Å²	119	127.9 Å²	127.9	83%	0.832	81%	0.814	S	S	*	*			trans	-93.1	105.6	158.6	-63.7	0	0	0	0	107	S26	S26-S28 PolarHBondContact O-N 2.97Å
29	A	41.8	Very low	45.2	Very low	94 Å²	94	134 Å²	134	78%	0.777	82%	0.823	S	S	*	*			trans	-108.1	119.9	164.7	0	0	0	0	0	108
30	A	37.5	Very low	44.6	Very low	99 Å²	99	133.5 Å²	133.5	82%	0.818	83%	0.828	S	S	*	*			trans	-87.1	153.7	-179.3	0	0	0	0	0	112.1
31	L	40.2	Very low	44.2	Very low	181 Å²	181	135.8 Å²	135.8	95%	0.948	83%	0.833	S	S	*	*			trans	92.6	114.5	146.9	-154.9	66.8	0	0	0	118.9
32	G	35.8	Very low	43.8	Very low	77 Å²	77	133.8 Å²	133.8	79%	0.794	83%	0.83	S	S	*	*			trans	171.2	83.9	167	0	0	0	0	0	111.6
33	D	41.6	Very low	43.7	Very low	172 Å²	172	126.6 Å²	126.6	92%	0.92	83%	0.829	S	S	*	*			trans	-71.8	139.9	176.5	-158	6.7	0	0	0	111.3
34	G	35.5	Very low	43.2	Very low	63 Å²	63	121.1 Å²	121.1	65%	0.649	82%	0.822	S	S	*	*			trans	165.5	122	176.6	0	0	0	0	0	113.8
35	P	51.5	Low	43.1	Very low	130 Å²	130	119 Å²	119	84%	0.844	82%	0.821	S	S	*	*			trans	-92.5	154.9	-174.1	35.4	-32	0	0	0	113.7
36	A	42.7	Very low	43.9	Very low	100 Å²	100	124.1 Å²	124.1	83%	0.826	83%	0.831	S	S	*	*			trans	72	102.1	162.3	0	0	0	0	0	118.7
37	A	36.7	Very low	44	Very low	97 Å²	97	121.3 Å²	121.3	80%	0.802	82%	0.82	S	S	*	*			trans	-155.5	99.5	137.5	0	0	0	0	0	110	R39	A37-R39 PolarHBondContact O-N 3.25Å
38	S	52.6	Low	44.9	Very low	123 Å²	123	120 Å²	120	86%	0.86	82%	0.819	S	S	*	*			trans	-48.3	115.7	168.5	-39.3	0	0	0	0	111.1
39	R	46.1	Very low	45.8	Very low	238 Å²	238	117.1 Å²	117.1	90%	0.898	80%	0.798	S	S	*	*			trans	-135.3	92.3	149.5	-77.6	-164.9	-123.5	146.1	2.4	108.5	A37 L41	A37-R39 PolarHBondContact O-N 3.25Å; R39-L41 PolarHBondContact O-N 3.45Å; R39-L41 VanDerWaalsContact O-N 3.09Å
40	A	49	Very low	46.8	Very low	100 Å²	100	116 Å²	116	83%	0.826	79%	0.789	S	S	*	*			trans	-53.4	109.5	157.4	0	0	0	0	0	108.1	A42	A40-A42 PolarHBondContact O-N 3.09Å
41	L	47.6	Very low	48	Very low	174 Å²	174	118.2 Å²	118.2	91%	0.911	79%	0.786	S	S	*	*			trans	-90	98.2	157.8	-150.1	82.1	0	0	0	106.5	R39	R39-L41 PolarHBondContact O-N 3.45Å; R39-L41 VanDerWaalsContact O-N 3.09Å
42	A	44.9	Very low	49.4	Very low	92 Å²	92	112.1 Å²	112.1	76%	0.76	77%	0.767	S	S	*	*			trans	-54.9	148.2	168.5	0	0	0	0	0	111.3	A40	A40-A42 PolarHBondContact O-N 3.09Å
43	G	49	Very low	50.9	Low	86 Å²	86	112.9 Å²	112.9	89%	0.887	76%	0.756	S	S	*	*			trans	94.4	83.9	146.8	0	0	0	0	0	115.1
44	G	43.1	Very low	52.5	Low	68 Å²	68	108.7 Å²	108.7	70%	0.701	73%	0.731	S	S	*	*			trans	171.7	35.9	166.7	0	0	0	0	0	113.7	Q46	G44-Q46 PolarHBondContact O-N 2.75Å
45	C	42.9	Very low	54.6	Low	133 Å²	133	112.5 Å²	112.5	90%	0.899	73%	0.732	S	S	*	*			trans	-67.5	82.2	161.1	-60.5	0	0	0	0	106.5	G47	C45-G47 PolarHBondContact O-N 3.38Å
46	Q	54.4	Low	56.3	Low	187 Å²	187	110.2 Å²	110.2	87%	0.874	71%	0.713	S	S	*	*			trans	-64	91.1	151.3	-72.2	-151.8	-0.4	0	0	104.5	G44 T48	G44-Q46 PolarHBondContact O-N 2.75Å; Q46-T48 PolarHBondContact O-N 3.09Å; Q46-T48 VanDerWaalsContact O-N 3.11Å
47	G	49.4	Very low	58.4	Low	57 Å²	57	110 Å²	110	59%	0.588	70%	0.695	S	S	*	*			trans	-50.4	123.1	169.6	0	0	0	0	0	106	C45 P49	C45-G47 PolarHBondContact O-N 3.38Å; G47-P49 WeakPolarHBondContact O-CD 3.47Å
48	T	60.1	Low	60.9	Low	129 Å²	129	110.1 Å²	110.1	79%	0.791	68%	0.681	S	S	*	*			trans	-42.5	109.5	172.1	-3.5	0	0	0	0	106.7	Q46 A50	Q46-T48 PolarHBondContact O-N 3.09Å; Q46-T48 VanDerWaalsContact O-N 3.11Å; T48-A50 PolarHBondContact O-N 2.88Å
49	P	60	Low	62.7	Low	59 Å²	59	112 Å²	112	38%	0.383	67%	0.67	S	S	.	*			trans	-57.5	136.2	177.6	20.5	-28.5	0	0	0	106.1	G47 L51 V53 Q54	G47-P49 WeakPolarHBondContact O-CD 3.47Å; P49-L51 PolarHBondContact O-N 3.21Å; P49-V53 HydrophobicContact CB-CB 4.3Å; P49-V53 HydrophobicContact CB-CG1 4.3Å; P49-Q54 HydrophobicContact CG-CB 4.21Å; P49-Q54 HydrophobicContact CG-CG 4.48Å
50	A	63.4	Low	65	Low	72 Å²	72	107 Å²	107	60%	0.595	65%	0.651	S	S	*	*			trans	-45.8	136.6	178.1	0	0	0	0	0	108.8	T48 G52 V53 Q54	T48-A50 PolarHBondContact O-N 2.88Å; A50-G52 CarbonylContact O-C 3.59Å; A50-G52 PolarHBondContact O-N 3.27Å; A50-V53 HydrophobicContact CB-CG2 4.47Å; A50-V53 WeakPolarHBondContact O-CA 3.44Å; A50-V53 WeakPolarHBondContact O-CB 3.5Å; A50-V53 PolarHBondContact O-N 3.01Å; A50-Q54 PolarHBondContact O-N 3.29Å
51	L	62.6	Low	67.1	Low	144 Å²	144	106.8 Å²	106.8	75%	0.754	63%	0.633	S	S	*	*	H	α-helix	trans	-48.9	-32.6	-167.5	-162.9	73.4	0	0	0	113.4	P49 Q55	P49-L51 PolarHBondContact O-N 3.21Å; L51-Q55 PolarHBondContact O-N 2.98Å; L51-Q55 VanDerWaalsContact O-N 3.09Å
52	G	67.8	Low	69.2	Low	53 Å²	53	104 Å²	104	55%	0.546	62%	0.618	S	S	.	*	H	α-helix	trans	-69.3	-35.7	174.6	0	0	0	0	0	115.3	A50 Q55 D56	A50-G52 CarbonylContact O-C 3.59Å; A50-G52 PolarHBondContact O-N 3.27Å; G52-Q55 PolarHBondContact O-N 2.96Å; G52-D56 PolarHBondContact O-N 3.28Å; G52-D56 VanDerWaalsContact O-N 3.09Å
53	V	69	Low	71.6	Confident	94 Å²	94	102.4 Å²	102.4	57%	0.57	60%	0.599	S	S	*	*	H	α-helix	trans	-71.9	-35.4	175.1	-179.3	0	0	0	0	110.7	P49 A50 Q55 D56 Q57	P49-V53 HydrophobicContact CB-CB 4.3Å; P49-V53 HydrophobicContact CB-CG1 4.3Å; A50-V53 HydrophobicContact CB-CG2 4.47Å; A50-V53 WeakPolarHBondContact O-CA 3.44Å; A50-V53 WeakPolarHBondContact O-CB 3.5Å; A50-V53 PolarHBondContact O-N 3.01Å; V53-Q55 VanDerWaalsContact C-N 3.31Å; V53-D56 PolarHBondContact O-N 3.45Å; V53-Q57 WeakPolarHBondContact O-CB 3.33Å; V53-Q57 PolarHBondContact O-N 2.89Å
54	Q	75.5	Confident	73.8	Confident	84 Å²	84	103.4 Å²	103.4	39%	0.393	58%	0.58	S	S	.	*	H	α-helix	trans	-65.6	-36.8	173.3	-164.7	174.9	75.1	0	0	111.4	P49 A50 Q57 L58	P49-Q54 HydrophobicContact CG-CB 4.21Å; P49-Q54 HydrophobicContact CG-CG 4.48Å; A50-Q54 PolarHBondContact O-N 3.29Å; Q54-Q57 PolarHBondContact O-N 2.97Å; Q54-L58 WeakPolarHBondContact O-CB 3.36Å; Q54-L58 VanDerWaalsContact O-CG 3.25Å; Q54-L58 WeakPolarHBondContact O-CG 3.48Å; Q54-L58 PolarHBondContact O-N 2.93Å
55	Q	77.6	Confident	76.1	Confident	143 Å²	143	102.3 Å²	102.3	67%	0.668	57%	0.565	S	S	*	*	H	α-helix	trans	-69	-39	176.7	-164.6	170.1	69.3	0	0	112.7	L51 G52 V53 L58 W59	L51-Q55 PolarHBondContact O-N 2.98Å; L51-Q55 VanDerWaalsContact O-N 3.09Å; G52-Q55 PolarHBondContact O-N 2.96Å; V53-Q55 VanDerWaalsContact C-N 3.31Å; Q55-L58 PolarHBondContact O-N 3.45Å; Q55-W59 WeakPolarHBondContact O-CB 3.47Å; Q55-W59 PolarHBondContact O-N 3.27Å
56	D	87.2	Confident	78.6	Confident	81 Å²	81	102.3 Å²	102.3	43%	0.433	55%	0.551	S	S	.	*	H	α-helix	trans	-63.6	-42.3	173.2	-170.5	67.2	0	0	0	111.7	G52 V53 W59 R60	G52-D56 PolarHBondContact O-N 3.28Å; G52-D56 VanDerWaalsContact O-N 3.09Å; V53-D56 PolarHBondContact O-N 3.45Å; D56-W59 PolarHBondContact O-N 3.45Å; D56-R60 WeakPolarHBondContact O-CG 3.25Å; D56-R60 PolarHBondContact O-N 3.03Å; D56-R60 IonicContact OD2-CZ 3.47Å; D56-R60 IonicContact OD2-NE 3.99Å; D56-R60 PolarHBondContact OD2-NE 3.34Å
57	Q	87.1	Confident	80.5	Confident	96 Å²	96	95.6 Å²	95.6	45%	0.449	53%	0.528	S	S	.	.	H	α-helix	trans	-63.4	-44.5	176.9	-175.3	59.6	32.9	0	0	111.9	V53 Q54 W59 R60 E61	V53-Q57 WeakPolarHBondContact O-CB 3.33Å; V53-Q57 PolarHBondContact O-N 2.89Å; Q54-Q57 PolarHBondContact O-N 2.97Å; Q57-W59 VanDerWaalsContact C-N 3.31Å; Q57-W59 PolarHBondContact O-N 2.96Å; Q57-R60 PolarHBondContact O-N 2.93Å; Q57-E61 PolarHBondContact NE2-OE1 2.85Å; Q57-E61 WeakPolarHBondContact O-CG 3.46Å; Q57-E61 PolarHBondContact O-N 3.39Å
58	L	90	Very high	82.6	Confident	100 Å²	100	98.4 Å²	98.4	52%	0.524	52%	0.521	S	S	.	.	H	α-helix	trans	-63.2	-38.7	175.2	-72.9	172.1	0	0	0	111.9	Q54 Q55 E61 L62	Q54-L58 WeakPolarHBondContact O-CB 3.36Å; Q54-L58 VanDerWaalsContact O-CG 3.25Å; Q54-L58 WeakPolarHBondContact O-CG 3.48Å; Q54-L58 PolarHBondContact O-N 2.93Å; Q55-L58 PolarHBondContact O-N 3.45Å; L58-E61 PolarHBondContact O-N 3.48Å; L58-L62 WeakPolarHBondContact O-CB 3.18Å; L58-L62 PolarHBondContact O-N 3.15Å
59	W	90.8	Very high	84	Confident	162 Å²	162	94 Å²	94	61%	0.614	50%	0.501	S	S	*	.	H	α-helix	trans	-64.7	-44.9	176.6	-173.3	83	0	0	0	111.5	Q55 D56 Q57 E61 L62 V63	Q55-W59 WeakPolarHBondContact O-CB 3.47Å; Q55-W59 PolarHBondContact O-N 3.27Å; D56-W59 PolarHBondContact O-N 3.45Å; Q57-W59 VanDerWaalsContact C-N 3.31Å; Q57-W59 PolarHBondContact O-N 2.96Å; W59-E61 VanDerWaalsContact C-N 3.35Å; W59-E61 PolarHBondContact O-N 3.46Å; W59-L62 PolarHBondContact O-N 3.05Å; W59-V63 HydrophobicContact CD2-CG2 4Å; W59-V63 HydrophobicContact CE3-CG2 4.2Å; W59-V63 HydrophobicContact CH2-CG2 4Å; W59-V63 HydrophobicContact CZ2-CG2 3.78Å; W59-V63 HydrophobicContact CZ3-CG2 4.2Å; W59-V63 WeakPolarHBondContact O-CG2 3.39Å; W59-V63 PolarHBondContact O-N 3.11Å
60	R	93.2	Very high	85.4	Confident	133 Å²	133	96.6 Å²	96.6	50%	0.502	51%	0.508	S	S	.	.	H	α-helix	trans	-57.8	-46.7	173.8	-74.9	168.6	170.9	-93.2	-4.3	111.7	D56 Q57 L62 V63 E64	D56-R60 WeakPolarHBondContact O-CG 3.25Å; D56-R60 PolarHBondContact O-N 3.03Å; D56-R60 IonicContact OD2-CZ 3.47Å; D56-R60 IonicContact OD2-NE 3.99Å; D56-R60 PolarHBondContact OD2-NE 3.34Å; Q57-R60 PolarHBondContact O-N 2.93Å; R60-L62 VanDerWaalsContact C-N 3.34Å; R60-L62 PolarHBondContact O-N 2.88Å; R60-V63 PolarHBondContact O-N 3.43Å; R60-E64 WeakPolarHBondContact O-CB 3.43Å; R60-E64 WeakPolarHBondContact O-CG 3.36Å; R60-E64 PolarHBondContact O-N 2.94Å
61	E	93.3	Very high	86.7	Confident	95 Å²	95	101.6 Å²	101.6	44%	0.444	51%	0.512	S	S	.	.	H	α-helix	trans	-63.5	-38.6	179	-74.7	173.2	-162.8	0	0	112.6	Q57 L58 W59 A65	Q57-E61 PolarHBondContact NE2-OE1 2.85Å; Q57-E61 WeakPolarHBondContact O-CG 3.46Å; Q57-E61 PolarHBondContact O-N 3.39Å; L58-E61 PolarHBondContact O-N 3.48Å; W59-E61 VanDerWaalsContact C-N 3.35Å; W59-E61 PolarHBondContact O-N 3.46Å; E61-A65 VanDerWaalsContact O-CB 3.25Å; E61-A65 WeakPolarHBondContact O-CB 3.32Å; E61-A65 PolarHBondContact O-N 2.96Å
62	L	92.9	Very high	88	Confident	117 Å²	117	102.5 Å²	102.5	61%	0.613	51%	0.505	S	S	*	.	H	α-helix	trans	-64.9	-48.9	176.2	-169.3	85.8	0	0	0	111.4	L58 W59 R60 E64 A65 E66	L58-L62 WeakPolarHBondContact O-CB 3.18Å; L58-L62 PolarHBondContact O-N 3.15Å; W59-L62 PolarHBondContact O-N 3.05Å; R60-L62 VanDerWaalsContact C-N 3.34Å; R60-L62 PolarHBondContact O-N 2.88Å; L62-E64 VanDerWaalsContact C-N 3.31Å; L62-E64 PolarHBondContact O-N 3.39Å; L62-A65 PolarHBondContact O-N 3.42Å; L62-A65 VanDerWaalsContact O-N 3.15Å; L62-E66 WeakPolarHBondContact O-CB 3.34Å; L62-E66 PolarHBondContact O-N 2.95Å
63	V	95.1	Very high	89.1	Confident	58 Å²	58	105.8 Å²	105.8	35%	0.352	50%	0.501	S	S	.	.	H	α-helix	trans	-61.3	-42.3	179.1	170.7	0	0	0	0	110.6	W59 R60 E66 A67	W59-V63 HydrophobicContact CD2-CG2 4Å; W59-V63 HydrophobicContact CE3-CG2 4.2Å; W59-V63 HydrophobicContact CH2-CG2 4Å; W59-V63 HydrophobicContact CZ2-CG2 3.78Å; W59-V63 HydrophobicContact CZ3-CG2 4.2Å; W59-V63 WeakPolarHBondContact O-CG2 3.39Å; W59-V63 PolarHBondContact O-N 3.11Å; R60-V63 PolarHBondContact O-N 3.43Å; V63-E66 PolarHBondContact O-N 3.47Å; V63-A67 WeakPolarHBondContact O-CB 3.48Å; V63-A67 PolarHBondContact O-N 2.92Å
64	E	93.9	Very high	90.1	Very high	106 Å²	106	103.8 Å²	103.8	50%	0.495	49%	0.494	S	S	.	.	H	α-helix	trans	-66.7	-39.2	175	-72.4	-177.5	-173.8	0	0	112.4	R60 L62 A67 R68	R60-E64 WeakPolarHBondContact O-CB 3.43Å; R60-E64 WeakPolarHBondContact O-CG 3.36Å; R60-E64 PolarHBondContact O-N 2.94Å; L62-E64 VanDerWaalsContact C-N 3.31Å; L62-E64 PolarHBondContact O-N 3.39Å; E64-A67 PolarHBondContact O-N 2.84Å; E64-R68 WeakPolarHBondContact O-CB 3.11Å; E64-R68 VanDerWaalsContact O-CG 3.26Å; E64-R68 WeakPolarHBondContact O-CG 3.25Å; E64-R68 PolarHBondContact O-N 2.79Å; E64-R68 IonicContact OE2-NH1 3.76Å; E64-R68 PolarHBondContact OE2-NH1 3.44Å
65	A	92.6	Very high	90.8	Very high	45 Å²	45	106.8 Å²	106.8	37%	0.372	51%	0.509	S	S	.	.	H	α-helix	trans	-63.7	-42.1	176.5	0	0	0	0	0	111.9	E61 L62 R68 G69	E61-A65 VanDerWaalsContact O-CB 3.25Å; E61-A65 WeakPolarHBondContact O-CB 3.32Å; E61-A65 PolarHBondContact O-N 2.96Å; L62-A65 PolarHBondContact O-N 3.42Å; L62-A65 VanDerWaalsContact O-N 3.15Å; A65-R68 VanDerWaalsContact CA-NH2 3.34Å; A65-R68 PolarHBondContact O-N 3.4Å; A65-G69 PolarHBondContact O-N 2.95Å
66	E	95.3	Very high	91.3	Very high	133 Å²	133	104.8 Å²	104.8	62%	0.621	50%	0.502	S	S	*	.	H	α-helix	trans	-62	-48.3	173.6	-176.1	176.7	-164	0	0	110.9	L62 V63 R68 G69 Q70	L62-E66 WeakPolarHBondContact O-CB 3.34Å; L62-E66 PolarHBondContact O-N 2.95Å; V63-E66 PolarHBondContact O-N 3.47Å; E66-R68 VanDerWaalsContact C-N 3.3Å; E66-R68 PolarHBondContact O-N 3.24Å; E66-G69 CarbonylContact O-C 3.56Å; E66-G69 WeakPolarHBondContact O-CA 3.3Å; E66-G69 PolarHBondContact O-N 3.33Å; E66-G69 VanDerWaalsContact O-N 3.07Å; E66-Q70 WeakPolarHBondContact O-CB 3.14Å; E66-Q70 PolarHBondContact O-N 3.44Å
67	A	93.6	Very high	91.1	Very high	46 Å²	46	107.7 Å²	107.7	38%	0.38	51%	0.507	S	S	.	.	H	α-helix	trans	-60.1	-39.5	177.9	0	0	0	0	0	112.5	V63 E64 R71	V63-A67 WeakPolarHBondContact O-CB 3.48Å; V63-A67 PolarHBondContact O-N 2.92Å; E64-A67 PolarHBondContact O-N 2.84Å; A67-R71 WeakPolarHBondContact O-CG 3.46Å; A67-R71 PolarHBondContact O-N 2.83Å
68	R	92.9	Very high	90.8	Very high	117 Å²	117	103.3 Å²	103.3	44%	0.442	49%	0.488	S	S	.	.	H	α-helix	trans	-67	-41.3	173.5	-71.3	-174.6	-54.1	-102.1	2.7	111.7	E64 A65 E66 R71 R72	E64-R68 WeakPolarHBondContact O-CB 3.11Å; E64-R68 VanDerWaalsContact O-CG 3.26Å; E64-R68 WeakPolarHBondContact O-CG 3.25Å; E64-R68 PolarHBondContact O-N 2.79Å; E64-R68 IonicContact OE2-NH1 3.76Å; E64-R68 PolarHBondContact OE2-NH1 3.44Å; A65-R68 VanDerWaalsContact CA-NH2 3.34Å; A65-R68 PolarHBondContact O-N 3.4Å; E66-R68 VanDerWaalsContact C-N 3.3Å; E66-R68 PolarHBondContact O-N 3.24Å; R68-R71 PolarHBondContact O-N 2.77Å; R68-R72 WeakPolarHBondContact O-CB 3.16Å; R68-R72 WeakPolarHBondContact O-CG 3.25Å; R68-R72 PolarHBondContact O-N 3.37Å
69	G	90.4	Very high	90.3	Very high	37 Å²	37	103.3 Å²	103.3	38%	0.381	48%	0.484	S	S	.	.	H	α-helix	trans	-60.8	-45.6	175.2	0	0	0	0	0	111.7	A65 E66 R71 R72 W73	A65-G69 PolarHBondContact O-N 2.95Å; E66-G69 CarbonylContact O-C 3.56Å; E66-G69 WeakPolarHBondContact O-CA 3.3Å; E66-G69 PolarHBondContact O-N 3.33Å; E66-G69 VanDerWaalsContact O-N 3.07Å; G69-R71 PolarHBondContact O-N 2.8Å; G69-R72 PolarHBondContact O-N 3.15Å; G69-W73 VanDerWaalsContact O-CB 3.3Å; G69-W73 WeakPolarHBondContact O-CB 3.33Å; G69-W73 PolarHBondContact O-N 3.49Å
70	Q	89.1	Confident	89.8	Confident	113 Å²	113	100.7 Å²	100.7	53%	0.528	48%	0.481	S	S	.	.	H	α-helix	trans	-61.8	-44	177.5	-167.7	67.2	19.1	0	0	111.8	E66 W73 A74	E66-Q70 WeakPolarHBondContact O-CB 3.14Å; E66-Q70 PolarHBondContact O-N 3.44Å; Q70-W73 PolarHBondContact O-N 3.05Å; Q70-A74 WeakPolarHBondContact O-CB 3.41Å; Q70-A74 PolarHBondContact O-N 3.39Å
71	R	90.6	Very high	89.1	Confident	176 Å²	176	100.6 Å²	100.6	66%	0.664	48%	0.484	S	S	*	.	H	α-helix	trans	-61.9	-49.6	175.2	-74.5	176.2	-162.7	-106.2	1.9	111.7	A67 R68 G69 W73 A74 E75	A67-R71 WeakPolarHBondContact O-CG 3.46Å; A67-R71 PolarHBondContact O-N 2.83Å; R68-R71 PolarHBondContact O-N 2.77Å; G69-R71 PolarHBondContact O-N 2.8Å; R71-W73 VanDerWaalsContact C-N 3.29Å; R71-W73 PolarHBondContact O-N 3.01Å; R71-A74 PolarHBondContact O-N 3.07Å; R71-A74 VanDerWaalsContact O-N 3.15Å; R71-E75 WeakPolarHBondContact O-CG 3.15Å; R71-E75 PolarHBondContact O-N 2.85Å
72	R	91.1	Very high	88.5	Confident	163 Å²	163	99.4 Å²	99.4	62%	0.615	48%	0.481	S	S	*	.	H	α-helix	trans	-60.9	-39.5	177.4	-71.7	174.8	-179.1	-175.5	0.3	111.7	R68 G69 E75 N76	R68-R72 WeakPolarHBondContact O-CB 3.16Å; R68-R72 WeakPolarHBondContact O-CG 3.25Å; R68-R72 PolarHBondContact O-N 3.37Å; G69-R72 PolarHBondContact O-N 3.15Å; R72-E75 PolarHBondContact O-N 3.33Å; R72-N76 WeakPolarHBondContact O-CB 3.05Å; R72-N76 PolarHBondContact O-N 2.92Å; R72-N76 PolarHBondContact O-ND2 3.34Å
73	W	91.1	Very high	87.9	Confident	122 Å²	122	97.9 Å²	97.9	46%	0.462	47%	0.468	S	S	.	.	H	α-helix	trans	-66.3	-42.7	175.5	-177.2	90.5	0	0	0	111.2	G69 Q70 R71 E75 N76 W77 G78	G69-W73 VanDerWaalsContact O-CB 3.3Å; G69-W73 WeakPolarHBondContact O-CB 3.33Å; G69-W73 PolarHBondContact O-N 3.49Å; Q70-W73 PolarHBondContact O-N 3.05Å; R71-W73 VanDerWaalsContact C-N 3.29Å; R71-W73 PolarHBondContact O-N 3.01Å; W73-E75 VanDerWaalsContact C-N 3.34Å; W73-E75 PolarHBondContact O-N 3.41Å; W73-N76 PolarHBondContact O-N 2.98Å; W73-W77 AromaticContact CD1-CD1 3.79Å; W73-W77 HydrophobicContact CD2-CB 4.3Å; W73-W77 HydrophobicContact CG-CB 4.35Å; W73-W77 HydrophobicContact CZ2-CB 4.44Å; W73-W77 CarbonylContact O-C 3.41Å; W73-W77 VanDerWaalsContact O-CA 3.26Å; W73-W77 WeakPolarHBondContact O-CA 3.32Å; W73-W77 WeakPolarHBondContact O-CB 3.5Å; W73-W77 PolarHBondContact O-N 3.26Å; W73-G78 PolarHBondContact O-N 3.5Å; W73-G78 VanDerWaalsContact O-N 3.08Å
74	A	89.4	Confident	87.2	Confident	52 Å²	52	98.3 Å²	98.3	43%	0.43	47%	0.468	S	S	.	.	H	α-helix	trans	-64.2	-37.9	176.3	0	0	0	0	0	112.4	Q70 R71 G78	Q70-A74 WeakPolarHBondContact O-CB 3.41Å; Q70-A74 PolarHBondContact O-N 3.39Å; R71-A74 PolarHBondContact O-N 3.07Å; R71-A74 VanDerWaalsContact O-N 3.15Å; A74-G78 WeakPolarHBondContact O-CA 3.38Å; A74-G78 PolarHBondContact O-N 2.76Å
75	E	89.4	Confident	86.4	Confident	148 Å²	148	99.7 Å²	99.7	69%	0.692	49%	0.487	S	S	*	.	H	α-helix	trans	-69.3	-45.8	176.4	-71.8	164.1	-166.2	0	0	112.2	R71 R72 W73	R71-E75 WeakPolarHBondContact O-CG 3.15Å; R71-E75 PolarHBondContact O-N 2.85Å; R72-E75 PolarHBondContact O-N 3.33Å; W73-E75 VanDerWaalsContact C-N 3.34Å; W73-E75 PolarHBondContact O-N 3.41Å
76	N	87.8	Confident	85.9	Confident	101 Å²	101	104.7 Å²	104.7	54%	0.54	51%	0.506	S	S	.	.	H	α-helix	trans	-86.6	-32.3	-173.9	-68.7	-70.9	0	0	0	113.5	R72 W73 F79	R72-N76 WeakPolarHBondContact O-CB 3.05Å; R72-N76 PolarHBondContact O-N 2.92Å; R72-N76 PolarHBondContact O-ND2 3.34Å; W73-N76 PolarHBondContact O-N 2.98Å; N76-F79 WeakPolarHBondContact O-CE1 3.26Å
77	W	84.1	Confident	85.2	Confident	141 Å²	141	100.7 Å²	100.7	53%	0.534	50%	0.501	S	S	.	.	H	α-helix	trans	-128.7	-2.7	-171.9	-62.4	119.5	0	0	0	113.6	W73 F79 L80	W73-W77 AromaticContact CD1-CD1 3.79Å; W73-W77 HydrophobicContact CD2-CB 4.3Å; W73-W77 HydrophobicContact CG-CB 4.35Å; W73-W77 HydrophobicContact CZ2-CB 4.44Å; W73-W77 CarbonylContact O-C 3.41Å; W73-W77 VanDerWaalsContact O-CA 3.26Å; W73-W77 WeakPolarHBondContact O-CA 3.32Å; W73-W77 WeakPolarHBondContact O-CB 3.5Å; W73-W77 PolarHBondContact O-N 3.26Å; W77-F79 AromaticContact CE3-CE1 3.8Å; W77-F79 HydrophobicContact CE3-CE1 3.8Å; W77-F79 AromaticContact CE3-CZ 3.95Å; W77-F79 HydrophobicContact CE3-CZ 3.95Å; W77-F79 HydrophobicContact CZ3-CE1 4.15Å; W77-F79 AromaticContact CZ3-CZ 4Å; W77-F79 HydrophobicContact CZ3-CZ 4Å; W77-F79 PolarHBondContact O-N 2.99Å; W77-F79 VanDerWaalsContact O-N 3.12Å; W77-L80 VanDerWaalsContact O-CB 3.25Å; W77-L80 WeakPolarHBondContact O-CB 3.46Å; W77-L80 PolarHBondContact O-N 2.86Å
78	G	80.4	Confident	84.6	Confident	4 Å²	4	103 Å²	103	4%	0.041	51%	0.507	C	S	.	.	G	3₁₀ helix	trans	-60.9	-24.2	179.1	0	0	0	0	0	112.7	W73 A74 L80 K81	W73-G78 PolarHBondContact O-N 3.5Å; W73-G78 VanDerWaalsContact O-N 3.08Å; A74-G78 WeakPolarHBondContact O-CA 3.38Å; A74-G78 PolarHBondContact O-N 2.76Å; G78-L80 PolarHBondContact O-N 3.33Å; G78-K81 WeakPolarHBondContact O-CD 3.27Å; G78-K81 WeakPolarHBondContact O-CE 3.36Å; G78-K81 WeakPolarHBondContact O-CG 3.34Å; G78-K81 PolarHBondContact O-N 2.77Å
79	F	79.1	Confident	84	Confident	101 Å²	101	105.2 Å²	105.2	44%	0.443	52%	0.519	S	S	.	.	G	3₁₀ helix	trans	-61	-31.5	174.1	75.6	-95.1	0	0	0	112.1	N76 W77 K81 D82 Y83	N76-F79 WeakPolarHBondContact O-CE1 3.26Å; W77-F79 AromaticContact CE3-CE1 3.8Å; W77-F79 HydrophobicContact CE3-CE1 3.8Å; W77-F79 AromaticContact CE3-CZ 3.95Å; W77-F79 HydrophobicContact CE3-CZ 3.95Å; W77-F79 HydrophobicContact CZ3-CE1 4.15Å; W77-F79 AromaticContact CZ3-CZ 4Å; W77-F79 HydrophobicContact CZ3-CZ 4Å; W77-F79 PolarHBondContact O-N 2.99Å; W77-F79 VanDerWaalsContact O-N 3.12Å; F79-K81 PolarHBondContact O-N 3.48Å; F79-K81 VanDerWaalsContact O-N 3.15Å; F79-D82 WeakPolarHBondContact O-CB 3.46Å; F79-D82 PolarHBondContact O-N 2.96Å; F79-Y83 HydrophobicContact CB-CE2 4.09Å; F79-Y83 AromaticContact CD2-CD2 3.87Å; F79-Y83 HydrophobicContact CD2-CD2 3.87Å; F79-Y83 AromaticContact CD2-CE2 3.83Å; F79-Y83 HydrophobicContact CD2-CE2 3.83Å; F79-Y83 HydrophobicContact CG-CE2 4.45Å; F79-Y83 WeakPolarHBondContact O-CD2 3.48Å; F79-Y83 WeakPolarHBondContact O-CE2 3.45Å
80	L	81.3	Confident	83.5	Confident	107 Å²	107	108.7 Å²	108.7	56%	0.56	52%	0.524	S	S	*	.	G	3₁₀ helix	trans	-62.8	-25.3	-176.7	-161.1	70.2	0	0	0	112.8	W77 G78 D82 Y83	W77-L80 VanDerWaalsContact O-CB 3.25Å; W77-L80 WeakPolarHBondContact O-CB 3.46Å; W77-L80 PolarHBondContact O-N 2.86Å; G78-L80 PolarHBondContact O-N 3.33Å; L80-D82 PolarHBondContact O-N 3.28Å; L80-Y83 PolarHBondContact O-N 3.12Å
81	K	78.7	Confident	82.8	Confident	130 Å²	130	111.9 Å²	111.9	57%	0.565	54%	0.539	S	S	*	.	G	3₁₀ helix	trans	-68.5	-23.3	176	84.4	-158.4	161.2	57.1	0	112.5	G78 F79	G78-K81 WeakPolarHBondContact O-CD 3.27Å; G78-K81 WeakPolarHBondContact O-CE 3.36Å; G78-K81 WeakPolarHBondContact O-CG 3.34Å; G78-K81 PolarHBondContact O-N 2.77Å; F79-K81 PolarHBondContact O-N 3.48Å; F79-K81 VanDerWaalsContact O-N 3.15Å
82	D	80.2	Confident	81.9	Confident	70 Å²	70	109.1 Å²	109.1	37%	0.374	54%	0.544	S	S	.	.	G	3₁₀ helix	trans	-98	1.1	-174.2	-55.5	-38.4	0	0	0	111.8	F79 L80 K89 K90	F79-D82 WeakPolarHBondContact O-CB 3.46Å; F79-D82 PolarHBondContact O-N 2.96Å; L80-D82 PolarHBondContact O-N 3.28Å; D82-K89 CarbonylContact O-C 3.51Å; D82-K89 WeakPolarHBondContact O-CA 3.33Å; D82-K90 PolarHBondContact O-N 2.94Å
83	Y	79.8	Confident	80.9	Confident	86 Å²	86	109.4 Å²	109.4	34%	0.337	55%	0.552	S	S	.	*	B	Isolated β-bridge	trans	-119	138.8	178.3	-65	-82.1	0	0	0	112.5	F79 L80 G87 N88 K89	F79-Y83 HydrophobicContact CB-CE2 4.09Å; F79-Y83 AromaticContact CD2-CD2 3.87Å; F79-Y83 HydrophobicContact CD2-CD2 3.87Å; F79-Y83 AromaticContact CD2-CE2 3.83Å; F79-Y83 HydrophobicContact CD2-CE2 3.83Å; F79-Y83 HydrophobicContact CG-CE2 4.45Å; F79-Y83 WeakPolarHBondContact O-CD2 3.48Å; F79-Y83 WeakPolarHBondContact O-CE2 3.45Å; L80-Y83 PolarHBondContact O-N 3.12Å; Y83-G87 WeakPolarHBondContact CD1-O 3.03Å; Y83-N88 CarbonylContact C-O 3.54Å; Y83-N88 VanDerWaalsContact CA-O 3.27Å; Y83-N88 WeakPolarHBondContact CA-O 3.08Å; Y83-K89 HydrophobicContact CD1-CG 4.1Å; Y83-K89 HydrophobicContact CE1-CG 3.5Å
84	D	80	Confident	80	Confident	66 Å²	66	112.2 Å²	112.2	35%	0.353	57%	0.571	S	S	.	*			trans	-74.8	163.6	169.1	-86.5	-24.3	0	0	0	111.2	L86 G87 N88 K90	D84-L86 PolarHBondContact O-N 3.08Å; D84-G87 WeakPolarHBondContact O-CA 3.48Å; D84-G87 PolarHBondContact O-N 2.96Å; D84-N88 PolarHBondContact N-O 2.73Å; D84-K90 HydrophobicContact CB-CG 4.34Å; D84-K90 WeakPolarHBondContact OD1-CD 3.34Å; D84-K90 WeakPolarHBondContact OD1-CE 3.26Å; D84-K90 VanDerWaalsContact OD1-CG 3.25Å; D84-K90 WeakPolarHBondContact OD1-CG 3.25Å; D84-K90 IonicContact OD1-NZ 2.98Å
85	P	77.6	Confident	79.3	Confident	136 Å²	136	116.8 Å²	116.8	88%	0.883	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56	-20.7	176	-25.4	34.3	0	0	0	114.4	G87	P85-G87 VanDerWaalsContact C-N 3.33Å
86	L	82.4	Confident	78.8	Confident	150 Å²	150	114 Å²	114	79%	0.785	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.2	1.5	173.2	-101	67.7	0	0	0	114	D84 N88	D84-L86 PolarHBondContact O-N 3.08Å; L86-N88 VanDerWaalsContact C-N 3.32Å; L86-N88 PolarHBondContact O-N 3.45Å
87	G	79.8	Confident	78.3	Confident	49 Å²	49	114.7 Å²	114.7	51%	0.505	60%	0.602	S	S	.	*	S	Bend	trans	79.3	8.8	179.9	0	0	0	0	0	115	Y83 D84 P85	Y83-G87 WeakPolarHBondContact CD1-O 3.03Å; D84-G87 WeakPolarHBondContact O-CA 3.48Å; D84-G87 PolarHBondContact O-N 2.96Å; P85-G87 VanDerWaalsContact C-N 3.33Å
88	N	81.8	Confident	77.6	Confident	95 Å²	95	112.6 Å²	112.6	51%	0.508	61%	0.608	S	S	.	*	P	Polyproline II helix	trans	-82	144.4	176.8	-64.4	-38.2	0	0	0	110.6	Y83 D84 L86 K90	Y83-N88 CarbonylContact C-O 3.54Å; Y83-N88 VanDerWaalsContact CA-O 3.27Å; Y83-N88 WeakPolarHBondContact CA-O 3.08Å; D84-N88 PolarHBondContact N-O 2.73Å; L86-N88 VanDerWaalsContact C-N 3.32Å; L86-N88 PolarHBondContact O-N 3.45Å; N88-K90 PolarHBondContact O-N 3.45Å
89	K	80.4	Confident	77.3	Confident	162 Å²	162	117.6 Å²	117.6	70%	0.704	64%	0.638	S	S	*	*	B	Isolated β-bridge	trans	-66.1	124	173.4	-68.5	-179.1	179	-179.4	0	109.2	D82 Y83	D82-K89 CarbonylContact O-C 3.51Å; D82-K89 WeakPolarHBondContact O-CA 3.33Å; Y83-K89 HydrophobicContact CD1-CG 4.1Å; Y83-K89 HydrophobicContact CE1-CG 3.5Å
90	K	78.6	Confident	77.2	Confident	110 Å²	110	116.3 Å²	116.3	48%	0.478	64%	0.64	S	S	.	*	P	Polyproline II helix	trans	-69.9	128.7	173.1	-63.2	-172.6	78.1	173.3	0	108.4	D82 D84 N88	D82-K90 PolarHBondContact O-N 2.94Å; D84-K90 HydrophobicContact CB-CG 4.34Å; D84-K90 WeakPolarHBondContact OD1-CD 3.34Å; D84-K90 WeakPolarHBondContact OD1-CE 3.26Å; D84-K90 VanDerWaalsContact OD1-CG 3.25Å; D84-K90 WeakPolarHBondContact OD1-CG 3.25Å; D84-K90 IonicContact OD1-NZ 2.98Å; N88-K90 PolarHBondContact O-N 3.45Å
91	E	75.8	Confident	76.6	Confident	180 Å²	180	120 Å²	120	84%	0.841	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-63.2	133.6	165.3	-67.3	-163.4	154.5	0	0	108.3	Q93	E91-Q93 PolarHBondContact O-N 3.49Å
92	P	70.5	Confident	76.1	Confident	119 Å²	119	118.7 Å²	118.7	77%	0.773	65%	0.646	S	S	*	*	P	Polyproline II helix	trans	-57.2	117.3	176.4	-18.3	29.2	0	0	0	108.2	E94	P92-E94 PolarHBondContact O-N 2.86Å
93	Q	70.3	Confident	75.5	Confident	169 Å²	169	118.3 Å²	118.3	79%	0.79	65%	0.649	S	S	*	*			trans	-64.4	111.6	173.7	-178.1	168.3	48.2	0	0	107.3	E91 L95	E91-Q93 PolarHBondContact O-N 3.49Å; Q93-L95 PolarHBondContact O-N 3.15Å
94	E	73.1	Confident	75.1	Confident	181 Å²	181	121.7 Å²	121.7	85%	0.846	67%	0.673	S	S	*	*			trans	-60	109	172.6	-68.4	-172.4	167.9	0	0	107.6	P92	P92-E94 PolarHBondContact O-N 2.86Å
95	L	75	Confident	74.8	Confident	147 Å²	147	123.9 Å²	123.9	77%	0.77	69%	0.689	S	S	*	*			trans	-63.6	132	176	-67.9	173.9	0	0	0	107.4	Q93 A97	Q93-L95 PolarHBondContact O-N 3.15Å; L95-A97 PolarHBondContact O-N 3.37Å
96	P	78.7	Confident	74.6	Confident	89 Å²	89	124.3 Å²	124.3	58%	0.578	68%	0.677	S	S	*	*			trans	-56.4	130.4	176.6	12.7	-20.9	0	0	0	109.9	S98 V99	P96-S98 PolarHBondContact O-N 2.76Å; P96-V99 HydrophobicContact CB-CG2 4.28Å; P96-V99 HydrophobicContact CG-CG2 3.7Å
97	A	76.8	Confident	74	Confident	117 Å²	117	123.2 Å²	123.2	97%	0.967	68%	0.679	S	S	*	*	S	Bend	trans	-57.7	-19	-173.9	0	0	0	0	0	114.3	L95	L95-A97 PolarHBondContact O-N 3.37Å
98	S	68.6	Low	73.1	Confident	96 Å²	96	123.5 Å²	123.5	67%	0.671	67%	0.672	S	S	*	*			trans	-152.2	108.5	179.1	169	0	0	0	0	108.1	P96	P96-S98 PolarHBondContact O-N 2.76Å
99	V	74.9	Confident	72.5	Confident	110 Å²	110	124.1 Å²	124.1	67%	0.667	68%	0.684	S	S	*	*			trans	-99.4	111.3	161.7	-176.7	0	0	0	0	105.7	P96 F101	P96-V99 HydrophobicContact CB-CG2 4.28Å; P96-V99 HydrophobicContact CG-CG2 3.7Å; V99-F101 PolarHBondContact O-N 3.09Å
100	P	77.4	Confident	71.8	Confident	73 Å²	73	121.8 Å²	121.8	47%	0.474	68%	0.684	S	S	.	*			trans	-60	129	178.1	25.1	-32.2	0	0	0	108.8	F102	P100-F102 WeakPolarHBondContact CB-O 3.33Å; P100-F102 PolarHBondContact O-N 3.48Å
101	F	67.7	Low	71	Confident	186 Å²	186	121.9 Å²	121.9	82%	0.816	69%	0.689	S	S	*	*	S	Bend	trans	-60.6	-28	180	-179.8	-95.6	0	0	0	111.8	V99	V99-F101 PolarHBondContact O-N 3.09Å
102	F	69.1	Low	70.4	Confident	101 Å²	101	124.5 Å²	124.5	44%	0.443	69%	0.692	S	S	.	*	S	Bend	trans	-106.3	135.5	173.5	-58.9	-69.2	0	0	0	109.5	P100 D104 C108	P100-F102 WeakPolarHBondContact CB-O 3.33Å; P100-F102 PolarHBondContact O-N 3.48Å; F102-D104 PolarHBondContact O-N 3.32Å; F102-C108 HydrophobicContact CD1-CB 3.64Å; F102-C108 HydrophobicContact CE1-CB 3.95Å; F102-C108 WeakPolarHBondContact CE1-SG 3.2Å
103	S	66.9	Low	69.9	Low	63 Å²	63	127.3 Å²	127.3	44%	0.441	69%	0.694	S	S	.	*			trans	-68.9	128.4	169	55	0	0	0	0	109.9	T105 F106	S103-T105 PolarHBondContact O-N 3.09Å; S103-F106 PolarHBondContact O-N 3.31Å; S103-F106 VanDerWaalsContact O-O 3.1Å; S103-F106 PolarHBondContact OG-O 3Å
104	D	70.9	Confident	69.5	Low	156 Å²	156	125.8 Å²	125.8	83%	0.834	70%	0.696	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.7	-16.6	171.2	-64.6	-37.5	0	0	0	112.5	F102	F102-D104 PolarHBondContact O-N 3.32Å
105	T	74.8	Confident	68.7	Low	112 Å²	112	120 Å²	120	69%	0.687	69%	0.685	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.1	-25.7	-177.8	-41.9	0	0	0	0	113.6	S103	S103-T105 PolarHBondContact O-N 3.09Å
106	F	73.3	Confident	68	Low	146 Å²	146	118.4 Å²	118.4	64%	0.64	69%	0.687	S	S	*	*	S	Bend	trans	-131.8	128.5	-174.4	-61.1	-76.9	0	0	0	111.4	S103 C108	S103-F106 PolarHBondContact O-N 3.31Å; S103-F106 VanDerWaalsContact O-O 3.1Å; S103-F106 PolarHBondContact OG-O 3Å; F106-C108 PolarHBondContact O-N 3.23Å
107	P	69.6	Low	67.2	Low	126 Å²	126	125.6 Å²	125.6	82%	0.818	70%	0.702	S	S	*	*			trans	-61.7	126.9	174.9	25.5	-32.3	0	0	0	109.9	S109	P107-S109 PolarHBondContact O-N 3.35Å
108	C	61.6	Low	65.6	Low	55 Å²	55	129.8 Å²	129.8	37%	0.372	72%	0.715	S	S	.	*			trans	-72.1	109.4	176.1	-174.2	0	0	0	0	109.9	F102 F106 T110	F102-C108 HydrophobicContact CD1-CB 3.64Å; F102-C108 HydrophobicContact CE1-CB 3.95Å; F102-C108 WeakPolarHBondContact CE1-SG 3.2Å; F106-C108 PolarHBondContact O-N 3.23Å; C108-T110 PolarHBondContact O-N 3.27Å; C108-T110 VanDerWaalsContact SG-CB 3.57Å
109	S	68.6	Low	65.4	Low	108 Å²	108	131.5 Å²	131.5	76%	0.755	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.6	3.9	177.5	70.7	0	0	0	0	113.9	P107 N111	P107-S109 PolarHBondContact O-N 3.35Å; S109-N111 VanDerWaalsContact C-N 3.29Å; S109-N111 PolarHBondContact O-N 3.32Å
110	T	64.8	Low	64.9	Low	114 Å²	114	132.6 Å²	132.6	70%	0.699	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.1	-25.8	-175	-59.4	0	0	0	0	112.2	C108 R112	C108-T110 PolarHBondContact O-N 3.27Å; C108-T110 VanDerWaalsContact SG-CB 3.57Å; T110-R112 PolarHBondContact O-N 3.27Å
111	N	62	Low	64.2	Low	111 Å²	111	135.9 Å²	135.9	59%	0.594	73%	0.734	S	S	*	*			trans	-86.4	96.8	171.7	-63.8	-28.5	0	0	0	108.4	S109 E113	S109-N111 VanDerWaalsContact C-N 3.29Å; S109-N111 PolarHBondContact O-N 3.32Å; N111-E113 PolarHBondContact O-N 3.15Å
112	R	63.6	Low	64	Low	236 Å²	236	133 Å²	133	89%	0.891	73%	0.729	S	S	*	*			trans	-69.3	56.9	165.1	-75.7	178.5	164	176.9	-4.4	110.2	T110 V114	T110-R112 PolarHBondContact O-N 3.27Å; R112-V114 PolarHBondContact O-N 3Å
113	E	61.2	Low	63.7	Low	178 Å²	178	135 Å²	135	83%	0.832	75%	0.747	S	S	*	*			trans	-78.9	86.3	164	-82.4	179.4	164.7	0	0	107.7	N111 G115	N111-E113 PolarHBondContact O-N 3.15Å; E113-G115 VanDerWaalsContact C-N 3.32Å; E113-G115 PolarHBondContact O-N 3.15Å
114	V	60.8	Low	63.5	Low	136 Å²	136	139.8 Å²	139.8	82%	0.824	77%	0.767	S	S	*	*			trans	-69.8	96	164.2	-178.3	0	0	0	0	106.1	R112 S116	R112-V114 PolarHBondContact O-N 3Å; V114-S116 PolarHBondContact O-N 3.14Å; V114-S116 VanDerWaalsContact O-N 3.1Å
115	G	56.2	Low	63	Low	60 Å²	60	138.6 Å²	138.6	62%	0.619	76%	0.763	S	S	*	*			trans	-55.6	115.6	173.8	0	0	0	0	0	110.4	E113 R117	E113-G115 VanDerWaalsContact C-N 3.32Å; E113-G115 PolarHBondContact O-N 3.15Å; G115-R117 PolarHBondContact O-N 3.42Å
116	S	59.7	Low	62	Low	114 Å²	114	140.7 Å²	140.7	80%	0.797	77%	0.768	S	S	*	*			trans	-60.4	100.6	164.3	161.6	0	0	0	0	108.1	V114 V118	V114-S116 PolarHBondContact O-N 3.14Å; V114-S116 VanDerWaalsContact O-N 3.1Å; S116-V118 PolarHBondContact O-N 3.38Å
117	R	63.3	Low	61.1	Low	240 Å²	240	140.3 Å²	140.3	91%	0.906	78%	0.779	S	S	*	*			trans	-77.1	118.5	166	-67.6	-178.7	177.3	-111.4	-0.1	107.5	G115	G115-R117 PolarHBondContact O-N 3.42Å
118	V	41.9	Very low	60.3	Low	205 Å²	205	141.5 Å²	141.5	100%	1.242	78%	0.775	S	S	*	*			trans	-66.1	0	156.1	-175.8	0	0	0	0	108.2	S116	S116-V118 PolarHBondContact O-N 3.38Å

Retrieved 118 of 118 residues in 23.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).