A0A087WQ77_MOUSE Loading...

NADH:ubiquinone oxidoreductase core subunit S1

AlphaFold DB , UniProt , Accession A0A087WQ77, Species MOUSE (Mus musculus, Mouse), Gene Ndufs1, Length 62 aa.

						>A0A087WQ77_MOUSE|A0A087WQ77|Ndufs1
DQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMTGLLV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	D	56.2	Low	54	Low	142 Å²	142	131.7 Å²	131.7	76%	0.759	65%	0.647	S	S	*	*				0	4.3	0	-60.9	-69.1	0	0	0	116.5	R4	D1-R4 VanDerWaalsContact OD1-CZ 3.25Å; D1-R4 IonicContact OD1-CZ 3.25Å; D1-R4 PolarHBondContact OD1-NH2 3.23Å; D1-R4 IonicContact OD1-NH2 2.86Å; D1-R4 IonicContact OD1-NH1 3.75Å; D1-R4 PolarHBondContact OD1-NH1 2.86Å
2	Q	59.3	Low	53.8	Low	175 Å²	175	127.8 Å²	127.8	82%	0.818	64%	0.639	S	S	*	*	H	α-helix	trans	-81.9	-22.8	-179.5	-75.6	174.2	-19.1	0	0	114.9
3	V	56.1	Low	53.3	Low	124 Å²	124	127.1 Å²	127.1	75%	0.752	64%	0.639	S	S	*	*	H	α-helix	trans	-76.9	-29.3	-176.3	-178.2	0	0	0	0	112	L7	V3-L7 PolarHBondContact O-N 2.8Å
4	R	54.1	Low	53.1	Low	169 Å²	169	126.2 Å²	126.2	64%	0.638	64%	0.636	S	S	*	*	H	α-helix	trans	-67.7	-39.2	178.9	-87.1	-171.7	-110.3	104.3	3.4	112.5	D1 R6 L7 E8	D1-R4 VanDerWaalsContact OD1-CZ 3.25Å; D1-R4 IonicContact OD1-CZ 3.25Å; D1-R4 PolarHBondContact OD1-NH2 3.23Å; D1-R4 IonicContact OD1-NH2 2.86Å; D1-R4 IonicContact OD1-NH1 3.75Å; D1-R4 PolarHBondContact OD1-NH1 2.86Å; R4-R6 PolarHBondContact O-N 3.14Å; R4-L7 PolarHBondContact O-N 3.46Å; R4-E8 PolarHBondContact O-N 3.22Å
5	N	56	Low	52.5	Low	101 Å²	101	123.9 Å²	123.9	54%	0.54	63%	0.63	S	S	.	*	H	α-helix	trans	-68	-34.3	-179.3	-65.2	7	0	0	0	112.7	L7 E8 E9	N5-L7 VanDerWaalsContact C-N 3.32Å; N5-L7 PolarHBondContact O-N 3.44Å; N5-E8 PolarHBondContact O-N 3.28Å; N5-E9 PolarHBondContact O-N 3.4Å
6	R	55.4	Low	52.2	Low	194 Å²	194	126.1 Å²	126.1	73%	0.732	63%	0.629	S	S	*	*	H	α-helix	trans	-71.4	-26.9	175.6	-93.3	-168.1	160	-162.9	-4.9	113.5	R4 E8 V10	R4-R6 PolarHBondContact O-N 3.14Å; R6-E8 VanDerWaalsContact C-N 3.35Å; R6-V10 PolarHBondContact O-N 3.5Å; R6-V10 WeakPolarHBondContact O-CG2 3.39Å
7	L	52.8	Low	52.1	Low	101 Å²	101	131.5 Å²	131.5	53%	0.529	64%	0.642	S	S	.	*	H	α-helix	trans	-74.7	-32	176.6	-156.9	67.2	0	0	0	110.9	V3 R4 N5 S11 L14	V3-L7 PolarHBondContact O-N 2.8Å; R4-L7 PolarHBondContact O-N 3.46Å; N5-L7 VanDerWaalsContact C-N 3.32Å; N5-L7 PolarHBondContact O-N 3.44Å; L7-S11 PolarHBondContact O-N 3.4Å; L7-L14 HydrophobicContact CD2-CD2 3.86Å; L7-L14 HydrophobicContact CG-CD2 4.43Å
8	E	51	Low	51.8	Low	107 Å²	107	132.9 Å²	132.9	50%	0.5	65%	0.653	S	S	.	*	H	α-helix	trans	-68.4	-37.6	174.7	-163	173.8	-163.4	0	0	112.6	R4 N5 R6 V15	R4-E8 PolarHBondContact O-N 3.22Å; N5-E8 PolarHBondContact O-N 3.28Å; R6-E8 VanDerWaalsContact C-N 3.35Å; E8-V15 HydrophobicContact CG-CG2 4.34Å
9	E	54.4	Low	51.5	Low	163 Å²	163	131 Å²	131	76%	0.762	65%	0.646	S	S	*	*	H	α-helix	trans	-71	-28.7	177.4	-73.9	179.8	169	0	0	114	N5	N5-E9 PolarHBondContact O-N 3.4Å
10	V	56.1	Low	51.5	Low	126 Å²	126	132.6 Å²	132.6	76%	0.764	66%	0.655	S	S	*	*	H	α-helix	trans	-89.9	-31.2	-176.2	175.6	0	0	0	0	112	R6	R6-V10 PolarHBondContact O-N 3.5Å; R6-V10 WeakPolarHBondContact O-CG2 3.39Å
11	S	43.2	Very low	51.6	Low	47 Å²	47	132 Å²	132	33%	0.329	65%	0.651	S	S	.	*			trans	-160	99.3	174.5	-175.5	0	0	0	0	110.1	L7 N13	L7-S11 PolarHBondContact O-N 3.4Å; S11-N13 PolarHBondContact O-N 3.25Å; S11-N13 PolarHBondContact OG-OD1 3.07Å
12	P	51.5	Low	51.3	Low	84 Å²	84	133.7 Å²	133.7	55%	0.545	65%	0.654	S	S	.	*	G	3₁₀ helix	trans	-67.3	-8.1	179.9	26.3	-33.4	0	0	0	113.5	L14	P12-L14 PolarHBondContact O-N 2.99Å
13	N	46.7	Very low	50.9	Low	119 Å²	119	130.5 Å²	130.5	64%	0.636	65%	0.647	S	S	*	*	G	3₁₀ helix	trans	-68.9	-14.3	-177.4	-36.1	49.6	0	0	0	113.1	S11	S11-N13 PolarHBondContact O-N 3.25Å; S11-N13 PolarHBondContact OG-OD1 3.07Å
14	L	50.6	Low	50.8	Low	115 Å²	115	131.3 Å²	131.3	60%	0.602	65%	0.647	S	S	*	*	G	3₁₀ helix	trans	-90.6	-2.8	-175.8	-134.8	79.4	0	0	0	114	L7 P12	L7-L14 HydrophobicContact CD2-CD2 3.86Å; L7-L14 HydrophobicContact CG-CD2 4.43Å; P12-L14 PolarHBondContact O-N 2.99Å
15	V	44.8	Very low	50.8	Low	91 Å²	91	130.8 Å²	130.8	55%	0.552	65%	0.646	S	S	*	*	S	Bend	trans	-111.1	-4.3	-175.2	-145.7	0	0	0	0	112.8	E8	E8-V15 HydrophobicContact CG-CG2 4.34Å
16	R	47.7	Very low	50.8	Low	159 Å²	159	133.8 Å²	133.8	60%	0.6	65%	0.654	S	S	*	*			trans	-105.5	93.4	176.8	-69.7	-174.2	170.9	-170.6	-3.6	110	D18 D19 E21	R16-D18 PolarHBondContact O-N 3.48Å; R16-D18 VanDerWaalsContact O-N 3.14Å; R16-D19 IonicContact NH1-OD2 3.46Å; R16-D19 HydrophobicContact CB-CB 4.48Å; R16-E21 IonicContact NH1-OE1 2.8Å; R16-E21 PolarHBondContact NH1-OE1 3.03Å
17	Y	49.9	Very low	50.9	Low	219 Å²	219	131.6 Å²	131.6	86%	0.859	65%	0.653	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.1	15.5	-178.5	-89.4	-80.6	0	0	0	115.2
18	D	47.5	Very low	51.2	Low	157 Å²	157	132.5 Å²	132.5	84%	0.84	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-154.9	7.4	-177.6	-129.3	-3.4	0	0	0	115.8	R16	R16-D18 PolarHBondContact O-N 3.48Å; R16-D18 VanDerWaalsContact O-N 3.14Å
19	D	45.4	Very low	51.5	Low	96 Å²	96	130.2 Å²	130.2	51%	0.513	65%	0.653	S	S	.	*			trans	-108.5	105.2	179	-72.8	-32.2	0	0	0	110.1	R16 E21	R16-D19 IonicContact NH1-OD2 3.46Å; R16-D19 HydrophobicContact CB-CB 4.48Å; D19-E21 VanDerWaalsContact C-N 3.27Å; D19-E21 PolarHBondContact O-N 3.21Å
20	I	50.7	Low	51.8	Low	163 Å²	163	124.1 Å²	124.1	84%	0.836	63%	0.629	S	S	*	*			trans	-72.3	89.9	164.9	-58.7	168.6	0	0	0	106.3	E22	I20-E22 PolarHBondContact O-N 2.84Å
21	E	53.3	Low	52.1	Low	120 Å²	120	124 Å²	124	56%	0.561	62%	0.62	S	S	*	*			trans	-65.4	106.2	171.8	-66.6	-72.9	162.8	0	0	108.4	R16 D19 T23	R16-E21 IonicContact NH1-OE1 2.8Å; R16-E21 PolarHBondContact NH1-OE1 3.03Å; D19-E21 VanDerWaalsContact C-N 3.27Å; D19-E21 PolarHBondContact O-N 3.21Å; E21-T23 VanDerWaalsContact C-N 3.35Å; E21-T23 PolarHBondContact O-N 2.89Å
22	E	50.9	Low	52.8	Low	177 Å²	177	127.4 Å²	127.4	83%	0.827	63%	0.634	S	S	*	*			trans	-60.5	96.9	169.4	-91.8	-174.4	165.9	0	0	109.1	I20 N24	I20-E22 PolarHBondContact O-N 2.84Å; E22-N24 VanDerWaalsContact C-N 3.25Å; E22-N24 PolarHBondContact O-N 2.87Å
23	T	51.7	Low	53.2	Low	109 Å²	109	126.7 Å²	126.7	67%	0.669	64%	0.635	S	S	*	*			trans	-74.7	82.6	172.6	42.2	0	0	0	0	109.2	E21 Y25	E21-T23 VanDerWaalsContact C-N 3.35Å; E21-T23 PolarHBondContact O-N 2.89Å; T23-Y25 PolarHBondContact O-N 2.82Å
24	N	53.5	Low	53.8	Low	141 Å²	141	128.4 Å²	128.4	75%	0.754	64%	0.637	S	S	*	*			trans	-68.7	18.4	175.9	-149.5	0.9	0	0	0	113.5	E22 F26	E22-N24 VanDerWaalsContact C-N 3.25Å; E22-N24 PolarHBondContact O-N 2.87Å; N24-F26 PolarHBondContact O-N 2.86Å; N24-F26 VanDerWaalsContact C-N 3.26Å
25	Y	54.1	Low	54	Low	158 Å²	158	129.4 Å²	129.4	62%	0.62	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.6	16.2	177.2	-59.7	-67	0	0	0	113.1	T23 Q27 Q28 A29	T23-Y25 PolarHBondContact O-N 2.82Å; Y25-Q27 PolarHBondContact O-N 3.4Å; Y25-Q28 PolarHBondContact O-N 3.33Å; Y25-A29 WeakPolarHBondContact O-CB 3.5Å; Y25-A29 PolarHBondContact O-N 3.06Å
26	F	55.3	Low	54.3	Low	163 Å²	163	129.6 Å²	129.6	72%	0.715	64%	0.643	S	S	*	*	H	α-helix	trans	-56.5	-36.3	176.8	-169.9	-98.4	0	0	0	112.1	N24 S30	N24-F26 PolarHBondContact O-N 2.86Å; N24-F26 VanDerWaalsContact C-N 3.26Å; F26-S30 WeakPolarHBondContact O-CB 3.46Å; F26-S30 PolarHBondContact O-N 3.43Å
27	Q	57.3	Low	54.7	Low	148 Å²	148	129.6 Å²	129.6	69%	0.692	66%	0.655	S	S	*	*	H	α-helix	trans	-68.6	-48.1	-179.9	-69.7	-176.4	-3.5	0	0	112.5	Y25 S30 E31	Y25-Q27 PolarHBondContact O-N 3.4Å; Q27-S30 PolarHBondContact O-N 3.05Å; Q27-E31 WeakPolarHBondContact O-CB 3.24Å; Q27-E31 WeakPolarHBondContact O-CG 3.39Å; Q27-E31 PolarHBondContact O-N 3.49Å
28	Q	59.4	Low	54.8	Low	120 Å²	120	126.7 Å²	126.7	56%	0.561	65%	0.649	S	S	*	*	H	α-helix	trans	-68.5	-40	180	-68.9	170.1	4.2	0	0	111.9	Y25 E31 L32	Y25-Q28 PolarHBondContact O-N 3.33Å; Q28-E31 PolarHBondContact O-N 3.35Å; Q28-L32 PolarHBondContact O-N 3.24Å; Q28-L32 WeakPolarHBondContact O-CG 3.24Å
29	A	58.4	Low	55.3	Low	59 Å²	59	127.2 Å²	127.2	49%	0.488	65%	0.647	S	S	.	*	H	α-helix	trans	-66.6	-38.5	174.8	0	0	0	0	0	111.8	Y25 A33	Y25-A29 WeakPolarHBondContact O-CB 3.5Å; Y25-A29 PolarHBondContact O-N 3.06Å; A29-A33 PolarHBondContact O-N 2.98Å; A29-A33 WeakPolarHBondContact O-CB 3.47Å
30	S	60.1	Low	55.7	Low	35 Å²	35	129 Å²	129	25%	0.245	66%	0.661	C	S	.	*	H	α-helix	trans	-65.2	-40.7	174.8	-172.3	0	0	0	0	112	F26 Q27 A33 K34	F26-S30 WeakPolarHBondContact O-CB 3.46Å; F26-S30 PolarHBondContact O-N 3.43Å; Q27-S30 PolarHBondContact O-N 3.05Å; S30-A33 PolarHBondContact O-N 2.86Å; S30-K34 WeakPolarHBondContact O-CB 3.37Å; S30-K34 VanDerWaalsContact O-CG 3.24Å; S30-K34 WeakPolarHBondContact O-CG 3.07Å; S30-K34 PolarHBondContact O-N 3.01Å
31	E	61.5	Low	56	Low	125 Å²	125	127.5 Å²	127.5	58%	0.584	65%	0.654	S	S	*	*	H	α-helix	trans	-65.9	-44	177.4	-76.7	176.8	178.3	0	0	111.9	Q27 Q28 K34 L35	Q27-E31 WeakPolarHBondContact O-CB 3.24Å; Q27-E31 WeakPolarHBondContact O-CG 3.39Å; Q27-E31 PolarHBondContact O-N 3.49Å; Q28-E31 PolarHBondContact O-N 3.35Å; E31-K34 PolarHBondContact O-N 2.93Å; E31-L35 PolarHBondContact O-N 3.35Å
32	L	59.6	Low	56.2	Low	118 Å²	118	126.7 Å²	126.7	62%	0.618	67%	0.668	S	S	*	*	H	α-helix	trans	-68.4	-36.5	175.2	-70.6	172.4	0	0	0	112.6	Q28 K34 L35 V36	Q28-L32 PolarHBondContact O-N 3.24Å; Q28-L32 WeakPolarHBondContact O-CG 3.24Å; L32-K34 VanDerWaalsContact C-N 3.31Å; L32-K34 PolarHBondContact O-N 2.9Å; L32-L35 HydrophobicContact CD2-CD1 4.27Å; L32-L35 PolarHBondContact O-N 2.94Å; L32-L35 WeakPolarHBondContact O-CB 3.14Å; L32-V36 PolarHBondContact O-N 3.47Å
33	A	58.3	Low	56.4	Low	68 Å²	68	124 Å²	124	56%	0.562	66%	0.659	S	S	*	*	H	α-helix	trans	-68.4	-29	176	0	0	0	0	0	112.8	A29 S30	A29-A33 PolarHBondContact O-N 2.98Å; A29-A33 WeakPolarHBondContact O-CB 3.47Å; S30-A33 PolarHBondContact O-N 2.86Å
34	K	59.2	Low	56.6	Low	156 Å²	156	124 Å²	124	68%	0.678	66%	0.661	S	S	*	*	H	α-helix	trans	-76.2	-23.3	173.2	-74.4	170.5	-174.6	173.6	0	113.5	S30 E31 L32 V36	S30-K34 WeakPolarHBondContact O-CB 3.37Å; S30-K34 VanDerWaalsContact O-CG 3.24Å; S30-K34 WeakPolarHBondContact O-CG 3.07Å; S30-K34 PolarHBondContact O-N 3.01Å; E31-K34 PolarHBondContact O-N 2.93Å; L32-K34 VanDerWaalsContact C-N 3.31Å; L32-K34 PolarHBondContact O-N 2.9Å; K34-V36 VanDerWaalsContact C-N 3.34Å
35	L	56.2	Low	56.7	Low	135 Å²	135	125.5 Å²	125.5	71%	0.707	67%	0.668	S	S	*	*	H	α-helix	trans	-73.1	-28.7	175.8	-90.7	149.8	0	0	0	112.1	E31 L32 N37	E31-L35 PolarHBondContact O-N 3.35Å; L32-L35 HydrophobicContact CD2-CD1 4.27Å; L32-L35 PolarHBondContact O-N 2.94Å; L32-L35 WeakPolarHBondContact O-CB 3.14Å; L35-N37 PolarHBondContact O-N 3.27Å
36	V	50.3	Low	56.7	Low	95 Å²	95	122.4 Å²	122.4	58%	0.576	67%	0.665	S	S	*	*	S	Bend	trans	-88.9	96.3	173.1	-177.9	0	0	0	0	108.4	L32 K34 Q38	L32-V36 PolarHBondContact O-N 3.47Å; K34-V36 VanDerWaalsContact C-N 3.34Å; V36-Q38 PolarHBondContact O-N 3.39Å
37	N	55.2	Low	56.7	Low	159 Å²	159	118.3 Å²	118.3	85%	0.85	66%	0.655	S	S	*	*			trans	-68.8	77.6	168.1	-93.4	-34.1	0	0	0	109.5	L35 E39	L35-N37 PolarHBondContact O-N 3.27Å; N37-E39 PolarHBondContact O-N 3.41Å
38	Q	53.4	Low	56.8	Low	158 Å²	158	117.3 Å²	117.3	74%	0.738	66%	0.662	S	S	*	*			trans	-73.6	117.3	163.9	-170.2	71.5	31.3	0	0	107	V36 V40	V36-Q38 PolarHBondContact O-N 3.39Å; Q38-V40 PolarHBondContact O-N 3.01Å; Q38-V40 VanDerWaalsContact O-N 3.12Å
39	E	58.1	Low	56.5	Low	168 Å²	168	117.1 Å²	117.1	79%	0.785	66%	0.661	S	S	*	*			trans	-56.6	119.6	174.6	-71.8	-174.1	159.1	0	0	109.5	N37 L41	N37-E39 PolarHBondContact O-N 3.41Å; E39-L41 PolarHBondContact O-N 3.01Å
40	V	53.8	Low	56.4	Low	135 Å²	135	120.4 Å²	120.4	82%	0.818	67%	0.669	S	S	*	*			trans	-70.5	100.9	170.3	179.9	0	0	0	0	106.2	Q38 A42	Q38-V40 PolarHBondContact O-N 3.01Å; Q38-V40 VanDerWaalsContact O-N 3.12Å; V40-A42 PolarHBondContact O-N 2.75Å
41	L	57.5	Low	56.1	Low	130 Å²	130	122.7 Å²	122.7	68%	0.681	68%	0.682	S	S	*	*			trans	-56.6	127.5	169.2	-69.9	169.3	0	0	0	108	E39 D43	E39-L41 PolarHBondContact O-N 3.01Å; L41-D43 PolarHBondContact O-N 3.48Å
42	A	56	Low	55.7	Low	104 Å²	104	123.5 Å²	123.5	86%	0.86	69%	0.689	S	S	*	*			trans	-71.8	27.5	-178.6	0	0	0	0	0	113.2	V40	V40-A42 PolarHBondContact O-N 2.75Å
43	D	56.6	Low	55.5	Low	121 Å²	121	126.4 Å²	126.4	65%	0.647	70%	0.696	S	S	*	*	S	Bend	trans	-83.3	134.6	175	-71.1	-31.2	0	0	0	108.6	L41 L45	L41-D43 PolarHBondContact O-N 3.48Å; D43-L45 PolarHBondContact O-N 3.25Å; D43-L45 VanDerWaalsContact O-N 3.11Å
44	P	54.1	Low	55.3	Low	108 Å²	108	126.8 Å²	126.8	70%	0.701	69%	0.689	S	S	*	*			trans	-59.5	121.9	-179.3	23.1	-30.9	0	0	0	109.3	V46	P44-V46 HydrophobicContact CB-CG2 4.23Å; P44-V46 HydrophobicContact CG-CG2 4.47Å; P44-V46 PolarHBondContact O-N 3.47Å
45	L	55.5	Low	55	Low	172 Å²	172	126.3 Å²	126.3	90%	0.901	69%	0.687	S	S	*	*			trans	-66.5	75.2	172.4	-78	157.3	0	0	0	109.5	D43 P47	D43-L45 PolarHBondContact O-N 3.25Å; D43-L45 VanDerWaalsContact O-N 3.11Å; L45-P47 WeakPolarHBondContact O-CD 3.44Å
46	V	55.2	Low	55	Low	94 Å²	94	127.3 Å²	127.3	57%	0.57	68%	0.682	S	S	*	*			trans	-78.6	118.8	172.6	-177.9	0	0	0	0	107.1	P44 L50	P44-V46 HydrophobicContact CB-CG2 4.23Å; P44-V46 HydrophobicContact CG-CG2 4.47Å; P44-V46 PolarHBondContact O-N 3.47Å; V46-L50 HydrophobicContact CG1-CD1 3.68Å
47	P	55.6	Low	55.6	Low	77 Å²	77	131.2 Å²	131.2	50%	0.5	70%	0.697	S	S	.	*			trans	-58.5	132	175.8	21.7	-29.8	0	0	0	109.2	L45 Q49 L50	L45-P47 WeakPolarHBondContact O-CD 3.44Å; P47-Q49 PolarHBondContact O-N 3.11Å; P47-L50 HydrophobicContact CG-CD2 4.34Å; P47-L50 HydrophobicContact CG-CG 4.29Å
48	P	58.3	Low	55.7	Low	127 Å²	127	128.7 Å²	128.7	83%	0.825	69%	0.687	S	S	*	*	S	Bend	trans	-69.2	-2.6	-169	25.1	-33.7	0	0	0	114.8
49	Q	53.7	Low	55.5	Low	116 Å²	116	123.7 Å²	123.7	54%	0.542	68%	0.678	S	S	.	*			trans	-137.7	93.9	-179	-64.3	-179.5	3.3	0	0	110.2	P47	P47-Q49 PolarHBondContact O-N 3.11Å
50	L	56.5	Low	55.4	Low	128 Å²	128	124.6 Å²	124.6	67%	0.67	69%	0.687	S	S	*	*			trans	-101.5	-9.2	177	-82.3	154.7	0	0	0	112.6	V46 P47	V46-L50 HydrophobicContact CG1-CD1 3.68Å; P47-L50 HydrophobicContact CG-CD2 4.34Å; P47-L50 HydrophobicContact CG-CG 4.29Å
51	T	53.1	Low	55.4	Low	82 Å²	82	126.3 Å²	126.3	50%	0.503	69%	0.691	S	S	.	*	S	Bend	trans	-135.4	142.5	-175.2	72.5	0	0	0	0	113.2	K53 D54	T51-K53 PolarHBondContact O-N 3.4Å; T51-D54 PolarHBondContact O-N 3.12Å; T51-D54 PolarHBondContact OG1-OD2 3.02Å
52	I	54.5	Low	54.9	Low	142 Å²	142	128.2 Å²	128.2	73%	0.728	71%	0.707	S	S	*	*	G	3₁₀ helix	trans	-57.9	-19.5	177.1	-67.8	163.1	0	0	0	112.3	D54 F55 Y56	I52-D54 VanDerWaalsContact C-N 3.32Å; I52-D54 PolarHBondContact O-N 3.42Å; I52-F55 VanDerWaalsContact O-CB 3.24Å; I52-F55 WeakPolarHBondContact O-CB 3.45Å; I52-F55 PolarHBondContact O-N 2.82Å; I52-Y56 HydrophobicContact CG2-CE2 4.48Å
53	K	55.3	Low	54.9	Low	180 Å²	180	129.5 Å²	129.5	78%	0.783	70%	0.7	S	S	*	*	G	3₁₀ helix	trans	-67.3	-30.9	176	-92.8	-178.2	171.6	-179.9	0	113.1	T51 F55	T51-K53 PolarHBondContact O-N 3.4Å; K53-F55 PolarHBondContact O-N 2.86Å
54	D	53.2	Low	54.8	Low	76 Å²	76	129.9 Å²	129.9	41%	0.406	70%	0.703	S	S	.	*	G	3₁₀ helix	trans	-80.3	-7.5	179.7	-55.6	-44.3	0	0	0	112.3	T51 I52 Y56	T51-D54 PolarHBondContact O-N 3.12Å; T51-D54 PolarHBondContact OG1-OD2 3.02Å; I52-D54 VanDerWaalsContact C-N 3.32Å; I52-D54 PolarHBondContact O-N 3.42Å; D54-Y56 VanDerWaalsContact C-N 3.33Å
55	F	54	Low	54.8	Low	145 Å²	145	131.1 Å²	131.1	64%	0.636	70%	0.703	S	S	*	*	G	3₁₀ helix	trans	-72.3	-24.7	178.1	-161.5	-98.2	0	0	0	112.9	I52 K53	I52-F55 VanDerWaalsContact O-CB 3.24Å; I52-F55 WeakPolarHBondContact O-CB 3.45Å; I52-F55 PolarHBondContact O-N 2.82Å; K53-F55 PolarHBondContact O-N 2.86Å
56	Y	55.9	Low	54.8	Low	156 Å²	156	128.7 Å²	128.7	61%	0.612	69%	0.691	S	S	*	*	G	3₁₀ helix	trans	-94.1	3.6	-173.1	-71.6	-77.6	0	0	0	114.8	I52 D54 V62	I52-Y56 HydrophobicContact CG2-CE2 4.48Å; D54-Y56 VanDerWaalsContact C-N 3.33Å; Y56-V62 WeakPolarHBondContact O-CG2 3.46Å
57	M	61.4	Low	54.8	Low	177 Å²	177	130.9 Å²	130.9	87%	0.872	70%	0.699	S	S	*	*	S	Bend	trans	-138.2	56.3	-176.1	-84.2	-177.9	151	0	0	112.1
58	T	57.3	Low	54.7	Low	107 Å²	107	134.5 Å²	134.5	66%	0.656	71%	0.712	S	S	*	*	S	Bend	trans	-125.5	14.1	177.4	52.1	0	0	0	0	114.4
59	G	49.1	Very low	54.5	Low	52 Å²	52	135 Å²	135	54%	0.536	70%	0.704	S	S	.	*	S	Bend	trans	-162	148.3	171.6	0	0	0	0	0	112.5	L61	G59-L61 PolarHBondContact O-N 3.28Å
60	L	57.4	Low	54.5	Low	187 Å²	187	136.5 Å²	136.5	98%	0.979	72%	0.716	S	S	*	*	S	Bend	trans	-65.3	21.7	-179.1	-162.1	96.5	0	0	0	114.4
61	L	54	Low	54.4	Low	172 Å²	172	137.2 Å²	137.2	90%	0.901	72%	0.72	S	S	*	*			trans	-147.4	73.8	176.8	-96.6	161.3	0	0	0	108.1	G59	G59-L61 PolarHBondContact O-N 3.28Å
62	V	47	Very low	54.5	Low	170 Å²	170	142.2 Å²	142.2	100%	1.03	74%	0.74	S	S	*	*			trans	-108.1	0	148.9	177.5	0	0	0	0	107.2	Y56	Y56-V62 WeakPolarHBondContact O-CG2 3.46Å

Retrieved 62 of 62 residues in 21.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).