A0A087WQ65_MOUSE Loading...

Lymphocyte antigen 6 family member E

AlphaFold DB , UniProt , Accession A0A087WQ65, Species MOUSE (Mus musculus, Mouse), Gene Ly6e, Length 113 aa.

						>A0A087WQ65_MOUSE|A0A087WQ65|Ly6e
MAWTVSRLLWLANLQQMSATSNMRVFLPVLLAALLGMEQVHSLMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.6	Very low	48	Very low	209 Å²	209	133.5 Å²	133.5	100%	1.03	66%	0.66	S	S	*	*				0	-28.2	0	-81.9	176	-147.9	0	0	114.4	W3 T4	M1-W3 VanDerWaalsContact C-N 3.33Å; M1-W3 PolarHBondContact O-N 3.44Å; M1-T4 PolarHBondContact O-OG1 3.47Å; M1-T4 VanDerWaalsContact O-OG1 3.1Å
2	A	41.8	Very low	48.4	Very low	76 Å²	76	127 Å²	127	63%	0.628	64%	0.642	S	S	*	*	H	α-helix	trans	-69.6	-23.6	179.4	0	0	0	0	0	115.3	S6	A2-S6 PolarHBondContact O-N 2.92Å
3	W	34.9	Very low	48.6	Very low	229 Å²	229	124.5 Å²	124.5	87%	0.867	63%	0.632	S	S	*	*	H	α-helix	trans	-75.7	-30.6	-175.4	-74.6	75.3	0	0	0	114.2	M1 R7	M1-W3 VanDerWaalsContact C-N 3.33Å; M1-W3 PolarHBondContact O-N 3.44Å; W3-R7 PolarHBondContact O-N 3.45Å
4	T	46.5	Very low	48.6	Very low	86 Å²	86	123.8 Å²	123.8	53%	0.528	63%	0.63	S	S	.	*	H	α-helix	trans	-75.4	-36.5	179.6	43.6	0	0	0	0	111.8	M1 R7 L8	M1-T4 PolarHBondContact O-OG1 3.47Å; M1-T4 VanDerWaalsContact O-OG1 3.1Å; T4-R7 PolarHBondContact O-N 3.44Å; T4-L8 WeakPolarHBondContact O-CD1 3.34Å; T4-L8 PolarHBondContact O-N 3.2Å; T4-L8 VanDerWaalsContact O-N 3.08Å
5	V	53	Low	48.8	Very low	82 Å²	82	125.7 Å²	125.7	50%	0.497	64%	0.635	S	S	.	*	H	α-helix	trans	-66.6	-40.1	177	-175.4	0	0	0	0	111.1	R7 L8 L9	V5-R7 PolarHBondContact O-N 3.14Å; V5-L8 PolarHBondContact O-N 3.26Å; V5-L9 HydrophobicContact CG1-CD1 3.94Å; V5-L9 PolarHBondContact O-N 3.43Å
6	S	50.8	Low	48.6	Very low	79 Å²	79	128.1 Å²	128.1	55%	0.552	64%	0.643	S	S	*	*	H	α-helix	trans	-62.4	-39.9	173.5	-76.2	0	0	0	0	112.6	A2 W10	A2-S6 PolarHBondContact O-N 2.92Å; S6-W10 WeakPolarHBondContact O-CB 3.35Å; S6-W10 PolarHBondContact O-N 3.48Å; S6-W10 VanDerWaalsContact O-N 3.08Å
7	R	51.8	Low	48.4	Very low	197 Å²	197	128.2 Å²	128.2	74%	0.743	64%	0.643	S	S	*	*	H	α-helix	trans	-63.4	-40.3	174.7	-95.8	-175.2	-179.2	-95	0.4	113	W3 T4 V5 W10 L11	W3-R7 PolarHBondContact O-N 3.45Å; T4-R7 PolarHBondContact O-N 3.44Å; V5-R7 PolarHBondContact O-N 3.14Å; R7-W10 PolarHBondContact O-N 2.79Å; R7-L11 WeakPolarHBondContact O-CG 3.29Å; R7-L11 PolarHBondContact O-N 3.29Å
8	L	51	Low	48.5	Very low	117 Å²	117	126.6 Å²	126.6	61%	0.613	65%	0.646	S	S	*	*	H	α-helix	trans	-70.2	-39.3	179.1	-80.3	150.4	0	0	0	112.4	T4 V5 W10 L11 A12	T4-L8 WeakPolarHBondContact O-CD1 3.34Å; T4-L8 PolarHBondContact O-N 3.2Å; T4-L8 VanDerWaalsContact O-N 3.08Å; V5-L8 PolarHBondContact O-N 3.26Å; L8-W10 VanDerWaalsContact C-N 3.29Å; L8-W10 PolarHBondContact O-N 2.95Å; L8-L11 PolarHBondContact O-N 3.46Å; L8-A12 WeakPolarHBondContact O-CB 3.25Å; L8-A12 PolarHBondContact O-N 2.86Å
9	L	52.7	Low	48.8	Very low	104 Å²	104	123.9 Å²	123.9	55%	0.545	65%	0.645	S	S	.	*	H	α-helix	trans	-64.7	-33	173.1	-81.3	156.1	0	0	0	112.6	V5 N13	V5-L9 HydrophobicContact CG1-CD1 3.94Å; V5-L9 PolarHBondContact O-N 3.43Å; L9-N13 PolarHBondContact O-N 3.04Å; L9-N13 VanDerWaalsContact O-N 3.17Å; L9-N13 PolarHBondContact O-ND2 2.99Å; L9-N13 VanDerWaalsContact O-ND2 3.09Å
10	W	49.4	Very low	49.1	Very low	184 Å²	184	124.1 Å²	124.1	70%	0.697	65%	0.652	S	S	*	*	H	α-helix	trans	-68.9	-45	173.8	-129	68	0	0	0	111.9	S6 R7 L8 A12 N13 L14	S6-W10 WeakPolarHBondContact O-CB 3.35Å; S6-W10 PolarHBondContact O-N 3.48Å; S6-W10 VanDerWaalsContact O-N 3.08Å; R7-W10 PolarHBondContact O-N 2.79Å; L8-W10 VanDerWaalsContact C-N 3.29Å; L8-W10 PolarHBondContact O-N 2.95Å; W10-A12 PolarHBondContact O-N 3.43Å; W10-N13 PolarHBondContact O-N 3.36Å; W10-L14 PolarHBondContact O-N 3.33Å; W10-L14 VanDerWaalsContact O-N 3.16Å
11	L	53	Low	49.3	Very low	106 Å²	106	122.6 Å²	122.6	56%	0.555	65%	0.651	S	S	*	*	H	α-helix	trans	-62.7	-41.1	176.4	-73.4	164.3	0	0	0	112.2	R7 L8 L14 Q15	R7-L11 WeakPolarHBondContact O-CG 3.29Å; R7-L11 PolarHBondContact O-N 3.29Å; L8-L11 PolarHBondContact O-N 3.46Å; L11-L14 WeakPolarHBondContact O-CB 3.19Å; L11-L14 PolarHBondContact O-N 3.28Å; L11-Q15 PolarHBondContact O-N 2.99Å
12	A	53.1	Low	50.1	Low	55 Å²	55	118.5 Å²	118.5	46%	0.455	63%	0.634	S	S	.	*	H	α-helix	trans	-66.1	-35.9	177.4	0	0	0	0	0	112.7	L8 W10 L14 Q15	L8-A12 WeakPolarHBondContact O-CB 3.25Å; L8-A12 PolarHBondContact O-N 2.86Å; W10-A12 PolarHBondContact O-N 3.43Å; A12-L14 VanDerWaalsContact C-N 3.32Å; A12-Q15 PolarHBondContact O-N 3.02Å
13	N	50.9	Low	50.9	Low	94 Å²	94	122.9 Å²	122.9	50%	0.503	64%	0.643	S	S	.	*	H	α-helix	trans	-68.3	-30.5	174.1	-95.7	-83.1	0	0	0	112.9	L9 W10 Q15 Q16	L9-N13 PolarHBondContact O-N 3.04Å; L9-N13 VanDerWaalsContact O-N 3.17Å; L9-N13 PolarHBondContact O-ND2 2.99Å; L9-N13 VanDerWaalsContact O-ND2 3.09Å; W10-N13 PolarHBondContact O-N 3.36Å; N13-Q15 VanDerWaalsContact C-N 3.29Å; N13-Q15 PolarHBondContact O-N 3.39Å; N13-Q16 PolarHBondContact O-N 2.87Å
14	L	49.1	Very low	52.2	Low	115 Å²	115	123 Å²	123	60%	0.602	64%	0.644	S	S	*	*	H	α-helix	trans	-67.4	-30.4	178.5	-148.7	75.7	0	0	0	112.3	W10 L11 A12	W10-L14 PolarHBondContact O-N 3.33Å; W10-L14 VanDerWaalsContact O-N 3.16Å; L11-L14 WeakPolarHBondContact O-CB 3.19Å; L11-L14 PolarHBondContact O-N 3.28Å; A12-L14 VanDerWaalsContact C-N 3.32Å
15	Q	50.9	Low	53.2	Low	153 Å²	153	123.1 Å²	123.1	72%	0.715	64%	0.644	S	S	*	*	H	α-helix	trans	-75.9	-29.5	179.1	-66.3	-178.4	-95.9	0	0	112.6	L11 A12 N13 S18	L11-Q15 PolarHBondContact O-N 2.99Å; A12-Q15 PolarHBondContact O-N 3.02Å; N13-Q15 VanDerWaalsContact C-N 3.29Å; N13-Q15 PolarHBondContact O-N 3.39Å; Q15-S18 PolarHBondContact O-OG 3.4Å
16	Q	46.4	Very low	53.9	Low	163 Å²	163	124.1 Å²	124.1	76%	0.762	64%	0.642	S	S	*	*	H	α-helix	trans	-79.3	-21.4	-178.1	-154.1	74	46.7	0	0	113.5	N13 S18	N13-Q16 PolarHBondContact O-N 2.87Å; Q16-S18 VanDerWaalsContact C-N 3.27Å; Q16-S18 PolarHBondContact O-N 2.97Å
17	M	45.4	Very low	55.1	Low	130 Å²	130	126 Å²	126	64%	0.64	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.6	3.4	-178.9	-69.8	173.1	160.4	0	0	114.1	A19	M17-A19 VanDerWaalsContact C-N 3.34Å; M17-A19 PolarHBondContact O-N 3.49Å
18	S	49	Very low	56.2	Low	100 Å²	100	120.1 Å²	120.1	70%	0.699	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.7	-2.6	-176.2	63.2	0	0	0	0	114.8	Q15 Q16	Q15-S18 PolarHBondContact O-OG 3.4Å; Q16-S18 VanDerWaalsContact C-N 3.27Å; Q16-S18 PolarHBondContact O-N 2.97Å
19	A	55.4	Low	57.6	Low	75 Å²	75	118.8 Å²	118.8	62%	0.62	63%	0.629	S	S	*	*	S	Bend	trans	-99.3	118.3	175.9	0	0	0	0	0	110.9	M17	M17-A19 VanDerWaalsContact C-N 3.34Å; M17-A19 PolarHBondContact O-N 3.49Å
20	T	53.6	Low	58.9	Low	128 Å²	128	118.9 Å²	118.9	79%	0.785	63%	0.629	S	S	*	*	S	Bend	trans	95	74.1	-178.8	73	0	0	0	0	115.8	N22	T20-N22 PolarHBondContact O-N 3.49Å
21	S	53.6	Low	60.2	Low	92 Å²	92	114.7 Å²	114.7	64%	0.643	62%	0.62	S	S	*	*			trans	-76.9	101.2	178.1	-177	0	0	0	0	112.5
22	N	60.3	Low	61.5	Low	124 Å²	124	112.7 Å²	112.7	66%	0.663	62%	0.619	S	S	*	*			trans	-89	91.4	151.3	-82.5	-61.5	0	0	0	108	T20 R24 V25 F26	T20-N22 PolarHBondContact O-N 3.49Å; N22-R24 PolarHBondContact O-N 3.24Å; N22-V25 PolarHBondContact O-N 3.16Å; N22-V25 VanDerWaalsContact O-N 3.14Å; N22-F26 WeakPolarHBondContact O-CD2 3.43Å
23	M	58.9	Low	62.7	Low	167 Å²	167	112.2 Å²	112.2	82%	0.823	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.9	-9.3	-171.2	-161.1	177.1	-179.4	0	0	115.8
24	R	62.2	Low	63.9	Low	233 Å²	233	113 Å²	113	88%	0.879	62%	0.619	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.9	-21.1	-178.1	-65.2	-177	166.6	-167.3	-4.8	114.4	N22 P28	N22-R24 PolarHBondContact O-N 3.24Å; R24-P28 WeakPolarHBondContact O-CD 3.48Å
25	V	66.4	Low	65.1	Low	87 Å²	87	114.4 Å²	114.4	53%	0.527	63%	0.626	S	S	.	*	T	Hydrogen-bonded Turn	trans	-101.1	-24.5	-173.1	-171.2	0	0	0	0	112.4	N22 L27 P28 V29	N22-V25 PolarHBondContact O-N 3.16Å; N22-V25 VanDerWaalsContact O-N 3.14Å; V25-L27 PolarHBondContact O-N 3.42Å; V25-P28 VanDerWaalsContact O-CD 3.25Å; V25-P28 WeakPolarHBondContact O-CD 3.44Å; V25-P28 VanDerWaalsContact O-CG 3.29Å; V25-P28 WeakPolarHBondContact O-CG 3.42Å; V25-V29 HydrophobicContact CG1-CG2 4Å; V25-V29 WeakPolarHBondContact O-CB 3.41Å; V25-V29 WeakPolarHBondContact O-CG2 3.27Å; V25-V29 PolarHBondContact O-N 3.17Å
26	F	68.1	Low	66	Low	103 Å²	103	110.1 Å²	110.1	45%	0.452	62%	0.623	S	S	.	*	H	α-helix	trans	-64.7	-39.7	-179.9	-74.9	-85	0	0	0	113.3	N22 V29 L30	N22-F26 WeakPolarHBondContact O-CD2 3.43Å; F26-V29 PolarHBondContact O-N 3.46Å; F26-L30 VanDerWaalsContact O-CB 3.25Å; F26-L30 WeakPolarHBondContact O-CB 3.25Å; F26-L30 PolarHBondContact O-N 3.09Å
27	L	75.4	Confident	66.9	Low	119 Å²	119	107.4 Å²	107.4	62%	0.623	61%	0.611	S	S	*	*	H	α-helix	trans	-63.3	-51.1	-179	-169	72.5	0	0	0	112.6	V25 V29 L30 L31	V25-L27 PolarHBondContact O-N 3.42Å; L27-V29 VanDerWaalsContact C-N 3.34Å; L27-V29 PolarHBondContact O-N 3.08Å; L27-L30 PolarHBondContact O-N 3.27Å; L27-L31 PolarHBondContact O-N 2.97Å
28	P	76.1	Confident	67.5	Low	73 Å²	73	109.7 Å²	109.7	47%	0.474	62%	0.62	S	S	.	*	H	α-helix	trans	-66.7	-33.8	177	23.6	-32.6	0	0	0	112.8	R24 V25 L31 A32	R24-P28 WeakPolarHBondContact O-CD 3.48Å; V25-P28 VanDerWaalsContact O-CD 3.25Å; V25-P28 WeakPolarHBondContact O-CD 3.44Å; V25-P28 VanDerWaalsContact O-CG 3.29Å; V25-P28 WeakPolarHBondContact O-CG 3.42Å; P28-L31 PolarHBondContact O-N 3.4Å; P28-A32 WeakPolarHBondContact O-CB 3.29Å; P28-A32 PolarHBondContact O-N 3.32Å
29	V	80.8	Confident	67.8	Low	90 Å²	90	112.1 Å²	112.1	55%	0.545	62%	0.621	S	S	.	*	H	α-helix	trans	-66	-41.9	175.7	170.8	0	0	0	0	111.5	V25 F26 L27 A32 A33	V25-V29 HydrophobicContact CG1-CG2 4Å; V25-V29 WeakPolarHBondContact O-CB 3.41Å; V25-V29 WeakPolarHBondContact O-CG2 3.27Å; V25-V29 PolarHBondContact O-N 3.17Å; F26-V29 PolarHBondContact O-N 3.46Å; L27-V29 VanDerWaalsContact C-N 3.34Å; L27-V29 PolarHBondContact O-N 3.08Å; V29-A32 PolarHBondContact O-N 3.12Å; V29-A33 WeakPolarHBondContact O-CB 3.47Å; V29-A33 PolarHBondContact O-N 3.2Å
30	L	78.7	Confident	68	Low	105 Å²	105	113.2 Å²	113.2	55%	0.55	62%	0.62	S	S	.	*	H	α-helix	trans	-66.5	-40.8	176.4	-175.3	66.7	0	0	0	111.7	F26 L27 A33 L34	F26-L30 VanDerWaalsContact O-CB 3.25Å; F26-L30 WeakPolarHBondContact O-CB 3.25Å; F26-L30 PolarHBondContact O-N 3.09Å; L27-L30 PolarHBondContact O-N 3.27Å; L30-A33 PolarHBondContact O-N 2.8Å; L30-L34 HydrophobicContact CG-CD1 4.42Å; L30-L34 WeakPolarHBondContact O-CG 3.32Å; L30-L34 PolarHBondContact O-N 3.24Å
31	L	77.5	Confident	68.6	Low	97 Å²	97	114.3 Å²	114.3	51%	0.508	62%	0.616	S	S	.	*	H	α-helix	trans	-62.4	-45.3	175	-118.2	71	0	0	0	111.5	L27 P28 A33 L34 L35	L27-L31 PolarHBondContact O-N 2.97Å; P28-L31 PolarHBondContact O-N 3.4Å; L31-A33 VanDerWaalsContact C-N 3.32Å; L31-A33 PolarHBondContact O-N 2.71Å; L31-L34 PolarHBondContact O-N 3.18Å; L31-L35 WeakPolarHBondContact O-CB 3.39Å; L31-L35 VanDerWaalsContact O-CG 3.27Å; L31-L35 WeakPolarHBondContact O-CG 3.45Å; L31-L35 PolarHBondContact O-N 3.27Å
32	A	80	Confident	69.6	Low	63 Å²	63	112.3 Å²	112.3	52%	0.521	60%	0.601	S	S	.	*	H	α-helix	trans	-62.8	-38.7	177.3	0	0	0	0	0	111.8	P28 V29 L35 G36	P28-A32 WeakPolarHBondContact O-CB 3.29Å; P28-A32 PolarHBondContact O-N 3.32Å; V29-A32 PolarHBondContact O-N 3.12Å; A32-L35 PolarHBondContact O-N 2.78Å; A32-G36 PolarHBondContact O-N 3.02Å
33	A	79	Confident	71	Confident	46 Å²	46	109.4 Å²	109.4	38%	0.38	59%	0.585	S	S	.	*	H	α-helix	trans	-63.7	-43.3	175.3	0	0	0	0	0	112.1	V29 L30 L31 G36 M37	V29-A33 WeakPolarHBondContact O-CB 3.47Å; V29-A33 PolarHBondContact O-N 3.2Å; L30-A33 PolarHBondContact O-N 2.8Å; L31-A33 VanDerWaalsContact C-N 3.32Å; L31-A33 PolarHBondContact O-N 2.71Å; A33-G36 PolarHBondContact O-N 2.89Å; A33-M37 WeakPolarHBondContact O-CE 3.36Å; A33-M37 VanDerWaalsContact O-CG 3.29Å; A33-M37 WeakPolarHBondContact O-CG 3.5Å; A33-M37 PolarHBondContact O-N 2.9Å
34	L	75.1	Confident	72.5	Confident	111 Å²	111	107 Å²	107	58%	0.581	57%	0.574	S	S	*	*	H	α-helix	trans	-68.2	-36.9	178.1	-72.3	167.8	0	0	0	112.8	L30 L31 M37	L30-L34 HydrophobicContact CG-CD1 4.42Å; L30-L34 WeakPolarHBondContact O-CG 3.32Å; L30-L34 PolarHBondContact O-N 3.24Å; L31-L34 PolarHBondContact O-N 3.18Å; L34-M37 WeakPolarHBondContact O-CG 3.5Å
35	L	74.4	Confident	73.9	Confident	143 Å²	143	96.1 Å²	96.1	75%	0.749	53%	0.533	S	S	*	.	H	α-helix	trans	-77.3	-24.2	177.3	-68.1	168.8	0	0	0	112.9	L31 A32 M37	L31-L35 WeakPolarHBondContact O-CB 3.39Å; L31-L35 VanDerWaalsContact O-CG 3.27Å; L31-L35 WeakPolarHBondContact O-CG 3.45Å; L31-L35 PolarHBondContact O-N 3.27Å; A32-L35 PolarHBondContact O-N 2.78Å; L35-M37 VanDerWaalsContact C-N 3.3Å
36	G	70.8	Confident	75.2	Confident	63 Å²	63	95.9 Å²	95.9	65%	0.649	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.1	-1.3	177	0	0	0	0	0	114.3	A32 A33 E38	A32-G36 PolarHBondContact O-N 3.02Å; A33-G36 PolarHBondContact O-N 2.89Å; G36-E38 PolarHBondContact O-N 2.92Å
37	M	65.3	Low	76.2	Confident	106 Å²	106	92.9 Å²	92.9	52%	0.522	52%	0.517	S	S	.	.	S	Bend	trans	-76.4	107	169.6	-45.8	-64	-170.7	0	0	107.7	A33 L34 L35 Q39	A33-M37 WeakPolarHBondContact O-CE 3.36Å; A33-M37 VanDerWaalsContact O-CG 3.29Å; A33-M37 WeakPolarHBondContact O-CG 3.5Å; A33-M37 PolarHBondContact O-N 2.9Å; L34-M37 WeakPolarHBondContact O-CG 3.5Å; L35-M37 VanDerWaalsContact C-N 3.3Å; M37-Q39 PolarHBondContact O-N 3.14Å
38	E	56.4	Low	77	Confident	178 Å²	178	87.8 Å²	87.8	83%	0.832	49%	0.491	S	S	*	.			trans	-60.3	112.7	167.9	-168.5	131.2	67.9	0	0	107.7	G36 V40	G36-E38 PolarHBondContact O-N 2.92Å; E38-V40 VanDerWaalsContact C-N 3.27Å; E38-V40 PolarHBondContact O-N 3.06Å
39	Q	56.3	Low	77.7	Confident	151 Å²	151	88.5 Å²	88.5	71%	0.706	49%	0.494	S	S	*	.			trans	-71.4	91	174.4	-71.6	178.2	42.7	0	0	107.1	M37 H41	M37-Q39 PolarHBondContact O-N 3.14Å; Q39-H41 PolarHBondContact O-N 3.41Å; Q39-H41 PolarHBondContact OE1-CE1 3.49Å
40	V	60	Low	78	Confident	99 Å²	99	89.3 Å²	89.3	60%	0.6	50%	0.496	S	S	*	.			trans	-68.5	79.8	167.2	-169.6	0	0	0	0	106.9	E38 S42 E65	E38-V40 VanDerWaalsContact C-N 3.27Å; E38-V40 PolarHBondContact O-N 3.06Å; V40-S42 PolarHBondContact O-N 3.35Å; V40-E65 HydrophobicContact CG1-CG 4.41Å
41	H	65.8	Low	78.4	Confident	151 Å²	151	87.1 Å²	87.1	70%	0.699	48%	0.483	S	S	*	.			trans	-66	103.9	168.8	-80.9	95.2	0	0	0	106.8	Q39 L43	Q39-H41 PolarHBondContact O-N 3.41Å; Q39-H41 PolarHBondContact OE1-CE1 3.49Å; H41-L43 PolarHBondContact O-N 3.48Å
42	S	75.4	Confident	78.8	Confident	49 Å²	49	90.1 Å²	90.1	34%	0.343	49%	0.492	S	S	.	.			trans	-67.6	119.8	165.9	-178.4	0	0	0	0	107.3	V40 M44 S62 C63	V40-S42 PolarHBondContact O-N 3.35Å; S42-M44 PolarHBondContact O-N 3.31Å; S42-S62 PolarHBondContact OG-OG 3.44Å; S42-C63 PolarHBondContact OG-O 3.41Å
43	L	88.1	Confident	78.9	Confident	63 Å²	63	91.5 Å²	91.5	33%	0.33	49%	0.49	S	S	.	.			trans	-57.2	134.4	172.7	179.6	71	0	0	0	108.7	H41 C63	H41-L43 PolarHBondContact O-N 3.48Å; L43-C63 HydrophobicContact CB-CB 4.06Å; L43-C63 VanDerWaalsContact O-CB 3.23Å; L43-C63 WeakPolarHBondContact O-CB 3.48Å; L43-C63 PolarHBondContact O-N 3.3Å; L43-C63 PolarHBondContact O-SG 2.87Å; L43-C63 VanDerWaalsContact O-SG 3.35Å
44	M	91.3	Very high	79.1	Confident	118 Å²	118	92.9 Å²	92.9	58%	0.581	49%	0.491	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-111	126.2	175.4	-73.2	-79.4	179.1	0	0	108.8	S42 V61 S62	S42-M44 PolarHBondContact O-N 3.31Å; M44-V61 WeakPolarHBondContact CA-O 3.38Å; M44-V61 VanDerWaalsContact SD-C 3.52Å; M44-V61 VanDerWaalsContact SD-O 3.41Å; M44-S62 VanDerWaalsContact CE-OG 3.27Å; M44-S62 WeakPolarHBondContact CE-OG 3.3Å; M44-S62 WeakPolarHBondContact SD-CA 3.31Å; M44-S62 PolarHBondContact SD-N 3.48Å
45	C	92.1	Very high	79.7	Confident	4 Å²	4	92.7 Å²	92.7	3%	0.027	49%	0.489	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	166	178.3	-63.1	0	0	0	0	111	P60 V61 C63 C70	C45-P60 CarbonylContact O-C 3.39Å; C45-P60 WeakPolarHBondContact O-CA 3.47Å; C45-V61 PolarHBondContact N-O 2.03Å; C45-V61 WeakPolarHBondContact O-CG2 3.04Å; C45-V61 PolarHBondContact O-N 2.86Å; C45-C63 PolarHBondContact SG-SG 2.03Å; C45-C70 VanDerWaalsContact CA-SG 3.58Å; C45-C70 HydrophobicContact CB-CB 3.86Å; C45-C70 WeakPolarHBondContact CB-SG 3.09Å; C45-C70 WeakPolarHBondContact SG-CA 3.27Å; C45-C70 WeakPolarHBondContact SG-CB 3.43Å; C45-C70 CovalentContact SG-SG 2.03Å; C45-C70 PolarHBondContact SG-SG 2.88Å
46	F	92.6	Very high	80.3	Confident	82 Å²	82	90 Å²	90	36%	0.36	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.1	141.1	166.9	-75.4	-53.6	0	0	0	109.9	C57 L58 W59 K90 G91	F46-C57 VanDerWaalsContact CB-O 3.29Å; F46-C57 WeakPolarHBondContact CB-O 3.44Å; F46-L58 WeakPolarHBondContact CD1-O 3.45Å; F46-L58 HydrophobicContact CE1-CB 4.38Å; F46-L58 HydrophobicContact CE1-CD2 4.21Å; F46-L58 WeakPolarHBondContact CE1-O 3.46Å; F46-L58 HydrophobicContact CE2-CD2 4.3Å; F46-L58 HydrophobicContact CZ-CD2 4.07Å; F46-W59 CarbonylContact C-O 3.56Å; F46-W59 WeakPolarHBondContact CA-O 3.38Å; F46-K90 HydrophobicContact CB-CD 4.17Å; F46-K90 CarbonylContact O-C 3.44Å; F46-K90 WeakPolarHBondContact O-CB 3.22Å; F46-G91 PolarHBondContact O-N 3.47Å
47	S	89.9	Confident	81.3	Confident	40 Å²	40	87.1 Å²	87.1	28%	0.28	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	140.1	-176.1	-174	0	0	0	0	112.9	W59 V61 K90	S47-W59 PolarHBondContact N-O 3.47Å; S47-V61 VanDerWaalsContact CB-CG1 3.48Å; S47-K90 WeakPolarHBondContact CA-O 3.06Å; S47-K90 PolarHBondContact OG-O 2.99Å
48	C	91.3	Very high	82.5	Confident	12 Å²	12	85.8 Å²	85.8	8%	0.081	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-167	161.5	168.8	62.4	0	0	0	0	111.4	Q51 C57 N89 K90	C48-Q51 HydrophobicContact CB-CB 4.46Å; C48-Q51 HydrophobicContact CB-CG 3.68Å; C48-C57 HydrophobicContact CB-CB 3.59Å; C48-C57 WeakPolarHBondContact CB-SG 3.08Å; C48-C57 WeakPolarHBondContact SG-CB 3.47Å; C48-C57 CovalentContact SG-SG 2.02Å; C48-C57 PolarHBondContact SG-SG 2.9Å; C48-N89 VanDerWaalsContact O-CA 3.27Å; C48-N89 WeakPolarHBondContact O-CA 3.45Å; C48-K90 PolarHBondContact N-O 2.79Å; C48-K90 VanDerWaalsContact N-O 3.1Å; C48-K90 PolarHBondContact O-N 3Å; C48-K90 PolarHBondContact SG-N 3.4Å
49	T	90.5	Very high	84.2	Confident	87 Å²	87	86.6 Å²	86.6	53%	0.534	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.5	133.3	176	-53.5	0	0	0	0	109.3	Q51 N89	T49-Q51 PolarHBondContact O-N 3.08Å; T49-Q51 VanDerWaalsContact O-N 3.16Å; T49-Q51 PolarHBondContact O-NE2 2.99Å; T49-N89 WeakPolarHBondContact CA-OD1 3.2Å
50	D	87.2	Confident	85.9	Confident	108 Å²	108	83.8 Å²	83.8	58%	0.578	43%	0.43	S	S	*	.	E	Extended strand (participates in β ladder)	trans	51.3	37.9	173	-64.8	-52.2	0	0	0	114.4	L88 N89	D50-L88 PolarHBondContact N-O 3.49Å; D50-N89 PolarHBondContact N-OD1 3.02Å
51	Q	88.3	Confident	87.4	Confident	59 Å²	59	81.3 Å²	81.3	28%	0.276	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	144.8	177.5	-62.4	-56	-50	0	0	110.8	C48 T49 N56 T87 L88	C48-Q51 HydrophobicContact CB-CB 4.46Å; C48-Q51 HydrophobicContact CB-CG 3.68Å; T49-Q51 PolarHBondContact O-N 3.08Å; T49-Q51 VanDerWaalsContact O-N 3.16Å; T49-Q51 PolarHBondContact O-NE2 2.99Å; Q51-N56 HydrophobicContact CB-CB 4.25Å; Q51-N56 HydrophobicContact CG-CB 3.99Å; Q51-N56 PolarHBondContact OE1-ND2 2.98Å; Q51-N56 VanDerWaalsContact OE1-ND2 3.08Å; Q51-T87 CarbonylContact O-C 3.54Å; Q51-L88 PolarHBondContact N-O 3.5Å; Q51-L88 WeakPolarHBondContact O-CA 3.38Å; Q51-L88 WeakPolarHBondContact O-CB 3.27Å; Q51-L88 PolarHBondContact O-N 3.1Å
52	K	85.6	Confident	88.7	Confident	160 Å²	160	77.7 Å²	77.7	70%	0.696	41%	0.407	S	S	*	.	S	Bend	trans	-87	-21.7	173.2	-63	-168.5	175.2	176.6	0	112.9
53	N	82.7	Confident	89.4	Confident	91 Å²	91	75.7 Å²	75.7	49%	0.487	39%	0.393	S	S	.	.	S	Bend	trans	-126.3	134.5	-170.2	-155.1	48.5	0	0	0	111	I55 N56	N53-I55 PolarHBondContact O-N 3.49Å; N53-N56 PolarHBondContact O-N 3.3Å
54	N	82.6	Confident	89.5	Confident	75 Å²	75	78.3 Å²	78.3	40%	0.401	40%	0.404	S	S	.	.	G	3₁₀ helix	trans	-61.4	-29.8	-177.5	178.8	72.1	0	0	0	113.5	N56 C57 L88 K90	N54-N56 PolarHBondContact O-N 3.1Å; N54-C57 WeakPolarHBondContact O-CA 3.32Å; N54-C57 VanDerWaalsContact O-CB 3.31Å; N54-C57 WeakPolarHBondContact O-CB 3.21Å; N54-C57 PolarHBondContact O-N 2.81Å; N54-L88 HydrophobicContact CB-CD2 4.17Å; N54-K90 WeakPolarHBondContact OD1-CE 3.29Å
55	I	87.1	Confident	89.4	Confident	107 Å²	107	80 Å²	80	55%	0.549	41%	0.41	S	S	.	.	G	3₁₀ helix	trans	-61.1	-35.3	179.9	-57.1	-58.9	0	0	0	111.4	N53 C57 L58	N53-I55 PolarHBondContact O-N 3.49Å; I55-C57 PolarHBondContact O-N 3.03Å; I55-L58 HydrophobicContact CB-CD1 4.37Å; I55-L58 HydrophobicContact CD1-CD1 3.96Å; I55-L58 HydrophobicContact CG2-CD1 4.11Å; I55-L58 PolarHBondContact O-N 2.8Å
56	N	88.2	Confident	89.1	Confident	88 Å²	88	85.6 Å²	85.6	47%	0.471	43%	0.434	S	S	.	.	G	3₁₀ helix	trans	-72.3	-7.9	177.5	-62	16.2	0	0	0	112.3	Q51 N53 N54	Q51-N56 HydrophobicContact CB-CB 4.25Å; Q51-N56 HydrophobicContact CG-CB 3.99Å; Q51-N56 PolarHBondContact OE1-ND2 2.98Å; Q51-N56 VanDerWaalsContact OE1-ND2 3.08Å; N53-N56 PolarHBondContact O-N 3.3Å; N54-N56 PolarHBondContact O-N 3.1Å
57	C	90.3	Very high	89	Confident	1 Å²	1	82.4 Å²	82.4	1%	0.007	42%	0.421	C	S	.	.	G	3₁₀ helix	trans	-101	5.9	177.6	-60.2	0	0	0	0	113.9	F46 C48 N54 I55 W59 K90	F46-C57 VanDerWaalsContact CB-O 3.29Å; F46-C57 WeakPolarHBondContact CB-O 3.44Å; C48-C57 HydrophobicContact CB-CB 3.59Å; C48-C57 WeakPolarHBondContact CB-SG 3.08Å; C48-C57 WeakPolarHBondContact SG-CB 3.47Å; C48-C57 CovalentContact SG-SG 2.02Å; C48-C57 PolarHBondContact SG-SG 2.9Å; N54-C57 WeakPolarHBondContact O-CA 3.32Å; N54-C57 VanDerWaalsContact O-CB 3.31Å; N54-C57 WeakPolarHBondContact O-CB 3.21Å; N54-C57 PolarHBondContact O-N 2.81Å; I55-C57 PolarHBondContact O-N 3.03Å; C57-W59 PolarHBondContact O-N 2.95Å; C57-K90 HydrophobicContact CB-CD 3.85Å; C57-K90 HydrophobicContact CB-CG 4.3Å
58	L	91.9	Very high	88.8	Confident	78 Å²	78	86.3 Å²	86.3	41%	0.408	43%	0.434	S	S	.	.			trans	-77.7	20.8	179.9	-69	162.9	0	0	0	113.5	F46 I55 P60	F46-L58 WeakPolarHBondContact CD1-O 3.45Å; F46-L58 HydrophobicContact CE1-CB 4.38Å; F46-L58 HydrophobicContact CE1-CD2 4.21Å; F46-L58 WeakPolarHBondContact CE1-O 3.46Å; F46-L58 HydrophobicContact CE2-CD2 4.3Å; F46-L58 HydrophobicContact CZ-CD2 4.07Å; I55-L58 HydrophobicContact CB-CD1 4.37Å; I55-L58 HydrophobicContact CD1-CD1 3.96Å; I55-L58 HydrophobicContact CG2-CD1 4.11Å; I55-L58 PolarHBondContact O-N 2.8Å; L58-P60 VanDerWaalsContact O-CD 3.3Å; L58-P60 WeakPolarHBondContact O-CD 3.07Å
59	W	91.8	Very high	88.6	Confident	196 Å²	196	90.8 Å²	90.8	74%	0.742	45%	0.45	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.4	113.5	178.2	-89.7	65.9	0	0	0	110.5	F46 S47 C57	F46-W59 CarbonylContact C-O 3.56Å; F46-W59 WeakPolarHBondContact CA-O 3.38Å; S47-W59 PolarHBondContact N-O 3.47Å; C57-W59 PolarHBondContact O-N 2.95Å
60	P	91.2	Very high	88.6	Confident	91 Å²	91	87 Å²	87	59%	0.591	43%	0.427	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.8	139.5	-179.9	30.6	-34.1	0	0	0	111	C45 L58	C45-P60 CarbonylContact O-C 3.39Å; C45-P60 WeakPolarHBondContact O-CA 3.47Å; L58-P60 VanDerWaalsContact O-CD 3.3Å; L58-P60 WeakPolarHBondContact O-CD 3.07Å
61	V	92.5	Very high	88.7	Confident	48 Å²	48	83.3 Å²	83.3	29%	0.291	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	144.2	175.4	-60.7	0	0	0	0	111	M44 C45 S47	M44-V61 WeakPolarHBondContact CA-O 3.38Å; M44-V61 VanDerWaalsContact SD-C 3.52Å; M44-V61 VanDerWaalsContact SD-O 3.41Å; C45-V61 PolarHBondContact N-O 2.03Å; C45-V61 WeakPolarHBondContact O-CG2 3.04Å; C45-V61 PolarHBondContact O-N 2.86Å; S47-V61 VanDerWaalsContact CB-CG1 3.48Å
62	S	92.8	Very high	88.6	Confident	74 Å²	74	81.1 Å²	81.1	52%	0.517	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.9	123.3	171.6	-151.1	0	0	0	0	109.1	S42 M44	S42-S62 PolarHBondContact OG-OG 3.44Å; M44-S62 VanDerWaalsContact CE-OG 3.27Å; M44-S62 WeakPolarHBondContact CE-OG 3.3Å; M44-S62 WeakPolarHBondContact SD-CA 3.31Å; M44-S62 PolarHBondContact SD-N 3.48Å
63	C	90.4	Very high	88.5	Confident	7 Å²	7	77.1 Å²	77.1	5%	0.047	38%	0.384	C	S	.	.	P	Polyproline II helix	trans	-82	157.3	178.6	-57.8	0	0	0	0	111.7	S42 L43 C45 D67 C92	S42-C63 PolarHBondContact OG-O 3.41Å; L43-C63 HydrophobicContact CB-CB 4.06Å; L43-C63 VanDerWaalsContact O-CB 3.23Å; L43-C63 WeakPolarHBondContact O-CB 3.48Å; L43-C63 PolarHBondContact O-N 3.3Å; L43-C63 PolarHBondContact O-SG 2.87Å; L43-C63 VanDerWaalsContact O-SG 3.35Å; C45-C63 PolarHBondContact SG-SG 2.03Å; C63-D67 HydrophobicContact CB-CB 4Å; C63-C92 WeakPolarHBondContact CA-SG 3.29Å; C63-C92 HydrophobicContact CB-CB 3.6Å; C63-C92 WeakPolarHBondContact CB-SG 3.17Å; C63-C92 WeakPolarHBondContact SG-CB 3.46Å; C63-C92 CovalentContact SG-SG 2.03Å; C63-C92 PolarHBondContact SG-SG 3Å
64	Q	90	Very high	88.4	Confident	118 Å²	118	73.3 Å²	73.3	55%	0.551	36%	0.364	S	S	*	.	P	Polyproline II helix	trans	-69.3	158.1	172.9	-69.4	170.2	76.4	0	0	110.2	K66 D67	Q64-K66 HydrophobicContact CB-CG 4Å; Q64-K66 PolarHBondContact O-N 3.3Å; Q64-K66 VanDerWaalsContact O-N 3.14Å; Q64-K66 VanDerWaalsContact OE1-CE 3.25Å; Q64-D67 WeakPolarHBondContact CB-OD2 3.05Å; Q64-D67 PolarHBondContact N-OD2 2.8Å; Q64-D67 WeakPolarHBondContact O-CB 3.23Å; Q64-D67 PolarHBondContact O-N 3.35Å
65	E	87.7	Confident	88.2	Confident	155 Å²	155	71.7 Å²	71.7	72%	0.724	36%	0.361	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.1	-29.2	-178.7	-164.6	177.3	175	0	0	113.4	V40 D67 H68	V40-E65 HydrophobicContact CG1-CG 4.41Å; E65-D67 VanDerWaalsContact C-N 3.32Å; E65-H68 PolarHBondContact O-CE1 2.72Å
66	K	87.2	Confident	87.7	Confident	120 Å²	120	68.1 Å²	68.1	52%	0.522	35%	0.348	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.6	-15.1	175.2	64.3	176.5	-178.4	-177.1	0	114.4	Q64 H68 P94	Q64-K66 HydrophobicContact CB-CG 4Å; Q64-K66 PolarHBondContact O-N 3.3Å; Q64-K66 VanDerWaalsContact O-N 3.14Å; Q64-K66 VanDerWaalsContact OE1-CE 3.25Å; K66-H68 PolarHBondContact O-CD2 3.43Å; K66-P94 WeakPolarHBondContact O-CA 3.42Å; K66-P94 VanDerWaalsContact O-CB 3.31Å; K66-P94 WeakPolarHBondContact O-CB 3.47Å
67	D	89.3	Confident	86.9	Confident	15 Å²	15	66.3 Å²	66.3	8%	0.08	35%	0.345	C	S	.	.			trans	-95.3	110.2	-175.3	-61.8	-31.1	0	0	0	108.7	C63 Q64 E65 C92 P94	C63-D67 HydrophobicContact CB-CB 4Å; Q64-D67 WeakPolarHBondContact CB-OD2 3.05Å; Q64-D67 PolarHBondContact N-OD2 2.8Å; Q64-D67 WeakPolarHBondContact O-CB 3.23Å; Q64-D67 PolarHBondContact O-N 3.35Å; E65-D67 VanDerWaalsContact C-N 3.32Å; D67-C92 HydrophobicContact CB-CB 3.8Å; D67-P94 VanDerWaalsContact OD1-CD 3.3Å; D67-P94 WeakPolarHBondContact OD1-CD 3.27Å
68	H	86.5	Confident	85.6	Confident	122 Å²	122	68.8 Å²	68.8	57%	0.565	37%	0.371	S	S	*	.			trans	-108.6	1.4	-173.6	-57.6	-63.4	0	0	0	113.5	E65 K66 S93	E65-H68 PolarHBondContact O-CE1 2.72Å; K66-H68 PolarHBondContact O-CD2 3.43Å; H68-S93 PolarHBondContact N-O 2.83Å
69	Y	87.4	Confident	84	Confident	107 Å²	107	73.4 Å²	73.4	42%	0.42	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	136.6	-175.2	-54.7	-79.4	0	0	0	112.2	C92 S93 C96	Y69-C92 CarbonylContact O-C 3.58Å; Y69-C92 WeakPolarHBondContact O-CA 3.34Å; Y69-S93 PolarHBondContact N-O 2.84Å; Y69-S93 VanDerWaalsContact N-O 3.12Å; Y69-S93 PolarHBondContact O-N 2.94Å; Y69-C96 HydrophobicContact CD1-CB 3.8Å; Y69-C96 HydrophobicContact CD2-CB 4.08Å; Y69-C96 HydrophobicContact CE1-CB 4.03Å; Y69-C96 HydrophobicContact CE2-CB 4.31Å; Y69-C96 HydrophobicContact CG-CB 3.82Å
70	C	90.3	Very high	83	Confident	8 Å²	8	68 Å²	68	5%	0.054	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	124	163.2	-56.7	0	0	0	0	108.7	C45 S112 Y113	C45-C70 VanDerWaalsContact CA-SG 3.58Å; C45-C70 HydrophobicContact CB-CB 3.86Å; C45-C70 WeakPolarHBondContact CB-SG 3.09Å; C45-C70 WeakPolarHBondContact SG-CA 3.27Å; C45-C70 WeakPolarHBondContact SG-CB 3.43Å; C45-C70 CovalentContact SG-SG 2.03Å; C45-C70 PolarHBondContact SG-SG 2.88Å; C70-S112 WeakPolarHBondContact O-CA 3.41Å; C70-Y113 HydrophobicContact CB-CD2 4.39Å; C70-Y113 HydrophobicContact CB-CE1 4.08Å; C70-Y113 HydrophobicContact CB-CE2 3.93Å
71	I	88.8	Confident	81.8	Confident	30 Å²	30	71.2 Å²	71.2	15%	0.154	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	146.3	178.4	61.2	166.1	0	0	0	111.2	L73 K90 G91 N111	I71-L73 HydrophobicContact CD1-CD1 3.84Å; I71-L73 HydrophobicContact CG1-CD1 4.46Å; I71-K90 WeakPolarHBondContact O-CA 3.42Å; I71-G91 PolarHBondContact N-O 3.41Å; I71-G91 PolarHBondContact O-N 2.77Å; I71-N111 CarbonylContact C-O 3.51Å; I71-N111 WeakPolarHBondContact CA-O 3.43Å
72	T	86.1	Confident	80.4	Confident	13 Å²	13	73.1 Å²	73.1	8%	0.08	42%	0.417	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	121.6	172.4	-58.9	0	0	0	0	108.1	L88 N89 K90 V110 N111	T72-L88 HydrophobicContact CG2-CD1 3.4Å; T72-L88 HydrophobicContact CG2-CG 4.47Å; T72-N89 CarbonylContact C-O 3.58Å; T72-N89 WeakPolarHBondContact CA-O 3.16Å; T72-K90 HydrophobicContact CG2-CG 4Å; T72-K90 PolarHBondContact OG1-NZ 2.77Å; T72-V110 CarbonylContact O-C 3.5Å; T72-V110 WeakPolarHBondContact O-CA 3.31Å; T72-N111 PolarHBondContact N-O 3.08Å; T72-N111 PolarHBondContact O-N 3.16Å
73	L	83.4	Confident	79.3	Confident	76 Å²	76	76.8 Å²	76.8	40%	0.398	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	130.4	168.9	-95.5	72.4	0	0	0	108.3	I71 L88 N89 S109 V110	I71-L73 HydrophobicContact CD1-CD1 3.84Å; I71-L73 HydrophobicContact CG1-CD1 4.46Å; L73-L88 CarbonylContact O-C 3.26Å; L73-L88 WeakPolarHBondContact O-CA 3.33Å; L73-N89 HydrophobicContact CB-CB 4.12Å; L73-N89 PolarHBondContact N-O 3.33Å; L73-N89 PolarHBondContact O-N 2.62Å; L73-N89 VanDerWaalsContact O-O 3.1Å; L73-S109 CarbonylContact C-O 3.3Å; L73-S109 WeakPolarHBondContact CA-O 3.41Å; L73-V110 HydrophobicContact CD1-CG1 3.69Å; L73-V110 HydrophobicContact CG-CG1 3.81Å
74	S	80.5	Confident	78.3	Confident	11 Å²	11	82.3 Å²	82.3	8%	0.077	46%	0.459	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	127.4	170.5	52.9	0	0	0	0	110.1	Y86 T87 A108 S109	S74-Y86 VanDerWaalsContact CB-OH 3.22Å; S74-Y86 WeakPolarHBondContact CB-OH 3.33Å; S74-T87 CarbonylContact C-O 3.53Å; S74-T87 WeakPolarHBondContact CA-O 3.16Å; S74-A108 CarbonylContact O-C 3.46Å; S74-A108 VanDerWaalsContact O-C 3.26Å; S74-A108 WeakPolarHBondContact O-CA 2.95Å; S74-S109 PolarHBondContact N-O 3.29Å; S74-S109 PolarHBondContact O-N 2.91Å; S74-S109 PolarHBondContact OG-O 2.79Å; S74-S109 PolarHBondContact OG-OG 3.26Å
75	A	78.4	Confident	77.5	Confident	41 Å²	41	78.2 Å²	78.2	34%	0.339	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	126.5	178.5	0	0	0	0	0	109.8	Y86 T87 V107	A75-Y86 CarbonylContact O-C 3.5Å; A75-Y86 VanDerWaalsContact O-CA 3.29Å; A75-Y86 WeakPolarHBondContact O-CA 3.33Å; A75-T87 PolarHBondContact N-O 2.71Å; A75-T87 PolarHBondContact O-N 2.8Å; A75-V107 CarbonylContact C-O 3.58Å; A75-V107 WeakPolarHBondContact CA-O 3.44Å
76	A	77.2	Confident	77.3	Confident	32 Å²	32	75.5 Å²	75.5	26%	0.264	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	129.4	171.2	0	0	0	0	0	110.3	G85 Y86 G106 V107	A76-G85 WeakPolarHBondContact CA-O 3.45Å; A76-Y86 HydrophobicContact CB-CD2 4.05Å; A76-G106 CarbonylContact O-C 3.43Å; A76-V107 HydrophobicContact CB-CB 4.08Å; A76-V107 PolarHBondContact N-O 3.26Å; A76-V107 PolarHBondContact O-N 3.18Å
77	A	70.6	Confident	77.1	Confident	49 Å²	49	72 Å²	72	41%	0.405	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	127.6	172.8	0	0	0	0	0	109	L84 G85	A77-L84 HydrophobicContact CB-CB 3.94Å; A77-L84 WeakPolarHBondContact O-CA 3.35Å; A77-L84 WeakPolarHBondContact O-CB 3.48Å; A77-L84 PolarHBondContact O-N 2.82Å; A77-G85 PolarHBondContact N-O 2.95Å; A77-G85 PolarHBondContact O-N 2.75Å
78	G	63.3	Low	77.1	Confident	54 Å²	54	71.7 Å²	71.7	56%	0.557	42%	0.42	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-158.2	150.3	178.3	0	0	0	0	0	111.7	V82	G78-V82 CarbonylContact C-O 3.5Å; G78-V82 WeakPolarHBondContact CA-O 3.32Å
79	F	58.7	Low	77.1	Confident	174 Å²	174	68.3 Å²	68.3	76%	0.763	41%	0.406	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-138.5	117	175.5	-167.4	-90	0	0	0	109.3	N81 V82 L84	F79-N81 PolarHBondContact O-N 2.83Å; F79-V82 HydrophobicContact CB-CG2 4.18Å; F79-V82 PolarHBondContact N-O 2.8Å; F79-V82 WeakPolarHBondContact O-CG2 3.2Å; F79-V82 PolarHBondContact O-N 3.47Å; F79-V82 VanDerWaalsContact O-N 3.1Å; F79-L84 HydrophobicContact CB-CD1 4.49Å
80	G	70	Confident	77.3	Confident	83 Å²	83	64.7 Å²	64.7	86%	0.856	39%	0.392	S	S	*	.	T	Hydrogen-bonded Turn	trans	57.9	-127.6	-172.5	0	0	0	0	0	112.1	V82	G80-V82 VanDerWaalsContact C-N 3.35Å
81	N	65.7	Low	77.4	Confident	159 Å²	159	65 Å²	65	85%	0.85	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.5	3.9	177.9	-166.6	22.8	0	0	0	113.7	F79	F79-N81 PolarHBondContact O-N 2.83Å
82	V	63.6	Low	77.5	Confident	88 Å²	88	65.3 Å²	65.3	53%	0.533	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	121.8	177.6	-63.6	0	0	0	0	110.9	G78 F79 G80 L84	G78-V82 CarbonylContact C-O 3.5Å; G78-V82 WeakPolarHBondContact CA-O 3.32Å; F79-V82 HydrophobicContact CB-CG2 4.18Å; F79-V82 PolarHBondContact N-O 2.8Å; F79-V82 WeakPolarHBondContact O-CG2 3.2Å; F79-V82 PolarHBondContact O-N 3.47Å; F79-V82 VanDerWaalsContact O-N 3.1Å; G80-V82 VanDerWaalsContact C-N 3.35Å; V82-L84 HydrophobicContact CB-CD1 4.5Å; V82-L84 HydrophobicContact CG2-CD1 3.84Å
83	N	70.3	Confident	77.7	Confident	150 Å²	150	65.6 Å²	65.6	80%	0.802	40%	0.404	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.4	108.9	171.2	-65.3	-76.8	0	0	0	108.3
84	L	69.4	Low	77.9	Confident	123 Å²	123	65.1 Å²	65.1	64%	0.644	41%	0.405	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-82.3	-15.4	179.8	-75.7	86.7	0	0	0	112.7	A77 F79 V82	A77-L84 HydrophobicContact CB-CB 3.94Å; A77-L84 WeakPolarHBondContact O-CA 3.35Å; A77-L84 WeakPolarHBondContact O-CB 3.48Å; A77-L84 PolarHBondContact O-N 2.82Å; F79-L84 HydrophobicContact CB-CD1 4.49Å; V82-L84 HydrophobicContact CB-CD1 4.5Å; V82-L84 HydrophobicContact CG2-CD1 3.84Å
85	G	73.6	Confident	78.1	Confident	33 Å²	33	70.4 Å²	70.4	34%	0.34	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	148.7	169.5	172.3	0	0	0	0	0	113.3	A76 A77	A76-G85 WeakPolarHBondContact CA-O 3.45Å; A77-G85 PolarHBondContact N-O 2.95Å; A77-G85 PolarHBondContact O-N 2.75Å
86	Y	82.4	Confident	78.3	Confident	97 Å²	97	70.1 Å²	70.1	38%	0.38	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	135.3	176.2	175	-95.2	0	0	0	108.6	S74 A75 A76 L88	S74-Y86 VanDerWaalsContact CB-OH 3.22Å; S74-Y86 WeakPolarHBondContact CB-OH 3.33Å; A75-Y86 CarbonylContact O-C 3.5Å; A75-Y86 VanDerWaalsContact O-CA 3.29Å; A75-Y86 WeakPolarHBondContact O-CA 3.33Å; A76-Y86 HydrophobicContact CB-CD2 4.05Å; Y86-L88 HydrophobicContact CE1-CB 4.1Å
87	T	84.6	Confident	78	Confident	47 Å²	47	71.1 Å²	71.1	29%	0.288	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	150.2	173.7	57.1	0	0	0	0	110.6	Q51 S74 A75	Q51-T87 CarbonylContact O-C 3.54Å; S74-T87 CarbonylContact C-O 3.53Å; S74-T87 WeakPolarHBondContact CA-O 3.16Å; A75-T87 PolarHBondContact N-O 2.71Å; A75-T87 PolarHBondContact O-N 2.8Å
88	L	87.6	Confident	77.6	Confident	8 Å²	8	74.8 Å²	74.8	4%	0.042	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133	127.5	-176.7	-175.1	70.4	0	0	0	109.2	D50 Q51 N54 T72 L73 Y86	D50-L88 PolarHBondContact N-O 3.49Å; Q51-L88 PolarHBondContact N-O 3.5Å; Q51-L88 WeakPolarHBondContact O-CA 3.38Å; Q51-L88 WeakPolarHBondContact O-CB 3.27Å; Q51-L88 PolarHBondContact O-N 3.1Å; N54-L88 HydrophobicContact CB-CD2 4.17Å; T72-L88 HydrophobicContact CG2-CD1 3.4Å; T72-L88 HydrophobicContact CG2-CG 4.47Å; L73-L88 CarbonylContact O-C 3.26Å; L73-L88 WeakPolarHBondContact O-CA 3.33Å; Y86-L88 HydrophobicContact CE1-CB 4.1Å
89	N	88.4	Confident	77.3	Confident	52 Å²	52	79 Å²	79	28%	0.278	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	142.8	169.5	-84.3	40	0	0	0	109.5	C48 T49 D50 T72 L73	C48-N89 VanDerWaalsContact O-CA 3.27Å; C48-N89 WeakPolarHBondContact O-CA 3.45Å; T49-N89 WeakPolarHBondContact CA-OD1 3.2Å; D50-N89 PolarHBondContact N-OD1 3.02Å; T72-N89 CarbonylContact C-O 3.58Å; T72-N89 WeakPolarHBondContact CA-O 3.16Å; L73-N89 HydrophobicContact CB-CB 4.12Å; L73-N89 PolarHBondContact N-O 3.33Å; L73-N89 PolarHBondContact O-N 2.62Å; L73-N89 VanDerWaalsContact O-O 3.1Å
90	K	91.3	Very high	77.1	Confident	31 Å²	31	76.9 Å²	76.9	14%	0.135	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	149.1	169.5	-64.8	-172	179.4	-81	0	109.4	F46 S47 C48 N54 C57 I71 T72	F46-K90 HydrophobicContact CB-CD 4.17Å; F46-K90 CarbonylContact O-C 3.44Å; F46-K90 WeakPolarHBondContact O-CB 3.22Å; S47-K90 WeakPolarHBondContact CA-O 3.06Å; S47-K90 PolarHBondContact OG-O 2.99Å; C48-K90 PolarHBondContact N-O 2.79Å; C48-K90 VanDerWaalsContact N-O 3.1Å; C48-K90 PolarHBondContact O-N 3Å; C48-K90 PolarHBondContact SG-N 3.4Å; N54-K90 WeakPolarHBondContact OD1-CE 3.29Å; C57-K90 HydrophobicContact CB-CD 3.85Å; C57-K90 HydrophobicContact CB-CG 4.3Å; I71-K90 WeakPolarHBondContact O-CA 3.42Å; T72-K90 HydrophobicContact CG2-CG 4Å; T72-K90 PolarHBondContact OG1-NZ 2.77Å
91	G	91.4	Very high	76.3	Confident	14 Å²	14	75.9 Å²	75.9	14%	0.144	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	176.1	-171.1	175.8	0	0	0	0	0	113.7	F46 I71	F46-G91 PolarHBondContact O-N 3.47Å; I71-G91 PolarHBondContact N-O 3.41Å; I71-G91 PolarHBondContact O-N 2.77Å
92	C	92.2	Very high	75.7	Confident	37 Å²	37	73.4 Å²	73.4	25%	0.25	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	147.3	179.3	-44.7	0	0	0	0	110.8	C63 D67 Y69	C63-C92 WeakPolarHBondContact CA-SG 3.29Å; C63-C92 HydrophobicContact CB-CB 3.6Å; C63-C92 WeakPolarHBondContact CB-SG 3.17Å; C63-C92 WeakPolarHBondContact SG-CB 3.46Å; C63-C92 CovalentContact SG-SG 2.03Å; C63-C92 PolarHBondContact SG-SG 3Å; D67-C92 HydrophobicContact CB-CB 3.8Å; Y69-C92 CarbonylContact O-C 3.58Å; Y69-C92 WeakPolarHBondContact O-CA 3.34Å
93	S	89.3	Confident	75	Confident	19 Å²	19	74 Å²	74	13%	0.133	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.2	145.5	174.2	-179.5	0	0	0	0	111.6	H68 Y69 I95	H68-S93 PolarHBondContact N-O 2.83Å; Y69-S93 PolarHBondContact N-O 2.84Å; Y69-S93 VanDerWaalsContact N-O 3.12Å; Y69-S93 PolarHBondContact O-N 2.94Å; S93-I95 VanDerWaalsContact C-N 3.26Å; S93-I95 WeakPolarHBondContact CB-O 3.01Å; S93-I95 PolarHBondContact OG-N 3.03Å; S93-I95 PolarHBondContact OG-O 3.47Å
94	P	88.3	Confident	73.8	Confident	66 Å²	66	73.9 Å²	73.9	43%	0.429	42%	0.418	S	S	.	.	S	Bend	trans	-75.1	-18.4	171.5	31.4	-34.7	0	0	0	112.5	K66 D67	K66-P94 WeakPolarHBondContact O-CA 3.42Å; K66-P94 VanDerWaalsContact O-CB 3.31Å; K66-P94 WeakPolarHBondContact O-CB 3.47Å; D67-P94 VanDerWaalsContact OD1-CD 3.3Å; D67-P94 WeakPolarHBondContact OD1-CD 3.27Å
95	I	85.1	Confident	72.5	Confident	122 Å²	122	76.6 Å²	76.6	63%	0.626	43%	0.432	S	S	*	.	S	Bend	trans	-128.2	130.9	-174.7	-58.6	167.9	0	0	0	109	S93	S93-I95 VanDerWaalsContact C-N 3.26Å; S93-I95 WeakPolarHBondContact CB-O 3.01Å; S93-I95 PolarHBondContact OG-N 3.03Å; S93-I95 PolarHBondContact OG-O 3.47Å
96	C	81.3	Confident	71.3	Confident	34 Å²	34	76.9 Å²	76.9	23%	0.23	44%	0.435	C	S	.	.			trans	-88.9	117.9	167	-170.2	0	0	0	0	109	Y69 S98 S112	Y69-C96 HydrophobicContact CD1-CB 3.8Å; Y69-C96 HydrophobicContact CD2-CB 4.08Å; Y69-C96 HydrophobicContact CE1-CB 4.03Å; Y69-C96 HydrophobicContact CE2-CB 4.31Å; Y69-C96 HydrophobicContact CG-CB 3.82Å; C96-S98 PolarHBondContact O-N 2.73Å; C96-S112 VanDerWaalsContact SG-CB 3.53Å; C96-S112 PolarHBondContact SG-OG 3.01Å
97	P	71.8	Confident	69.8	Low	53 Å²	53	74.6 Å²	74.6	34%	0.344	43%	0.431	S	S	.	.			trans	-60.3	125.5	171	23.9	-30.2	0	0	0	109	E99 V110	P97-E99 PolarHBondContact O-N 2.02Å; P97-V110 HydrophobicContact CB-CG2 4Å; P97-V110 HydrophobicContact CG-CB 3.81Å; P97-V110 HydrophobicContact CG-CG1 4.26Å; P97-V110 HydrophobicContact CG-CG2 3.54Å
98	S	61.1	Low	68.3	Low	127 Å²	127	73.9 Å²	73.9	89%	0.888	43%	0.43	S	S	*	.	S	Bend	trans	-73.2	-10.7	-170.5	-49.8	0	0	0	0	114.2	C96	C96-S98 PolarHBondContact O-N 2.73Å
99	E	58.3	Low	67	Low	141 Å²	141	75.5 Å²	75.5	66%	0.659	44%	0.442	S	S	*	.	S	Bend	trans	-130	134.5	178.8	-57.2	-157.6	-168.9	0	0	109.8	P97 V101 V110	P97-E99 PolarHBondContact O-N 2.02Å; E99-V101 HydrophobicContact CB-CG1 4.26Å; E99-V101 PolarHBondContact O-N 3.04Å; E99-V110 WeakPolarHBondContact O-CG2 2.94Å
100	N	53.4	Low	65.7	Low	131 Å²	131	74.1 Å²	74.1	70%	0.701	44%	0.435	S	S	*	.			trans	-65.3	75.7	164.5	46	-8	0	0	0	108.6	N102	N100-N102 VanDerWaalsContact C-N 3.33Å; N100-N102 PolarHBondContact O-N 2.85Å
101	V	53.9	Low	64.2	Low	62 Å²	62	77.3 Å²	77.3	38%	0.376	45%	0.454	S	S	.	.			trans	-66	86	-176.9	-79.1	0	0	0	0	110.8	E99 L103 V110	E99-V101 HydrophobicContact CB-CG1 4.26Å; E99-V101 PolarHBondContact O-N 3.04Å; V101-L103 VanDerWaalsContact C-N 3.26Å; V101-L103 HydrophobicContact CB-CD1 4.35Å; V101-L103 PolarHBondContact O-N 2.77Å; V101-V110 HydrophobicContact CG2-CG1 4.49Å; V101-V110 HydrophobicContact CG2-CG2 3.73Å
102	N	52.4	Low	62.7	Low	106 Å²	106	79.4 Å²	79.4	57%	0.567	47%	0.466	S	S	*	.			trans	-75	84.3	166.3	-166.2	-43.8	0	0	0	108.5	N100 N104 V107	N100-N102 VanDerWaalsContact C-N 3.33Å; N100-N102 PolarHBondContact O-N 2.85Å; N102-N104 PolarHBondContact O-N 3.1Å; N102-V107 VanDerWaalsContact OD1-CG1 3.27Å; N102-V107 WeakPolarHBondContact OD1-CG1 3.4Å
103	L	49.5	Very low	61.2	Low	102 Å²	102	85 Å²	85	53%	0.534	48%	0.483	S	S	.	.			trans	-69.4	99.7	177.2	-85.7	143.7	0	0	0	109.3	V101 L105 G106 V107	V101-L103 VanDerWaalsContact C-N 3.26Å; V101-L103 HydrophobicContact CB-CD1 4.35Å; V101-L103 PolarHBondContact O-N 2.77Å; L103-L105 PolarHBondContact O-N 3.22Å; L103-G106 CarbonylContact O-C 3.55Å; L103-G106 VanDerWaalsContact O-C 3.3Å; L103-G106 PolarHBondContact O-N 3.3Å; L103-G106 VanDerWaalsContact O-O 3.14Å; L103-V107 WeakPolarHBondContact O-CA 3.3Å
104	N	43.9	Very low	59.8	Low	147 Å²	147	88.3 Å²	88.3	79%	0.786	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.4	28.2	-175.8	-163.2	35.4	0	0	0	115.2	N102	N102-N104 PolarHBondContact O-N 3.1Å
105	L	43.2	Very low	58.3	Low	179 Å²	179	89.5 Å²	89.5	94%	0.937	50%	0.504	S	S	*	.	T	Hydrogen-bonded Turn	trans	-132.4	15.9	178.9	-83.2	140.7	0	0	0	112.4	L103	L103-L105 PolarHBondContact O-N 3.22Å
106	G	48.2	Very low	56.8	Low	39 Å²	39	87.7 Å²	87.7	40%	0.402	50%	0.498	S	S	.	.	S	Bend	trans	136	92.4	-167.1	0	0	0	0	0	106.6	A76 L103 A108	A76-G106 CarbonylContact O-C 3.43Å; L103-G106 CarbonylContact O-C 3.55Å; L103-G106 VanDerWaalsContact O-C 3.3Å; L103-G106 PolarHBondContact O-N 3.3Å; L103-G106 VanDerWaalsContact O-O 3.14Å; G106-A108 PolarHBondContact O-N 3.17Å
107	V	51.4	Low	55.3	Low	49 Å²	49	90.8 Å²	90.8	30%	0.297	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.5	92.9	-157	-174	0	0	0	0	110.7	A75 A76 N102 L103	A75-V107 CarbonylContact C-O 3.58Å; A75-V107 WeakPolarHBondContact CA-O 3.44Å; A76-V107 HydrophobicContact CB-CB 4.08Å; A76-V107 PolarHBondContact N-O 3.26Å; A76-V107 PolarHBondContact O-N 3.18Å; N102-V107 VanDerWaalsContact OD1-CG1 3.27Å; N102-V107 WeakPolarHBondContact OD1-CG1 3.4Å; L103-V107 WeakPolarHBondContact O-CA 3.3Å
108	A	52.8	Low	54.3	Low	33 Å²	33	93.2 Å²	93.2	27%	0.273	52%	0.524	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.3	90.7	175.1	0	0	0	0	0	111	S74 G106	S74-A108 CarbonylContact O-C 3.46Å; S74-A108 VanDerWaalsContact O-C 3.26Å; S74-A108 WeakPolarHBondContact O-CA 2.95Å; G106-A108 PolarHBondContact O-N 3.17Å
109	S	60.8	Low	53.8	Low	42 Å²	42	90.9 Å²	90.9	29%	0.294	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.4	137	178.3	86.9	0	0	0	0	112.6	L73 S74	L73-S109 CarbonylContact C-O 3.3Å; L73-S109 WeakPolarHBondContact CA-O 3.41Å; S74-S109 PolarHBondContact N-O 3.29Å; S74-S109 PolarHBondContact O-N 2.91Å; S74-S109 PolarHBondContact OG-O 2.79Å; S74-S109 PolarHBondContact OG-OG 3.26Å
110	V	60.3	Low	53.5	Low	22 Å²	22	87.4 Å²	87.4	13%	0.133	49%	0.488	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	125.6	176.5	-65.3	0	0	0	0	110.1	T72 L73 P97 E99 V101	T72-V110 CarbonylContact O-C 3.5Å; T72-V110 WeakPolarHBondContact O-CA 3.31Å; L73-V110 HydrophobicContact CD1-CG1 3.69Å; L73-V110 HydrophobicContact CG-CG1 3.81Å; P97-V110 HydrophobicContact CB-CG2 4Å; P97-V110 HydrophobicContact CG-CB 3.81Å; P97-V110 HydrophobicContact CG-CG1 4.26Å; P97-V110 HydrophobicContact CG-CG2 3.54Å; E99-V110 WeakPolarHBondContact O-CG2 2.94Å; V101-V110 HydrophobicContact CG2-CG1 4.49Å; V101-V110 HydrophobicContact CG2-CG2 3.73Å
111	N	60.7	Low	53.5	Low	99 Å²	99	84 Å²	84	53%	0.529	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	131.9	177.4	-149.9	90.3	0	0	0	110.5	I71 T72	I71-N111 CarbonylContact C-O 3.51Å; I71-N111 WeakPolarHBondContact CA-O 3.43Å; T72-N111 PolarHBondContact N-O 3.08Å; T72-N111 PolarHBondContact O-N 3.16Å
112	S	59.9	Low	53.5	Low	58 Å²	58	85.8 Å²	85.8	41%	0.406	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	151.8	170.3	57	0	0	0	0	110.7	C70 C96	C70-S112 WeakPolarHBondContact O-CA 3.41Å; C96-S112 VanDerWaalsContact SG-CB 3.53Å; C96-S112 PolarHBondContact SG-OG 3.01Å
113	Y	58.9	Low	53.6	Low	154 Å²	154	84 Å²	84	60%	0.604	47%	0.472	S	S	*	.			trans	-147.5	0	169.9	62.5	-93.4	0	0	0	110.6	C70	C70-Y113 HydrophobicContact CB-CD2 4.39Å; C70-Y113 HydrophobicContact CB-CE1 4.08Å; C70-Y113 HydrophobicContact CB-CE2 3.93Å

Retrieved 113 of 113 residues in 18.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).