A0A087WQ90_MOUSE Loading...

Transformed mouse 3T3 cell double minute 4

AlphaFold DB , UniProt , Accession A0A087WQ90, Species MOUSE (Mus musculus, Mouse), Gene Mdm4, Length 141 aa.

						>A0A087WQ90_MOUSE|A0A087WQ90|Mdm4
MTSHSTSAQCSASDSACRISSEQISQQVRPKLQLLKILHAAGAQGEVFTMKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGDLLGCQSFSVKDPSPLYDMLRKNLVTSASINTGSHYGFSKSRPTEARCNRILQSQKKN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.6	Very low	43.5	Very low	226 Å²	226	134.8 Å²	134.8	100%	1.113	81%	0.813	S	S	*	*				0	93.1	0	-72.7	168	74.5	0	0	106.1
2	T	44.4	Very low	43.5	Very low	113 Å²	113	131.7 Å²	131.7	69%	0.693	81%	0.812	S	S	*	*				47.9	114.9	100.1	59	0	0	0	0	110.3
3	S	35.4	Very low	43.6	Very low	111 Å²	111	129.6 Å²	129.6	78%	0.776	81%	0.806	S	S	*	*				-154.2	141.9	81.6	-66.4	0	0	0	0	114.3
4	H	46.9	Very low	43.8	Very low	167 Å²	167	128.9 Å²	128.9	77%	0.773	79%	0.794	S	S	*	*			trans	-80.9	132.6	165	-48.6	-87.1	0	0	0	108.1
5	S	44.1	Very low	44.2	Very low	124 Å²	124	127.2 Å²	127.2	87%	0.867	79%	0.79	S	S	*	*			trans	-105.9	92.5	168	-70.4	0	0	0	0	108.5	S7	S5-S7 PolarHBondContact O-N 2.82Å
6	T	47.4	Very low	44.2	Very low	132 Å²	132	123.6 Å²	123.6	81%	0.81	78%	0.776	S	S	*	*			trans	-70.7	114.3	168.1	-61.7	0	0	0	0	108.2	A8	T6-A8 PolarHBondContact O-N 3.17Å
7	S	47.1	Very low	44.5	Very low	107 Å²	107	122.9 Å²	122.9	75%	0.748	78%	0.775	S	S	*	*			trans	-68.5	114.6	167.7	45.2	0	0	0	0	108.9	S5 Q9	S5-S7 PolarHBondContact O-N 2.82Å; S7-Q9 PolarHBondContact O-N 3.49Å; S7-Q9 VanDerWaalsContact O-N 3.15Å
8	A	46	Very low	44.5	Very low	87 Å²	87	128 Å²	128	72%	0.719	78%	0.777	S	S	*	*			trans	-64	112.1	170.1	0	0	0	0	0	108.9	T6 C10	T6-A8 PolarHBondContact O-N 3.17Å; A8-C10 PolarHBondContact O-N 3.04Å; A8-C10 VanDerWaalsContact O-N 3.14Å
9	Q	46.3	Very low	44.6	Very low	187 Å²	187	126.6 Å²	126.6	87%	0.874	76%	0.763	S	S	*	*			trans	-73	98.8	162.7	-72.7	-174.8	-25.2	0	0	107.4	S7 S11	S7-Q9 PolarHBondContact O-N 3.49Å; S7-Q9 VanDerWaalsContact O-N 3.15Å; Q9-S11 PolarHBondContact O-N 3.1Å
10	C	41.1	Very low	44.9	Very low	118 Å²	118	123.2 Å²	123.2	80%	0.797	75%	0.746	S	S	*	*			trans	-62.6	119.3	169.2	-65.8	0	0	0	0	108.2	A8 A12	A8-C10 PolarHBondContact O-N 3.04Å; A8-C10 VanDerWaalsContact O-N 3.14Å; C10-A12 PolarHBondContact O-N 3Å
11	S	42.5	Very low	45.2	Very low	111 Å²	111	122 Å²	122	78%	0.776	74%	0.743	S	S	*	*			trans	-52.5	112.9	171.2	-69.2	0	0	0	0	109.3	Q9 S13	Q9-S11 PolarHBondContact O-N 3.1Å; S11-S13 VanDerWaalsContact C-N 3.3Å; S11-S13 PolarHBondContact O-N 3.44Å
12	A	42.9	Very low	45.8	Very low	97 Å²	97	118.1 Å²	118.1	80%	0.802	72%	0.722	S	S	*	*			trans	-68.5	94.7	164.8	0	0	0	0	0	107.3	C10 D14	C10-A12 PolarHBondContact O-N 3Å; A12-D14 PolarHBondContact O-N 3.31Å
13	S	45.6	Very low	46.3	Very low	105 Å²	105	117.4 Å²	117.4	73%	0.734	71%	0.711	S	S	*	*			trans	-68.9	77.7	164.5	-58	0	0	0	0	108.6	S11 S15	S11-S13 VanDerWaalsContact C-N 3.3Å; S11-S13 PolarHBondContact O-N 3.44Å; S13-S15 PolarHBondContact O-N 3.33Å
14	D	46.4	Very low	47.3	Very low	119 Å²	119	116.4 Å²	116.4	64%	0.636	70%	0.696	S	S	*	*			trans	-73.3	70.6	165.3	-165.2	-115	0	0	0	108.4	A12	A12-D14 PolarHBondContact O-N 3.31Å
15	S	49	Very low	48.1	Very low	104 Å²	104	112.7 Å²	112.7	73%	0.727	69%	0.689	S	S	*	*			trans	-108.9	28.1	166.4	60.1	0	0	0	0	110.7	S13 C17	S13-S15 PolarHBondContact O-N 3.33Å; S15-C17 PolarHBondContact O-N 2.97Å
16	A	44.5	Very low	49.8	Very low	69 Å²	69	110.6 Å²	110.6	57%	0.57	67%	0.665	S	S	*	*	S	Bend	trans	-74.7	92.8	166	0	0	0	0	0	108.7	R18	A16-R18 PolarHBondContact O-N 3.17Å; A16-R18 VanDerWaalsContact O-N 3.09Å
17	C	48.8	Very low	51.8	Low	113 Å²	113	109.6 Å²	109.6	76%	0.764	65%	0.651	S	S	*	*			trans	41.5	59.8	145.6	-59.2	0	0	0	0	116.8	S15 I19	S15-C17 PolarHBondContact O-N 2.97Å; C17-I19 PolarHBondContact O-N 2.91Å
18	R	44.8	Very low	54	Low	214 Å²	214	104.8 Å²	104.8	81%	0.808	62%	0.617	S	S	*	*			trans	-76.8	67	153.7	-65	-163.7	-174.5	-134	1.6	109.2	A16 S20	A16-R18 PolarHBondContact O-N 3.17Å; A16-R18 VanDerWaalsContact O-N 3.09Å; R18-S20 PolarHBondContact O-N 3.11Å
19	I	47.4	Very low	56.3	Low	101 Å²	101	106.8 Å²	106.8	52%	0.518	61%	0.606	S	S	.	*			trans	-69	92.2	152.5	-58.8	179.3	0	0	0	103.3	C17 S21 Q23 I24	C17-I19 PolarHBondContact O-N 2.91Å; I19-S21 PolarHBondContact O-N 3.01Å; I19-Q23 HydrophobicContact CG2-CB 3.83Å; I19-Q23 HydrophobicContact CG2-CG 4.23Å; I19-I24 HydrophobicContact CG2-CG1 4.36Å
20	S	50.4	Low	58.7	Low	58 Å²	58	98.4 Å²	98.4	41%	0.406	57%	0.568	S	S	.	*			trans	-49.5	139.4	175.1	-69.4	0	0	0	0	108.4	R18 E22 Q23	R18-S20 PolarHBondContact O-N 3.11Å; S20-E22 WeakPolarHBondContact CB-OE2 3.47Å; S20-E22 PolarHBondContact O-N 3.44Å; S20-Q23 WeakPolarHBondContact O-CB 3.32Å; S20-Q23 PolarHBondContact O-N 3.33Å
21	S	50.1	Low	61.3	Low	98 Å²	98	98 Å²	98	69%	0.685	55%	0.553	S	S	*	*	H	α-helix	trans	-50.1	-24.5	177.4	-58.8	0	0	0	0	112.9	I19 Q23 I24 S25	I19-S21 PolarHBondContact O-N 3.01Å; S21-Q23 VanDerWaalsContact C-N 3.28Å; S21-Q23 PolarHBondContact O-N 3.49Å; S21-I24 PolarHBondContact O-N 3.09Å; S21-S25 PolarHBondContact O-N 3.22Å
22	E	51.8	Low	63.8	Low	146 Å²	146	98.2 Å²	98.2	68%	0.682	55%	0.545	S	S	*	.	H	α-helix	trans	-59.8	-31.2	172.4	-70.3	145.4	142.8	0	0	114.1	S20 S25 Q26	S20-E22 WeakPolarHBondContact CB-OE2 3.47Å; S20-E22 PolarHBondContact O-N 3.44Å; E22-S25 PolarHBondContact O-N 3.1Å; E22-Q26 WeakPolarHBondContact O-CG 3.37Å; E22-Q26 PolarHBondContact O-N 3.08Å
23	Q	53.3	Low	66.2	Low	97 Å²	97	98 Å²	98	45%	0.453	53%	0.527	S	S	.	.	H	α-helix	trans	-77.7	-23.6	-179.8	-164.1	171.1	-20.7	0	0	112.6	I19 S20 S21	I19-Q23 HydrophobicContact CG2-CB 3.83Å; I19-Q23 HydrophobicContact CG2-CG 4.23Å; S20-Q23 WeakPolarHBondContact O-CB 3.32Å; S20-Q23 PolarHBondContact O-N 3.33Å; S21-Q23 VanDerWaalsContact C-N 3.28Å; S21-Q23 PolarHBondContact O-N 3.49Å
24	I	56.6	Low	68.6	Low	91 Å²	91	93 Å²	93	47%	0.467	49%	0.492	S	S	.	.	H	α-helix	trans	-75.3	-32.5	171.8	-62	171.7	0	0	0	110.6	I19 S21 Q26	I19-I24 HydrophobicContact CG2-CG1 4.36Å; S21-I24 PolarHBondContact O-N 3.09Å; I24-Q26 VanDerWaalsContact C-N 3.27Å; I24-Q26 PolarHBondContact O-N 3.28Å
25	S	63.9	Low	71	Confident	88 Å²	88	88.2 Å²	88.2	62%	0.615	47%	0.467	S	S	*	.	S	Bend	trans	-81.9	-0.3	176.4	-57.3	0	0	0	0	113.8	S21 E22 Q27	S21-S25 PolarHBondContact O-N 3.22Å; E22-S25 PolarHBondContact O-N 3.1Å; S25-Q27 PolarHBondContact O-N 2.91Å; S25-Q27 VanDerWaalsContact O-N 3.16Å
26	Q	80.7	Confident	73.3	Confident	80 Å²	80	88.6 Å²	88.6	37%	0.374	46%	0.455	S	S	.	.			trans	-66.5	116.5	175.8	-76.4	174.1	19.6	0	0	110	E22 I24	E22-Q26 WeakPolarHBondContact O-CG 3.37Å; E22-Q26 PolarHBondContact O-N 3.08Å; I24-Q26 VanDerWaalsContact C-N 3.27Å; I24-Q26 PolarHBondContact O-N 3.28Å
27	Q	89.8	Confident	75.8	Confident	112 Å²	112	85.3 Å²	85.3	52%	0.523	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.1	129.1	171.8	-73.7	-175.9	83.5	0	0	109.5	S25 V47 F48 S110	S25-Q27 PolarHBondContact O-N 2.91Å; S25-Q27 VanDerWaalsContact O-N 3.16Å; Q27-V47 HydrophobicContact CB-CG1 3.69Å; Q27-V47 HydrophobicContact CG-CG1 4.02Å; Q27-V47 VanDerWaalsContact OE1-CG1 3.23Å; Q27-F48 CarbonylContact C-O 3.6Å; Q27-F48 WeakPolarHBondContact CA-O 3.42Å; Q27-S110 VanDerWaalsContact CB-OG 3.3Å; Q27-S110 WeakPolarHBondContact CB-OG 3.39Å; Q27-S110 PolarHBondContact O-N 3.3Å; Q27-S110 PolarHBondContact O-OG 2.98Å
28	V	92.6	Very high	78.1	Confident	6 Å²	6	79.9 Å²	79.9	4%	0.036	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	147.9	177.4	-63.9	0	0	0	0	109.5	P30 F48 M50 V53 L107 V108	V28-P30 WeakPolarHBondContact O-CD 3.17Å; V28-F48 WeakPolarHBondContact CG2-O 3.35Å; V28-F48 PolarHBondContact N-O 3.2Å; V28-F48 PolarHBondContact O-N 2.91Å; V28-M50 HydrophobicContact CG1-SD 4.39Å; V28-M50 HydrophobicContact CG2-CE 3.58Å; V28-M50 HydrophobicContact CG2-SD 4.43Å; V28-V53 HydrophobicContact CG2-CG2 4.23Å; V28-L107 HydrophobicContact CB-CB 4.39Å; V28-L107 HydrophobicContact CB-CD2 4.25Å; V28-L107 HydrophobicContact CG2-CD2 3.88Å; V28-V108 WeakPolarHBondContact CA-O 3.41Å
29	R	94.9	Very high	80.6	Confident	128 Å²	128	73.6 Å²	73.6	48%	0.483	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	105.5	171.3	-74.3	-177.6	-178.4	-129	3.5	108.8	E46 V47 V108	R29-E46 IonicContact NH1-OE2 3.96Å; R29-V47 HydrophobicContact CG-CG2 3.92Å; R29-V108 PolarHBondContact N-O 2.93Å; R29-V108 PolarHBondContact O-N 3.06Å
30	P	95.2	Very high	83	Confident	12 Å²	12	71.8 Å²	71.8	8%	0.078	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.3	143.1	173.7	-23.7	35.2	0	0	0	112	V28 L34 L35 L38 E46 F48 V53 N106 L107	V28-P30 WeakPolarHBondContact O-CD 3.17Å; P30-L34 HydrophobicContact CB-CB 4.11Å; P30-L34 HydrophobicContact CB-CD2 3.98Å; P30-L34 HydrophobicContact CB-CG 3.99Å; P30-L35 HydrophobicContact CB-CB 4.45Å; P30-L38 HydrophobicContact CB-CD1 4.2Å; P30-L38 HydrophobicContact CG-CD1 3.74Å; P30-E46 WeakPolarHBondContact CD-O 3.43Å; P30-F48 HydrophobicContact CG-CD2 3.65Å; P30-F48 HydrophobicContact CG-CE2 4.24Å; P30-V53 HydrophobicContact CG-CG2 4.38Å; P30-N106 CarbonylContact C-O 3.47Å; P30-N106 WeakPolarHBondContact CA-O 3.34Å; P30-L107 HydrophobicContact CB-CD2 4.15Å; P30-L107 HydrophobicContact CG-CD2 3.94Å
31	K	95.9	Very high	85.2	Confident	108 Å²	108	69.9 Å²	69.9	47%	0.47	36%	0.359	S	S	.	.			trans	-63.8	156.7	168	-69.1	-178.2	-176	168.9	0	110.2	Q33 L34 L35 K105 N106	K31-Q33 PolarHBondContact O-N 3.32Å; K31-L34 PolarHBondContact O-N 3.47Å; K31-L35 PolarHBondContact O-N 3.24Å; K31-K105 WeakPolarHBondContact CE-O 3.48Å; K31-K105 PolarHBondContact NZ-O 2.99Å; K31-N106 PolarHBondContact N-O 2.77Å
32	L	94.9	Very high	87.3	Confident	117 Å²	117	67.7 Å²	67.7	61%	0.613	35%	0.352	S	S	*	.	H	α-helix	trans	-49.4	-39.4	-174.5	-176.4	63	0	0	0	114.2	L35 K36	L32-L35 PolarHBondContact O-N 2.86Å; L32-K36 WeakPolarHBondContact O-CG 3.37Å; L32-K36 PolarHBondContact O-N 2.86Å; L32-K36 VanDerWaalsContact O-N 3.08Å
33	Q	94.6	Very high	89.4	Confident	92 Å²	92	61 Å²	61	43%	0.43	32%	0.322	S	S	.	.	H	α-helix	trans	-63.2	-50.6	179.1	-70.2	-91.4	-35.8	0	0	112	K31 K36 L85	K31-Q33 PolarHBondContact O-N 3.32Å; Q33-K36 PolarHBondContact O-N 3.07Å; Q33-L85 HydrophobicContact CB-CD1 3.76Å
34	L	95.9	Very high	91.4	Very high	0 Å²	0	64.3 Å²	64.3	0%	0	34%	0.337	C	S	.	.	H	α-helix	trans	-65.3	-40.2	175.6	-179.2	55	0	0	0	111.2	P30 K31 K36 I37 L38 V53 L57 L85 M102 L103 N106 L107	P30-L34 HydrophobicContact CB-CB 4.11Å; P30-L34 HydrophobicContact CB-CD2 3.98Å; P30-L34 HydrophobicContact CB-CG 3.99Å; K31-L34 PolarHBondContact O-N 3.47Å; L34-K36 VanDerWaalsContact C-N 3.3Å; L34-K36 PolarHBondContact O-N 2.98Å; L34-I37 WeakPolarHBondContact O-CB 3.47Å; L34-I37 PolarHBondContact O-N 3.37Å; L34-I37 VanDerWaalsContact O-N 3.09Å; L34-L38 HydrophobicContact CD1-CD2 4.49Å; L34-L38 HydrophobicContact CD1-CG 4.39Å; L34-L38 HydrophobicContact CG-CD1 4.26Å; L34-L38 HydrophobicContact CG-CG 4.42Å; L34-L38 WeakPolarHBondContact O-CG 3.35Å; L34-L38 PolarHBondContact O-N 2.89Å; L34-V53 HydrophobicContact CD2-CG1 4.42Å; L34-L57 HydrophobicContact CD1-CD1 4.41Å; L34-L85 HydrophobicContact CB-CD2 3.85Å; L34-L85 HydrophobicContact CD1-CD2 3.86Å; L34-L85 HydrophobicContact CG-CD2 4.41Å; L34-M102 HydrophobicContact CD1-CE 4.24Å; L34-M102 HydrophobicContact CD1-SD 4.24Å; L34-M102 HydrophobicContact CD2-SD 4.37Å; L34-L103 HydrophobicContact CD2-CD2 3.95Å; L34-N106 HydrophobicContact CB-CB 4.14Å; L34-N106 HydrophobicContact CD2-CB 3.88Å; L34-L107 HydrophobicContact CD2-CD2 3.76Å; L34-L107 HydrophobicContact CD2-CG 4.37Å
35	L	96.3	Very high	93.1	Very high	19 Å²	19	62.3 Å²	62.3	10%	0.099	34%	0.339	C	S	.	.	H	α-helix	trans	-57.7	-41.7	179.4	-172.3	63.4	0	0	0	112.3	P30 K31 L32 I37 L38 H39 E46 F48	P30-L35 HydrophobicContact CB-CB 4.45Å; K31-L35 PolarHBondContact O-N 3.24Å; L32-L35 PolarHBondContact O-N 2.86Å; L35-I37 VanDerWaalsContact C-N 3.31Å; L35-I37 PolarHBondContact O-N 3.47Å; L35-L38 PolarHBondContact O-N 3.4Å; L35-H39 WeakPolarHBondContact CD1-NE2 3.45Å; L35-H39 PolarHBondContact O-N 3.38Å; L35-E46 HydrophobicContact CD2-CG 4.5Å; L35-F48 HydrophobicContact CD1-CE2 3.56Å; L35-F48 HydrophobicContact CD1-CZ 4.18Å
36	K	96.8	Very high	94.6	Very high	111 Å²	111	64 Å²	64	48%	0.483	34%	0.337	S	S	.	.	H	α-helix	trans	-59.4	-40.1	175.8	-75	174.3	178.3	-174.9	0	112.7	L32 Q33 L34 A40 L81	L32-K36 WeakPolarHBondContact O-CG 3.37Å; L32-K36 PolarHBondContact O-N 2.86Å; L32-K36 VanDerWaalsContact O-N 3.08Å; Q33-K36 PolarHBondContact O-N 3.07Å; L34-K36 VanDerWaalsContact C-N 3.3Å; L34-K36 PolarHBondContact O-N 2.98Å; K36-A40 WeakPolarHBondContact O-CB 3.49Å; K36-A40 PolarHBondContact O-N 3.15Å; K36-L81 HydrophobicContact CB-CD2 4.1Å
37	I	97.3	Very high	95.2	Very high	0 Å²	0	62.3 Å²	62.3	0%	0	33%	0.332	C	S	.	.	H	α-helix	trans	-64.5	-46.7	176.3	-61.7	175.7	0	0	0	109.8	L34 L35 H39 A40 A41 Y60 L81 L82 L85	L34-I37 WeakPolarHBondContact O-CB 3.47Å; L34-I37 PolarHBondContact O-N 3.37Å; L34-I37 VanDerWaalsContact O-N 3.09Å; L35-I37 VanDerWaalsContact C-N 3.31Å; L35-I37 PolarHBondContact O-N 3.47Å; I37-H39 PolarHBondContact O-N 2.81Å; I37-A40 PolarHBondContact O-N 2.85Å; I37-A41 PolarHBondContact O-N 3.08Å; I37-A41 VanDerWaalsContact O-N 3.08Å; I37-Y60 HydrophobicContact CB-CE2 4.5Å; I37-Y60 HydrophobicContact CG2-CD1 3.74Å; I37-Y60 HydrophobicContact CG2-CD2 3.59Å; I37-Y60 HydrophobicContact CG2-CE1 4.03Å; I37-Y60 HydrophobicContact CG2-CE2 3.9Å; I37-Y60 HydrophobicContact CG2-CG 3.5Å; I37-Y60 WeakPolarHBondContact O-CD2 3.47Å; I37-L81 HydrophobicContact CD1-CD2 4.35Å; I37-L81 HydrophobicContact CD1-CG 4.04Å; I37-L81 HydrophobicContact CG1-CB 4.35Å; I37-L81 HydrophobicContact CG1-CD2 3.62Å; I37-L81 HydrophobicContact CG1-CG 3.85Å; I37-L82 HydrophobicContact CD1-CB 4.36Å; I37-L82 HydrophobicContact CD1-CD1 4.24Å; I37-L85 HydrophobicContact CD1-CB 4.34Å; I37-L85 HydrophobicContact CD1-CD2 3.65Å
38	L	97.6	Very high	95.4	Very high	0 Å²	0	57.2 Å²	57.2	0%	0	31%	0.308	C	S	.	.	H	α-helix	trans	-62	-43.7	179.7	-58.6	174.8	0	0	0	111.3	P30 L34 L35 A41 G42 A43 F48 V53 L57	P30-L38 HydrophobicContact CB-CD1 4.2Å; P30-L38 HydrophobicContact CG-CD1 3.74Å; L34-L38 HydrophobicContact CD1-CD2 4.49Å; L34-L38 HydrophobicContact CD1-CG 4.39Å; L34-L38 HydrophobicContact CG-CD1 4.26Å; L34-L38 HydrophobicContact CG-CG 4.42Å; L34-L38 WeakPolarHBondContact O-CG 3.35Å; L34-L38 PolarHBondContact O-N 2.89Å; L35-L38 PolarHBondContact O-N 3.4Å; L38-A41 CarbonylContact O-C 3.57Å; L38-A41 WeakPolarHBondContact O-CA 3.25Å; L38-A41 WeakPolarHBondContact O-CB 3.32Å; L38-A41 PolarHBondContact O-N 3.45Å; L38-A41 VanDerWaalsContact O-N 3.1Å; L38-G42 PolarHBondContact O-N 2.76Å; L38-A43 VanDerWaalsContact C-CB 3.47Å; L38-A43 HydrophobicContact CB-CB 3.84Å; L38-A43 WeakPolarHBondContact O-CB 3.29Å; L38-A43 PolarHBondContact O-N 3.47Å; L38-F48 HydrophobicContact CD1-CD2 4.14Å; L38-F48 HydrophobicContact CD1-CE2 4.15Å; L38-V53 HydrophobicContact CD1-CG2 4.2Å; L38-V53 HydrophobicContact CD2-CG1 4.35Å; L38-L57 HydrophobicContact CD2-CG 4.37Å
39	H	97.3	Very high	95.4	Very high	81 Å²	81	58.5 Å²	58.5	38%	0.375	32%	0.316	S	S	.	.	H	α-helix	trans	-65.1	-39.8	176.3	-70	174.4	0	0	0	112.6	L35 I37 A41 G42 A43 G45	L35-H39 WeakPolarHBondContact CD1-NE2 3.45Å; L35-H39 PolarHBondContact O-N 3.38Å; I37-H39 PolarHBondContact O-N 2.81Å; H39-A41 PolarHBondContact O-N 3.05Å; H39-G42 PolarHBondContact O-N 3.11Å; H39-A43 PolarHBondContact CD2-O 3.33Å; H39-G45 PolarHBondContact NE2-O 3.46Å
40	A	96.5	Very high	95.2	Very high	64 Å²	64	54.9 Å²	54.9	53%	0.529	31%	0.305	S	S	.	.	H	α-helix	trans	-62.8	-22.6	173.5	0	0	0	0	0	112.7	K36 I37 G42 Y60	K36-A40 WeakPolarHBondContact O-CB 3.49Å; K36-A40 PolarHBondContact O-N 3.15Å; I37-A40 PolarHBondContact O-N 2.85Å; A40-G42 VanDerWaalsContact C-N 3.34Å; A40-Y60 HydrophobicContact CB-CD2 4.06Å; A40-Y60 HydrophobicContact CB-CE2 3.75Å
41	A	96.6	Very high	95	Very high	18 Å²	18	61.9 Å²	61.9	15%	0.149	34%	0.335	C	S	.	.	T	Hydrogen-bonded Turn	trans	-86.7	0.2	172.1	0	0	0	0	0	114.1	I37 L38 H39 Y56 Q59 Y60	I37-A41 PolarHBondContact O-N 3.08Å; I37-A41 VanDerWaalsContact O-N 3.08Å; L38-A41 CarbonylContact O-C 3.57Å; L38-A41 WeakPolarHBondContact O-CA 3.25Å; L38-A41 WeakPolarHBondContact O-CB 3.32Å; L38-A41 PolarHBondContact O-N 3.45Å; L38-A41 VanDerWaalsContact O-N 3.1Å; H39-A41 PolarHBondContact O-N 3.05Å; A41-Y56 VanDerWaalsContact CB-O 3.25Å; A41-Y56 WeakPolarHBondContact CB-O 3.36Å; A41-Q59 HydrophobicContact CB-CB 4.24Å; A41-Y60 HydrophobicContact CB-CD2 4.36Å
42	G	95.2	Very high	94.9	Very high	51 Å²	51	60.5 Å²	60.5	53%	0.526	33%	0.33	S	S	.	.	T	Hydrogen-bonded Turn	trans	97.6	5.6	-179.6	0	0	0	0	0	115.3	L38 H39 A40	L38-G42 PolarHBondContact O-N 2.76Å; H39-G42 PolarHBondContact O-N 3.11Å; A40-G42 VanDerWaalsContact C-N 3.34Å
43	A	96.3	Very high	94.9	Very high	6 Å²	6	54.9 Å²	54.9	5%	0.05	30%	0.3	C	S	.	.			trans	-67.8	150.5	175.1	0	0	0	0	0	111.7	L38 H39 F48 Y56	L38-A43 VanDerWaalsContact C-CB 3.47Å; L38-A43 HydrophobicContact CB-CB 3.84Å; L38-A43 WeakPolarHBondContact O-CB 3.29Å; L38-A43 PolarHBondContact O-N 3.47Å; H39-A43 PolarHBondContact CD2-O 3.33Å; A43-F48 HydrophobicContact CB-CE1 3.76Å; A43-F48 HydrophobicContact CB-CZ 3.97Å; A43-Y56 HydrophobicContact CB-CD1 3.77Å; A43-Y56 HydrophobicContact CB-CD2 3.63Å; A43-Y56 HydrophobicContact CB-CE1 3.78Å; A43-Y56 HydrophobicContact CB-CE2 3.65Å; A43-Y56 HydrophobicContact CB-CG 3.71Å
44	Q	94.4	Very high	94.9	Very high	167 Å²	167	53.8 Å²	53.8	78%	0.78	30%	0.296	S	S	*	.			trans	-127.4	151.9	176.1	-61.6	-178.8	4.4	0	0	110.4	F48	Q44-F48 WeakPolarHBondContact O-CE1 3.13Å; Q44-F48 WeakPolarHBondContact O-CZ 3.47Å
45	G	93.6	Very high	94.9	Very high	49 Å²	49	58.8 Å²	58.8	51%	0.505	32%	0.319	S	S	.	.	S	Bend	trans	84.5	-173.7	-178	0	0	0	0	0	114	H39 F48	H39-G45 PolarHBondContact NE2-O 3.46Å; G45-F48 WeakPolarHBondContact O-CZ 3.49Å
46	E	93.5	Very high	94.9	Very high	122 Å²	122	60.5 Å²	60.5	57%	0.57	33%	0.325	S	S	*	.	S	Bend	trans	-120.5	-8.9	-174.4	-60.3	-176	169.2	0	0	113.5	R29 P30 L35	R29-E46 IonicContact NH1-OE2 3.96Å; P30-E46 WeakPolarHBondContact CD-O 3.43Å; L35-E46 HydrophobicContact CD2-CG 4.5Å
47	V	93.7	Very high	94.9	Very high	45 Å²	45	55.3 Å²	55.3	27%	0.273	30%	0.302	S	S	.	.			trans	-120.7	132	-176.1	-173.4	0	0	0	0	108.1	Q27 R29	Q27-V47 HydrophobicContact CB-CG1 3.69Å; Q27-V47 HydrophobicContact CG-CG1 4.02Å; Q27-V47 VanDerWaalsContact OE1-CG1 3.23Å; R29-V47 HydrophobicContact CG-CG2 3.92Å
48	F	94.1	Very high	94.8	Very high	6 Å²	6	57.1 Å²	57.1	3%	0.026	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.9	162	-177.5	-59.8	-84.1	0	0	0	110.1	Q27 V28 P30 L35 L38 A43 Q44 G45 E52 V53 Y56	Q27-F48 CarbonylContact C-O 3.6Å; Q27-F48 WeakPolarHBondContact CA-O 3.42Å; V28-F48 WeakPolarHBondContact CG2-O 3.35Å; V28-F48 PolarHBondContact N-O 3.2Å; V28-F48 PolarHBondContact O-N 2.91Å; P30-F48 HydrophobicContact CG-CD2 3.65Å; P30-F48 HydrophobicContact CG-CE2 4.24Å; L35-F48 HydrophobicContact CD1-CE2 3.56Å; L35-F48 HydrophobicContact CD1-CZ 4.18Å; L38-F48 HydrophobicContact CD1-CD2 4.14Å; L38-F48 HydrophobicContact CD1-CE2 4.15Å; A43-F48 HydrophobicContact CB-CE1 3.76Å; A43-F48 HydrophobicContact CB-CZ 3.97Å; Q44-F48 WeakPolarHBondContact O-CE1 3.13Å; Q44-F48 WeakPolarHBondContact O-CZ 3.47Å; G45-F48 WeakPolarHBondContact O-CZ 3.49Å; F48-E52 HydrophobicContact CB-CB 4.27Å; F48-E52 HydrophobicContact CD1-CB 4.25Å; F48-V53 HydrophobicContact CB-CG2 3.66Å; F48-V53 HydrophobicContact CG-CG2 4.32Å; F48-Y56 HydrophobicContact CD1-CD2 4.42Å; F48-Y56 HydrophobicContact CD1-CE2 4.22Å; F48-Y56 HydrophobicContact CE1-CD2 4.43Å; F48-Y56 HydrophobicContact CE1-CE2 4.13Å
49	T	92.8	Very high	94.8	Very high	33 Å²	33	60.2 Å²	60.2	20%	0.202	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	166.2	164	61.2	0	0	0	0	110.6	K51 E52 V53	T49-K51 VanDerWaalsContact C-N 3.25Å; T49-K51 PolarHBondContact O-N 3.39Å; T49-E52 WeakPolarHBondContact CB-OE2 3.4Å; T49-E52 PolarHBondContact N-OE2 3.04Å; T49-E52 PolarHBondContact O-N 2.9Å; T49-E52 WeakPolarHBondContact OG1-CG 3.41Å; T49-E52 PolarHBondContact OG1-N 3.09Å; T49-E52 PolarHBondContact OG1-OE2 3.37Å; T49-V53 WeakPolarHBondContact O-CG2 3.36Å; T49-V53 PolarHBondContact O-N 3.39Å
50	M	90.5	Very high	94.8	Very high	52 Å²	52	56.8 Å²	56.8	26%	0.256	32%	0.319	S	S	.	.	H	α-helix	trans	-63.7	-32.5	174.8	-67.1	-74.4	58.9	0	0	114.7	V28 V53 M54 L107	V28-M50 HydrophobicContact CG1-SD 4.39Å; V28-M50 HydrophobicContact CG2-CE 3.58Å; V28-M50 HydrophobicContact CG2-SD 4.43Å; M50-V53 HydrophobicContact CE-CB 3.53Å; M50-V53 HydrophobicContact CE-CG1 3.9Å; M50-V53 HydrophobicContact CE-CG2 3.56Å; M50-M54 WeakPolarHBondContact O-CB 3.22Å; M50-M54 WeakPolarHBondContact O-CG 3.4Å; M50-M54 PolarHBondContact O-N 2.88Å; M50-M54 VanDerWaalsContact O-N 3.12Å; M50-L107 HydrophobicContact CE-CD1 3.28Å; M50-L107 HydrophobicContact CE-CD2 4.09Å; M50-L107 HydrophobicContact CE-CG 4.3Å; M50-L107 HydrophobicContact SD-CD1 3.32Å; M50-L107 WeakPolarHBondContact SD-CD1 3.48Å
51	K	91.6	Very high	94.9	Very high	159 Å²	159	54.7 Å²	54.7	69%	0.691	30%	0.299	S	S	*	.	H	α-helix	trans	-61.8	-45	173	-173.5	-179.5	177.4	-175.3	0	111.9	T49 H55	T49-K51 VanDerWaalsContact C-N 3.25Å; T49-K51 PolarHBondContact O-N 3.39Å; K51-H55 WeakPolarHBondContact O-CB 3.45Å; K51-H55 PolarHBondContact O-N 2.81Å
52	E	94.6	Very high	94.8	Very high	78 Å²	78	58.3 Å²	58.3	36%	0.364	31%	0.314	S	S	.	.	H	α-helix	trans	-67.1	-44.8	-179.6	-73.5	165	136.1	0	0	112	F48 T49 M54 H55 Y56	F48-E52 HydrophobicContact CB-CB 4.27Å; F48-E52 HydrophobicContact CD1-CB 4.25Å; T49-E52 WeakPolarHBondContact CB-OE2 3.4Å; T49-E52 PolarHBondContact N-OE2 3.04Å; T49-E52 PolarHBondContact O-N 2.9Å; T49-E52 WeakPolarHBondContact OG1-CG 3.41Å; T49-E52 PolarHBondContact OG1-N 3.09Å; T49-E52 PolarHBondContact OG1-OE2 3.37Å; E52-M54 VanDerWaalsContact C-N 3.32Å; E52-M54 PolarHBondContact O-N 3.06Å; E52-H55 WeakPolarHBondContact O-CB 3.48Å; E52-H55 PolarHBondContact O-N 3.04Å; E52-H55 VanDerWaalsContact O-N 3.16Å; E52-Y56 HydrophobicContact CB-CD2 4.27Å; E52-Y56 HydrophobicContact CB-CE2 4.14Å; E52-Y56 WeakPolarHBondContact O-CD2 3.48Å; E52-Y56 PolarHBondContact O-N 3.35Å
53	V	94.4	Very high	94.8	Very high	0 Å²	0	60.6 Å²	60.6	0%	0	32%	0.317	C	S	.	.	H	α-helix	trans	-58.4	-46.7	177.9	171.9	0	0	0	0	110.8	V28 P30 L34 L38 F48 T49 M50 H55 Y56 L57 L103 L107	V28-V53 HydrophobicContact CG2-CG2 4.23Å; P30-V53 HydrophobicContact CG-CG2 4.38Å; L34-V53 HydrophobicContact CD2-CG1 4.42Å; L38-V53 HydrophobicContact CD1-CG2 4.2Å; L38-V53 HydrophobicContact CD2-CG1 4.35Å; F48-V53 HydrophobicContact CB-CG2 3.66Å; F48-V53 HydrophobicContact CG-CG2 4.32Å; T49-V53 WeakPolarHBondContact O-CG2 3.36Å; T49-V53 PolarHBondContact O-N 3.39Å; M50-V53 HydrophobicContact CE-CB 3.53Å; M50-V53 HydrophobicContact CE-CG1 3.9Å; M50-V53 HydrophobicContact CE-CG2 3.56Å; V53-H55 VanDerWaalsContact C-N 3.33Å; V53-H55 PolarHBondContact O-N 3.35Å; V53-Y56 PolarHBondContact O-N 2.97Å; V53-L57 HydrophobicContact CG1-CD1 3.74Å; V53-L57 WeakPolarHBondContact O-CB 3.34Å; V53-L57 WeakPolarHBondContact O-CD1 3.49Å; V53-L57 PolarHBondContact O-N 2.87Å; V53-L103 HydrophobicContact CG1-CD2 3.51Å; V53-L107 HydrophobicContact CG2-CD2 4.45Å
54	M	93.9	Very high	94.9	Very high	68 Å²	68	65.2 Å²	65.2	34%	0.335	34%	0.336	S	S	.	.	H	α-helix	trans	-61.1	-42.9	176.5	-69.2	-64.3	-70.1	0	0	112	M50 E52 L57 G58 L99 Y100 L103	M50-M54 WeakPolarHBondContact O-CB 3.22Å; M50-M54 WeakPolarHBondContact O-CG 3.4Å; M50-M54 PolarHBondContact O-N 2.88Å; M50-M54 VanDerWaalsContact O-N 3.12Å; E52-M54 VanDerWaalsContact C-N 3.32Å; E52-M54 PolarHBondContact O-N 3.06Å; M54-L57 PolarHBondContact O-N 3.12Å; M54-G58 PolarHBondContact O-N 2.94Å; M54-G58 VanDerWaalsContact O-N 3.1Å; M54-L99 HydrophobicContact CE-CD2 3.88Å; M54-L99 HydrophobicContact SD-CD2 3.43Å; M54-L99 WeakPolarHBondContact SD-CD2 3.48Å; M54-Y100 HydrophobicContact CE-CE1 4.36Å; M54-Y100 HydrophobicContact SD-CE1 4.42Å; M54-L103 HydrophobicContact SD-CD1 3.71Å
55	H	95.1	Very high	95	Very high	106 Å²	106	63.3 Å²	63.3	49%	0.491	33%	0.327	S	S	.	.	H	α-helix	trans	-60.5	-52.7	178	177.4	71.6	0	0	0	111.7	K51 E52 V53 L57 G58 Q59	K51-H55 WeakPolarHBondContact O-CB 3.45Å; K51-H55 PolarHBondContact O-N 2.81Å; E52-H55 WeakPolarHBondContact O-CB 3.48Å; E52-H55 PolarHBondContact O-N 3.04Å; E52-H55 VanDerWaalsContact O-N 3.16Å; V53-H55 VanDerWaalsContact C-N 3.33Å; V53-H55 PolarHBondContact O-N 3.35Å; H55-L57 VanDerWaalsContact C-N 3.34Å; H55-L57 PolarHBondContact O-N 3.46Å; H55-G58 PolarHBondContact O-N 3.35Å; H55-G58 VanDerWaalsContact O-N 3.15Å; H55-Q59 WeakPolarHBondContact O-CG 3.47Å; H55-Q59 PolarHBondContact O-N 2.99Å
56	Y	97.9	Very high	95.2	Very high	54 Å²	54	62.1 Å²	62.1	21%	0.212	31%	0.309	C	S	.	.	H	α-helix	trans	-67.2	-31.7	-179	-71.3	-61.6	0	0	0	113	A41 A43 F48 E52 V53 Q59 Y60	A41-Y56 VanDerWaalsContact CB-O 3.25Å; A41-Y56 WeakPolarHBondContact CB-O 3.36Å; A43-Y56 HydrophobicContact CB-CD1 3.77Å; A43-Y56 HydrophobicContact CB-CD2 3.63Å; A43-Y56 HydrophobicContact CB-CE1 3.78Å; A43-Y56 HydrophobicContact CB-CE2 3.65Å; A43-Y56 HydrophobicContact CB-CG 3.71Å; F48-Y56 HydrophobicContact CD1-CD2 4.42Å; F48-Y56 HydrophobicContact CD1-CE2 4.22Å; F48-Y56 HydrophobicContact CE1-CD2 4.43Å; F48-Y56 HydrophobicContact CE1-CE2 4.13Å; E52-Y56 HydrophobicContact CB-CD2 4.27Å; E52-Y56 HydrophobicContact CB-CE2 4.14Å; E52-Y56 WeakPolarHBondContact O-CD2 3.48Å; E52-Y56 PolarHBondContact O-N 3.35Å; V53-Y56 PolarHBondContact O-N 2.97Å; Y56-Q59 PolarHBondContact O-N 3.33Å; Y56-Y60 WeakPolarHBondContact O-CB 3.08Å; Y56-Y60 PolarHBondContact O-N 3.42Å
57	L	96.1	Very high	95.4	Very high	2 Å²	2	59.6 Å²	59.6	1%	0.01	30%	0.295	C	S	.	.	H	α-helix	trans	-61.1	-44.3	170.1	-90.1	152.9	0	0	0	111.8	L34 L38 V53 M54 H55 Q59 Y60 I61 L82 M102 L103	L34-L57 HydrophobicContact CD1-CD1 4.41Å; L38-L57 HydrophobicContact CD2-CG 4.37Å; V53-L57 HydrophobicContact CG1-CD1 3.74Å; V53-L57 WeakPolarHBondContact O-CB 3.34Å; V53-L57 WeakPolarHBondContact O-CD1 3.49Å; V53-L57 PolarHBondContact O-N 2.87Å; M54-L57 PolarHBondContact O-N 3.12Å; H55-L57 VanDerWaalsContact C-N 3.34Å; H55-L57 PolarHBondContact O-N 3.46Å; L57-Q59 VanDerWaalsContact C-N 3.35Å; L57-Y60 WeakPolarHBondContact O-CB 3.33Å; L57-Y60 PolarHBondContact O-N 3.46Å; L57-I61 WeakPolarHBondContact O-CG1 3.23Å; L57-I61 PolarHBondContact O-N 3.1Å; L57-I61 VanDerWaalsContact O-N 3.15Å; L57-L82 HydrophobicContact CD2-CD1 3.62Å; L57-M102 HydrophobicContact CD1-CE 4.2Å; L57-M102 HydrophobicContact CD2-CE 4.17Å; L57-L103 HydrophobicContact CD1-CD2 3.89Å
58	G	95.7	Very high	95.5	Very high	38 Å²	38	59.5 Å²	59.5	39%	0.392	29%	0.293	S	S	.	.	H	α-helix	trans	-60.6	-43.9	173.8	0	0	0	0	0	112.3	M54 H55 Y60 I61 M62	M54-G58 PolarHBondContact O-N 2.94Å; M54-G58 VanDerWaalsContact O-N 3.1Å; H55-G58 PolarHBondContact O-N 3.35Å; H55-G58 VanDerWaalsContact O-N 3.15Å; G58-Y60 PolarHBondContact O-N 2.89Å; G58-I61 PolarHBondContact O-N 3.15Å; G58-M62 PolarHBondContact O-N 2.91Å; G58-M62 VanDerWaalsContact O-N 3.07Å
59	Q	97.6	Very high	95.6	Very high	66 Å²	66	66.6 Å²	66.6	31%	0.308	33%	0.326	S	S	.	.	H	α-helix	trans	-61.8	-42.4	176.1	-66	-63.4	95.9	0	0	112.1	A41 H55 Y56 L57 I61 M62 V63	A41-Q59 HydrophobicContact CB-CB 4.24Å; H55-Q59 WeakPolarHBondContact O-CG 3.47Å; H55-Q59 PolarHBondContact O-N 2.99Å; Y56-Q59 PolarHBondContact O-N 3.33Å; L57-Q59 VanDerWaalsContact C-N 3.35Å; Q59-I61 PolarHBondContact O-N 2.99Å; Q59-M62 PolarHBondContact O-N 3.49Å; Q59-M62 VanDerWaalsContact OE1-CE 3.27Å; Q59-V63 WeakPolarHBondContact O-CG2 3.05Å; Q59-V63 PolarHBondContact O-N 2.97Å
60	Y	97.8	Very high	95.7	Very high	9 Å²	9	74 Å²	74	4%	0.035	36%	0.358	C	S	.	.	H	α-helix	trans	-57.9	-49.5	177.6	-174.4	-95.2	0	0	0	111.5	I37 A40 A41 Y56 L57 G58 M62 V63 K64 L66 D80 L82	I37-Y60 HydrophobicContact CB-CE2 4.5Å; I37-Y60 HydrophobicContact CG2-CD1 3.74Å; I37-Y60 HydrophobicContact CG2-CD2 3.59Å; I37-Y60 HydrophobicContact CG2-CE1 4.03Å; I37-Y60 HydrophobicContact CG2-CE2 3.9Å; I37-Y60 HydrophobicContact CG2-CG 3.5Å; I37-Y60 WeakPolarHBondContact O-CD2 3.47Å; A40-Y60 HydrophobicContact CB-CD2 4.06Å; A40-Y60 HydrophobicContact CB-CE2 3.75Å; A41-Y60 HydrophobicContact CB-CD2 4.36Å; Y56-Y60 WeakPolarHBondContact O-CB 3.08Å; Y56-Y60 PolarHBondContact O-N 3.42Å; L57-Y60 WeakPolarHBondContact O-CB 3.33Å; L57-Y60 PolarHBondContact O-N 3.46Å; G58-Y60 PolarHBondContact O-N 2.89Å; Y60-M62 VanDerWaalsContact C-N 3.28Å; Y60-M62 PolarHBondContact O-N 2.72Å; Y60-V63 PolarHBondContact O-N 2.78Å; Y60-K64 HydrophobicContact CD1-CG 4.37Å; Y60-K64 HydrophobicContact CE1-CG 4.01Å; Y60-K64 HydrophobicContact CE2-CG 4.17Å; Y60-K64 VanDerWaalsContact O-CB 3.32Å; Y60-K64 WeakPolarHBondContact O-CB 3.09Å; Y60-K64 WeakPolarHBondContact O-CG 3.39Å; Y60-K64 PolarHBondContact O-N 2.81Å; Y60-K64 PolarHBondContact OH-NZ 3.06Å; Y60-L66 HydrophobicContact CD1-CD1 4.31Å; Y60-L66 HydrophobicContact CE1-CD1 4Å; Y60-D80 WeakPolarHBondContact CE1-OD1 3.46Å; Y60-D80 VanDerWaalsContact OH-CG 3.26Å; Y60-D80 PolarHBondContact OH-OD1 2.93Å; Y60-D80 PolarHBondContact OH-OD2 3.27Å; Y60-L82 HydrophobicContact CD1-CB 4.44Å; Y60-L82 HydrophobicContact CD1-CD2 4.24Å; Y60-L82 HydrophobicContact CE1-CB 3.96Å; Y60-L82 HydrophobicContact CE1-CD2 4.48Å
61	I	96.8	Very high	96	Very high	19 Å²	19	76.4 Å²	76.4	10%	0.097	37%	0.369	C	S	.	.	H	α-helix	trans	-58.7	-42.2	178.3	-68.7	164.2	0	0	0	110.8	L57 G58 Q59 Q65 L66 V75 L82 F91	L57-I61 WeakPolarHBondContact O-CG1 3.23Å; L57-I61 PolarHBondContact O-N 3.1Å; L57-I61 VanDerWaalsContact O-N 3.15Å; G58-I61 PolarHBondContact O-N 3.15Å; Q59-I61 PolarHBondContact O-N 2.99Å; I61-Q65 WeakPolarHBondContact O-CA 3.42Å; I61-Q65 PolarHBondContact O-N 3.39Å; I61-L66 HydrophobicContact CG2-CB 4.25Å; I61-L66 PolarHBondContact O-N 2.89Å; I61-V75 HydrophobicContact CD1-CG1 4.38Å; I61-V75 HydrophobicContact CD1-CG2 4.41Å; I61-V75 HydrophobicContact CG1-CG1 4.31Å; I61-V75 HydrophobicContact CG2-CG1 4.13Å; I61-V75 HydrophobicContact CG2-CG2 4Å; I61-L82 HydrophobicContact CD1-CD2 4.07Å; I61-L82 HydrophobicContact CG1-CD2 3.62Å; I61-F91 HydrophobicContact CD1-CZ 3.99Å
62	M	95.9	Very high	96.2	Very high	95 Å²	95	75.2 Å²	75.2	47%	0.468	37%	0.366	S	S	.	.	H	α-helix	trans	-67.2	-49.3	179.7	-175.7	177.9	63.8	0	0	112.3	G58 Q59 Y60 K64 Q65	G58-M62 PolarHBondContact O-N 2.91Å; G58-M62 VanDerWaalsContact O-N 3.07Å; Q59-M62 PolarHBondContact O-N 3.49Å; Q59-M62 VanDerWaalsContact OE1-CE 3.27Å; Y60-M62 VanDerWaalsContact C-N 3.28Å; Y60-M62 PolarHBondContact O-N 2.72Å; M62-K64 VanDerWaalsContact C-N 3.33Å; M62-K64 PolarHBondContact O-N 2.85Å; M62-Q65 PolarHBondContact O-N 3.46Å; M62-Q65 VanDerWaalsContact O-N 3.1Å
63	V	95.6	Very high	96.2	Very high	98 Å²	98	73.8 Å²	73.8	59%	0.594	36%	0.359	S	S	*	.	H	α-helix	trans	-64.3	-39.1	-178.4	170.7	0	0	0	0	111.4	Q59 Y60 Q65	Q59-V63 WeakPolarHBondContact O-CG2 3.05Å; Q59-V63 PolarHBondContact O-N 2.97Å; Y60-V63 PolarHBondContact O-N 2.78Å; V63-Q65 VanDerWaalsContact C-N 3.27Å; V63-Q65 PolarHBondContact O-N 2.98Å
64	K	96.8	Very high	96.3	Very high	103 Å²	103	75.6 Å²	75.6	45%	0.448	37%	0.368	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.1	-6.5	176.5	-72	-76.8	-165	116.7	0	113.6	Y60 M62 L66 D80	Y60-K64 HydrophobicContact CD1-CG 4.37Å; Y60-K64 HydrophobicContact CE1-CG 4.01Å; Y60-K64 HydrophobicContact CE2-CG 4.17Å; Y60-K64 VanDerWaalsContact O-CB 3.32Å; Y60-K64 WeakPolarHBondContact O-CB 3.09Å; Y60-K64 WeakPolarHBondContact O-CG 3.39Å; Y60-K64 PolarHBondContact O-N 2.81Å; Y60-K64 PolarHBondContact OH-NZ 3.06Å; M62-K64 VanDerWaalsContact C-N 3.33Å; M62-K64 PolarHBondContact O-N 2.85Å; K64-L66 VanDerWaalsContact C-N 3.25Å; K64-L66 HydrophobicContact CB-CD1 4.08Å; K64-L66 HydrophobicContact CB-CD2 4.07Å; K64-L66 HydrophobicContact CB-CG 3.64Å; K64-L66 PolarHBondContact O-N 3.35Å; K64-D80 IonicContact NZ-OD2 2.82Å; K64-D80 PolarHBondContact NZ-OD2 3.16Å
65	Q	97.1	Very high	96.5	Very high	127 Å²	127	72.4 Å²	72.4	59%	0.593	35%	0.352	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.5	44	-174.5	-58.7	-175.5	41.6	0	0	112.9	I61 M62 V63 Y67	I61-Q65 WeakPolarHBondContact O-CA 3.42Å; I61-Q65 PolarHBondContact O-N 3.39Å; M62-Q65 PolarHBondContact O-N 3.46Å; M62-Q65 VanDerWaalsContact O-N 3.1Å; V63-Q65 VanDerWaalsContact C-N 3.27Å; V63-Q65 PolarHBondContact O-N 2.98Å; Q65-Y67 HydrophobicContact CB-CE1 4.39Å; Q65-Y67 HydrophobicContact CG-CE1 4.46Å; Q65-Y67 PolarHBondContact O-N 3.12Å
66	L	97.3	Very high	96.6	Very high	25 Å²	25	72.7 Å²	72.7	13%	0.131	35%	0.35	C	S	.	.			trans	-77.2	-2.7	179.6	-59.8	177.5	0	0	0	112.8	Y60 I61 K64 V75 Y76 C77 D80 L82	Y60-L66 HydrophobicContact CD1-CD1 4.31Å; Y60-L66 HydrophobicContact CE1-CD1 4Å; I61-L66 HydrophobicContact CG2-CB 4.25Å; I61-L66 PolarHBondContact O-N 2.89Å; K64-L66 VanDerWaalsContact C-N 3.25Å; K64-L66 HydrophobicContact CB-CD1 4.08Å; K64-L66 HydrophobicContact CB-CD2 4.07Å; K64-L66 HydrophobicContact CB-CG 3.64Å; K64-L66 PolarHBondContact O-N 3.35Å; L66-V75 HydrophobicContact CB-CG1 3.9Å; L66-V75 CarbonylContact O-C 3.47Å; L66-V75 VanDerWaalsContact O-CA 3.29Å; L66-V75 WeakPolarHBondContact O-CA 3.41Å; L66-Y76 PolarHBondContact O-N 2.72Å; L66-C77 HydrophobicContact CD1-CB 4.34Å; L66-D80 HydrophobicContact CD1-CB 4.44Å; L66-D80 HydrophobicContact CD2-CB 4.41Å; L66-L82 HydrophobicContact CD1-CD2 4.02Å
67	Y	97.4	Very high	96.6	Very high	69 Å²	69	70.1 Å²	70.1	27%	0.271	34%	0.34	S	S	.	.	B	Isolated β-bridge	trans	-88.8	151.4	178.9	63.1	-89.1	0	0	0	111.3	Q65 Q72 M74	Q65-Y67 HydrophobicContact CB-CE1 4.39Å; Q65-Y67 HydrophobicContact CG-CE1 4.46Å; Q65-Y67 PolarHBondContact O-N 3.12Å; Y67-Q72 HydrophobicContact CD2-CG 4.13Å; Y67-Q72 HydrophobicContact CE2-CG 4.49Å; Y67-M74 CarbonylContact C-O 3.51Å; Y67-M74 WeakPolarHBondContact CA-O 3.47Å
68	D	97.6	Very high	96.6	Very high	43 Å²	43	72.4 Å²	72.4	23%	0.23	36%	0.364	C	S	.	.			trans	-73.7	135.7	172.4	-166.7	-83	0	0	0	111.4	Q70 E71 Q72 M74 Y76	D68-Q70 VanDerWaalsContact C-N 3.34Å; D68-Q70 PolarHBondContact O-N 3.25Å; D68-Q70 WeakPolarHBondContact OD1-CA 3.5Å; D68-Q70 WeakPolarHBondContact OD1-CB 3.48Å; D68-Q70 PolarHBondContact OD1-N 2.96Å; D68-E71 HydrophobicContact CB-CB 4.22Å; D68-E71 WeakPolarHBondContact CB-O 3.36Å; D68-E71 CarbonylContact O-C 3.39Å; D68-E71 PolarHBondContact OD1-N 3.22Å; D68-Q72 WeakPolarHBondContact O-CA 3.46Å; D68-Q72 WeakPolarHBondContact O-CG 3.5Å; D68-Q72 PolarHBondContact O-N 3.31Å; D68-Q72 VanDerWaalsContact O-N 3.11Å; D68-M74 HydrophobicContact CB-CB 4.25Å; D68-M74 PolarHBondContact N-O 2.83Å; D68-Y76 HydrophobicContact CB-CD2 4.35Å; D68-Y76 HydrophobicContact CB-CE2 3.85Å
69	Q	94.7	Very high	96.5	Very high	154 Å²	154	74.6 Å²	74.6	72%	0.72	39%	0.387	S	S	*	.	S	Bend	trans	-70.4	-30.3	-178.3	-68.9	-173.9	-21.1	0	0	113.3
70	Q	95.8	Very high	96.5	Very high	188 Å²	188	72.3 Å²	72.3	88%	0.879	38%	0.376	S	S	*	.	S	Bend	trans	-89.2	-40.4	178.9	-59.2	-177.1	43.7	0	0	110.4	D68	D68-Q70 VanDerWaalsContact C-N 3.34Å; D68-Q70 PolarHBondContact O-N 3.25Å; D68-Q70 WeakPolarHBondContact OD1-CA 3.5Å; D68-Q70 WeakPolarHBondContact OD1-CB 3.48Å; D68-Q70 PolarHBondContact OD1-N 2.96Å
71	E	96.3	Very high	96.4	Very high	103 Å²	103	74.2 Å²	74.2	48%	0.481	39%	0.387	S	S	.	.	S	Bend	trans	-116	67.5	-179.9	-65.6	-160.8	112.2	0	0	111.1	D68 H73 M74	D68-E71 HydrophobicContact CB-CB 4.22Å; D68-E71 WeakPolarHBondContact CB-O 3.36Å; D68-E71 CarbonylContact O-C 3.39Å; D68-E71 PolarHBondContact OD1-N 3.22Å; E71-H73 PolarHBondContact O-N 3.45Å; E71-H73 IonicContact OE1-CE1 3.62Å; E71-M74 HydrophobicContact CB-CB 4.4Å; E71-M74 HydrophobicContact CB-CG 4.31Å; E71-M74 WeakPolarHBondContact O-CB 3.43Å; E71-M74 PolarHBondContact O-N 2.95Å
72	Q	95.6	Very high	96.4	Very high	134 Å²	134	73.3 Å²	73.3	63%	0.626	38%	0.383	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.4	-16.7	-174.1	-65.3	-172.7	-26.3	0	0	116.4	Y67 D68 M74	Y67-Q72 HydrophobicContact CD2-CG 4.13Å; Y67-Q72 HydrophobicContact CE2-CG 4.49Å; D68-Q72 WeakPolarHBondContact O-CA 3.46Å; D68-Q72 WeakPolarHBondContact O-CG 3.5Å; D68-Q72 PolarHBondContact O-N 3.31Å; D68-Q72 VanDerWaalsContact O-N 3.11Å; Q72-M74 VanDerWaalsContact C-N 3.3Å
73	H	94.6	Very high	96.4	Very high	48 Å²	48	69 Å²	69	22%	0.222	36%	0.363	C	S	.	.	T	Hydrogen-bonded Turn	trans	-75.2	-16.2	171.7	76.5	-67.1	0	0	0	113.9	E71 S92 V93 K94	E71-H73 PolarHBondContact O-N 3.45Å; E71-H73 IonicContact OE1-CE1 3.62Å; H73-S92 PolarHBondContact CD2-OG 3.35Å; H73-S92 VanDerWaalsContact CD2-OG 3.25Å; H73-S92 CarbonylContact O-C 3.59Å; H73-S92 WeakPolarHBondContact O-CA 3.43Å; H73-V93 WeakPolarHBondContact O-CG2 3.34Å; H73-V93 PolarHBondContact O-N 3.08Å; H73-K94 HydrophobicContact CB-CG 4.25Å; H73-K94 VanDerWaalsContact CD2-CD 3.47Å; H73-K94 WeakPolarHBondContact CD2-CD 3.32Å; H73-K94 VanDerWaalsContact CD2-CE 3.43Å; H73-K94 WeakPolarHBondContact CD2-CE 3.49Å; H73-K94 PolarHBondContact CD2-NZ 3.24Å; H73-K94 PolarHBondContact NE2-NZ 2.76Å
74	M	97.3	Very high	96.4	Very high	38 Å²	38	70 Å²	70	19%	0.187	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	130.2	175.1	-73.6	-64	-74.8	0	0	109.7	Y67 D68 E71 Q72 Y76	Y67-M74 CarbonylContact C-O 3.51Å; Y67-M74 WeakPolarHBondContact CA-O 3.47Å; D68-M74 HydrophobicContact CB-CB 4.25Å; D68-M74 PolarHBondContact N-O 2.83Å; E71-M74 HydrophobicContact CB-CB 4.4Å; E71-M74 HydrophobicContact CB-CG 4.31Å; E71-M74 WeakPolarHBondContact O-CB 3.43Å; E71-M74 PolarHBondContact O-N 2.95Å; Q72-M74 VanDerWaalsContact C-N 3.3Å; M74-Y76 HydrophobicContact CB-CE2 4.34Å
75	V	97.9	Very high	96.3	Very high	1 Å²	1	66.3 Å²	66.3	1%	0.006	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	124.6	177.2	179.1	0	0	0	0	108.5	I61 L66 S90 F91 V93	I61-V75 HydrophobicContact CD1-CG1 4.38Å; I61-V75 HydrophobicContact CD1-CG2 4.41Å; I61-V75 HydrophobicContact CG1-CG1 4.31Å; I61-V75 HydrophobicContact CG2-CG1 4.13Å; I61-V75 HydrophobicContact CG2-CG2 4Å; L66-V75 HydrophobicContact CB-CG1 3.9Å; L66-V75 CarbonylContact O-C 3.47Å; L66-V75 VanDerWaalsContact O-CA 3.29Å; L66-V75 WeakPolarHBondContact O-CA 3.41Å; V75-S90 CarbonylContact O-C 3.1Å; V75-S90 WeakPolarHBondContact O-CA 3.36Å; V75-S90 VanDerWaalsContact O-CB 3.23Å; V75-S90 WeakPolarHBondContact O-CB 3.47Å; V75-F91 HydrophobicContact CB-CD1 4.12Å; V75-F91 HydrophobicContact CB-CE1 3.71Å; V75-F91 HydrophobicContact CB-CE2 4.29Å; V75-F91 HydrophobicContact CB-CZ 3.81Å; V75-F91 HydrophobicContact CG1-CD1 4.33Å; V75-F91 HydrophobicContact CG1-CE1 3.59Å; V75-F91 HydrophobicContact CG1-CZ 3.88Å; V75-F91 HydrophobicContact CG2-CE1 4.38Å; V75-F91 HydrophobicContact CG2-CE2 4.2Å; V75-F91 HydrophobicContact CG2-CZ 3.95Å; V75-F91 PolarHBondContact N-O 2.73Å; V75-F91 PolarHBondContact O-N 2.82Å; V75-V93 HydrophobicContact CG2-CG2 3.98Å
76	Y	97.9	Very high	96.2	Very high	112 Å²	112	61.4 Å²	61.4	44%	0.439	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	110.7	174.6	-62.5	-76.1	0	0	0	109.3	L66 D68 M74	L66-Y76 PolarHBondContact O-N 2.72Å; D68-Y76 HydrophobicContact CB-CD2 4.35Å; D68-Y76 HydrophobicContact CB-CE2 3.85Å; M74-Y76 HydrophobicContact CB-CE2 4.34Å
77	C	96.8	Very high	96.1	Very high	0 Å²	0	63.6 Å²	63.6	0%	0	36%	0.356	C	S	.	.			trans	-121.5	12	-174	53.4	0	0	0	0	113.1	L66 G79 D80 L82 G83 Q89	L66-C77 HydrophobicContact CD1-CB 4.34Å; C77-G79 PolarHBondContact O-N 3.16Å; C77-D80 PolarHBondContact O-N 3.14Å; C77-L82 HydrophobicContact CB-CB 4.29Å; C77-L82 HydrophobicContact CB-CD2 4.43Å; C77-L82 HydrophobicContact CB-CG 4.36Å; C77-G83 WeakPolarHBondContact O-CA 3.39Å; C77-G83 PolarHBondContact O-N 3.02Å; C77-G83 VanDerWaalsContact SG-CA 3.53Å; C77-Q89 PolarHBondContact N-O 3.01Å
78	G	96	Very high	95.9	Very high	51 Å²	51	62 Å²	62	53%	0.526	36%	0.355	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.6	126.3	173.3	0	0	0	0	0	111.7	D80 Q89	G78-D80 VanDerWaalsContact C-N 3.25Å; G78-D80 PolarHBondContact O-N 3.31Å; G78-Q89 PolarHBondContact N-O 3.01Å; G78-Q89 VanDerWaalsContact N-O 3.09Å
79	G	94.9	Very high	95.9	Very high	83 Å²	83	67.4 Å²	67.4	86%	0.856	38%	0.378	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.8	3.5	-176.3	0	0	0	0	0	114.9	C77	C77-G79 PolarHBondContact O-N 3.16Å
80	D	97.1	Very high	96	Very high	18 Å²	18	62.4 Å²	62.4	10%	0.096	36%	0.36	C	S	.	.	S	Bend	trans	-104.1	153	168.2	-171.5	-88.6	0	0	0	110.6	Y60 K64 L66 C77 G78 L82 G83 D84	Y60-D80 WeakPolarHBondContact CE1-OD1 3.46Å; Y60-D80 VanDerWaalsContact OH-CG 3.26Å; Y60-D80 PolarHBondContact OH-OD1 2.93Å; Y60-D80 PolarHBondContact OH-OD2 3.27Å; K64-D80 IonicContact NZ-OD2 2.82Å; K64-D80 PolarHBondContact NZ-OD2 3.16Å; L66-D80 HydrophobicContact CD1-CB 4.44Å; L66-D80 HydrophobicContact CD2-CB 4.41Å; C77-D80 PolarHBondContact O-N 3.14Å; G78-D80 VanDerWaalsContact C-N 3.25Å; G78-D80 PolarHBondContact O-N 3.31Å; D80-L82 PolarHBondContact O-N 3.46Å; D80-L82 VanDerWaalsContact O-N 3.11Å; D80-L82 WeakPolarHBondContact OD1-CB 3.44Å; D80-L82 PolarHBondContact OD1-N 3.05Å; D80-G83 PolarHBondContact O-N 3.01Å; D80-D84 PolarHBondContact O-N 3.33Å; D80-D84 VanDerWaalsContact O-N 3.17Å
81	L	95.6	Very high	96	Very high	49 Å²	49	54.1 Å²	54.1	26%	0.257	32%	0.321	S	S	.	.	H	α-helix	trans	-54.4	-31.3	176.8	-174.1	62.4	0	0	0	112.6	K36 I37 L85	K36-L81 HydrophobicContact CB-CD2 4.1Å; I37-L81 HydrophobicContact CD1-CD2 4.35Å; I37-L81 HydrophobicContact CD1-CG 4.04Å; I37-L81 HydrophobicContact CG1-CB 4.35Å; I37-L81 HydrophobicContact CG1-CD2 3.62Å; I37-L81 HydrophobicContact CG1-CG 3.85Å; L81-L85 WeakPolarHBondContact O-CB 3.4Å; L81-L85 PolarHBondContact O-N 3.22Å
82	L	96.6	Very high	96	Very high	1 Å²	1	50.5 Å²	50.5	1%	0.005	31%	0.308	C	S	.	.	H	α-helix	trans	-63.6	-41.6	174.8	-177.5	61.3	0	0	0	112	I37 L57 Y60 I61 L66 C77 D80 L85 L86	I37-L82 HydrophobicContact CD1-CB 4.36Å; I37-L82 HydrophobicContact CD1-CD1 4.24Å; L57-L82 HydrophobicContact CD2-CD1 3.62Å; Y60-L82 HydrophobicContact CD1-CB 4.44Å; Y60-L82 HydrophobicContact CD1-CD2 4.24Å; Y60-L82 HydrophobicContact CE1-CB 3.96Å; Y60-L82 HydrophobicContact CE1-CD2 4.48Å; I61-L82 HydrophobicContact CD1-CD2 4.07Å; I61-L82 HydrophobicContact CG1-CD2 3.62Å; L66-L82 HydrophobicContact CD1-CD2 4.02Å; C77-L82 HydrophobicContact CB-CB 4.29Å; C77-L82 HydrophobicContact CB-CD2 4.43Å; C77-L82 HydrophobicContact CB-CG 4.36Å; D80-L82 PolarHBondContact O-N 3.46Å; D80-L82 VanDerWaalsContact O-N 3.11Å; D80-L82 WeakPolarHBondContact OD1-CB 3.44Å; D80-L82 PolarHBondContact OD1-N 3.05Å; L82-L85 PolarHBondContact O-N 3.03Å; L82-L86 HydrophobicContact CD1-CD1 3.97Å; L82-L86 HydrophobicContact CD1-CG 4.28Å; L82-L86 HydrophobicContact CG-CD1 3.81Å; L82-L86 WeakPolarHBondContact O-CB 3.38Å; L82-L86 WeakPolarHBondContact O-CD1 3.32Å; L82-L86 VanDerWaalsContact O-CG 3.22Å; L82-L86 WeakPolarHBondContact O-CG 3.49Å; L82-L86 PolarHBondContact O-N 2.94Å
83	G	96.1	Very high	95.9	Very high	5 Å²	5	48.2 Å²	48.2	5%	0.052	30%	0.302	C	S	.	.	H	α-helix	trans	-68.9	-40.7	177.8	0	0	0	0	0	112.3	C77 D80 L85 L86 G87 C88	C77-G83 WeakPolarHBondContact O-CA 3.39Å; C77-G83 PolarHBondContact O-N 3.02Å; C77-G83 VanDerWaalsContact SG-CA 3.53Å; D80-G83 PolarHBondContact O-N 3.01Å; G83-L85 VanDerWaalsContact C-N 3.27Å; G83-L85 PolarHBondContact O-N 3.26Å; G83-L86 PolarHBondContact O-N 2.76Å; G83-G87 WeakPolarHBondContact O-CA 3.35Å; G83-G87 PolarHBondContact O-N 3.42Å; G83-C88 WeakPolarHBondContact CA-O 3.45Å; G83-C88 PolarHBondContact O-N 2.96Å
84	D	95.3	Very high	95.9	Very high	118 Å²	118	53.5 Å²	53.5	63%	0.631	33%	0.325	S	S	*	.	H	α-helix	trans	-59.8	-39.6	174.1	-67.8	-22.8	0	0	0	111.6	D80	D80-D84 PolarHBondContact O-N 3.33Å; D80-D84 VanDerWaalsContact O-N 3.17Å
85	L	95.3	Very high	95.7	Very high	25 Å²	25	55.8 Å²	55.8	13%	0.131	34%	0.338	C	S	.	.	H	α-helix	trans	-74	-38.2	-179.9	-166.6	65.2	0	0	0	113	Q33 L34 I37 L81 L82 G83 M102 N106	Q33-L85 HydrophobicContact CB-CD1 3.76Å; L34-L85 HydrophobicContact CB-CD2 3.85Å; L34-L85 HydrophobicContact CD1-CD2 3.86Å; L34-L85 HydrophobicContact CG-CD2 4.41Å; I37-L85 HydrophobicContact CD1-CB 4.34Å; I37-L85 HydrophobicContact CD1-CD2 3.65Å; L81-L85 WeakPolarHBondContact O-CB 3.4Å; L81-L85 PolarHBondContact O-N 3.22Å; L82-L85 PolarHBondContact O-N 3.03Å; G83-L85 VanDerWaalsContact C-N 3.27Å; G83-L85 PolarHBondContact O-N 3.26Å; L85-M102 HydrophobicContact CB-CG 4.48Å; L85-M102 HydrophobicContact CD2-CE 4.35Å; L85-M102 HydrophobicContact CD2-CG 4.14Å; L85-M102 HydrophobicContact CD2-SD 3.57Å; L85-M102 VanDerWaalsContact CD2-SD 3.57Å; L85-M102 HydrophobicContact CG-CG 3.76Å; L85-M102 HydrophobicContact CG-SD 3.87Å; L85-M102 WeakPolarHBondContact O-CG 3.19Å; L85-N106 WeakPolarHBondContact CD1-OD1 3.45Å
86	L	94.1	Very high	95.2	Very high	25 Å²	25	57.9 Å²	57.9	13%	0.131	35%	0.351	C	S	.	.	H	α-helix	trans	-73.5	-29.5	175.8	-71.3	165.7	0	0	0	111.9	L82 G83 C88 F91 P98 M102	L82-L86 HydrophobicContact CD1-CD1 3.97Å; L82-L86 HydrophobicContact CD1-CG 4.28Å; L82-L86 HydrophobicContact CG-CD1 3.81Å; L82-L86 WeakPolarHBondContact O-CB 3.38Å; L82-L86 WeakPolarHBondContact O-CD1 3.32Å; L82-L86 VanDerWaalsContact O-CG 3.22Å; L82-L86 WeakPolarHBondContact O-CG 3.49Å; L82-L86 PolarHBondContact O-N 2.94Å; G83-L86 PolarHBondContact O-N 2.76Å; L86-C88 VanDerWaalsContact C-N 3.33Å; L86-F91 HydrophobicContact CD1-CD1 3.6Å; L86-F91 HydrophobicContact CD1-CE1 3.42Å; L86-F91 VanDerWaalsContact CD1-CE1 3.42Å; L86-F91 HydrophobicContact CD1-CZ 4.34Å; L86-P98 WeakPolarHBondContact CD2-O 3.49Å; L86-M102 HydrophobicContact CD2-CB 3.63Å; L86-M102 HydrophobicContact CD2-CE 4.22Å; L86-M102 HydrophobicContact CD2-CG 3.95Å; L86-M102 HydrophobicContact CG-CG 4.41Å
87	G	94.4	Very high	95	Very high	70 Å²	70	55.3 Å²	55.3	72%	0.722	35%	0.35	S	S	*	.	T	Hydrogen-bonded Turn	trans	74.1	23.2	-171.4	0	0	0	0	0	113.1	G83	G83-G87 WeakPolarHBondContact O-CA 3.35Å; G83-G87 PolarHBondContact O-N 3.42Å
88	C	94.8	Very high	94.8	Very high	37 Å²	37	57.2 Å²	57.2	25%	0.25	36%	0.362	C	S	.	.	S	Bend	trans	-137.7	156.4	176.6	70.4	0	0	0	0	111.4	G83 L86 S90	G83-C88 WeakPolarHBondContact CA-O 3.45Å; G83-C88 PolarHBondContact O-N 2.96Å; L86-C88 VanDerWaalsContact C-N 3.33Å; C88-S90 PolarHBondContact SG-O 3.02Å; C88-S90 VanDerWaalsContact SG-O 3.35Å
89	Q	96.6	Very high	94.6	Very high	156 Å²	156	55.6 Å²	55.6	73%	0.729	34%	0.341	S	S	*	.	S	Bend	trans	-83.7	-24.2	177.4	-66.3	-177.2	80.5	0	0	112.4	C77 G78	C77-Q89 PolarHBondContact N-O 3.01Å; G78-Q89 PolarHBondContact N-O 3.01Å; G78-Q89 VanDerWaalsContact N-O 3.09Å
90	S	96.6	Very high	94.5	Very high	49 Å²	49	57 Å²	57	34%	0.343	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.4	158	179.6	58.7	0	0	0	0	111.3	V75 C88	V75-S90 CarbonylContact O-C 3.1Å; V75-S90 WeakPolarHBondContact O-CA 3.36Å; V75-S90 VanDerWaalsContact O-CB 3.23Å; V75-S90 WeakPolarHBondContact O-CB 3.47Å; C88-S90 PolarHBondContact SG-O 3.02Å; C88-S90 VanDerWaalsContact SG-O 3.35Å
91	F	96.7	Very high	94.3	Very high	13 Å²	13	59.4 Å²	59.4	6%	0.057	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.7	162	170.3	67.8	-83.9	0	0	0	110.9	I61 V75 L86 V93 P98	I61-F91 HydrophobicContact CD1-CZ 3.99Å; V75-F91 HydrophobicContact CB-CD1 4.12Å; V75-F91 HydrophobicContact CB-CE1 3.71Å; V75-F91 HydrophobicContact CB-CE2 4.29Å; V75-F91 HydrophobicContact CB-CZ 3.81Å; V75-F91 HydrophobicContact CG1-CD1 4.33Å; V75-F91 HydrophobicContact CG1-CE1 3.59Å; V75-F91 HydrophobicContact CG1-CZ 3.88Å; V75-F91 HydrophobicContact CG2-CE1 4.38Å; V75-F91 HydrophobicContact CG2-CE2 4.2Å; V75-F91 HydrophobicContact CG2-CZ 3.95Å; V75-F91 PolarHBondContact N-O 2.73Å; V75-F91 PolarHBondContact O-N 2.82Å; L86-F91 HydrophobicContact CD1-CD1 3.6Å; L86-F91 HydrophobicContact CD1-CE1 3.42Å; L86-F91 VanDerWaalsContact CD1-CE1 3.42Å; L86-F91 HydrophobicContact CD1-CZ 4.34Å; F91-V93 HydrophobicContact CE2-CG2 4.43Å; F91-P98 HydrophobicContact CB-CB 4.37Å; F91-P98 HydrophobicContact CB-CG 4.16Å
92	S	96.3	Very high	94.2	Very high	28 Å²	28	57.2 Å²	57.2	20%	0.196	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	130.6	176	-178	0	0	0	0	110.1	H73 K94 D95	H73-S92 PolarHBondContact CD2-OG 3.35Å; H73-S92 VanDerWaalsContact CD2-OG 3.25Å; H73-S92 CarbonylContact O-C 3.59Å; H73-S92 WeakPolarHBondContact O-CA 3.43Å; S92-K94 PolarHBondContact O-N 3.27Å; S92-K94 PolarHBondContact OG-N 3.39Å; S92-D95 CarbonylContact O-C 3.59Å; S92-D95 WeakPolarHBondContact O-CA 3.37Å; S92-D95 PolarHBondContact O-N 3.19Å
93	V	93.6	Very high	94	Very high	85 Å²	85	57.5 Å²	57.5	52%	0.515	33%	0.325	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.6	-22	171.9	178.6	0	0	0	0	111.3	H73 V75 F91 D95	H73-V93 WeakPolarHBondContact O-CG2 3.34Å; H73-V93 PolarHBondContact O-N 3.08Å; V75-V93 HydrophobicContact CG2-CG2 3.98Å; F91-V93 HydrophobicContact CE2-CG2 4.43Å; V93-D95 VanDerWaalsContact C-N 3.27Å
94	K	94.3	Very high	93.7	Very high	159 Å²	159	66.2 Å²	66.2	69%	0.691	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.3	-25.4	172.2	-64.3	178	-175.5	156.1	0	112.4	H73 S92 P96	H73-K94 HydrophobicContact CB-CG 4.25Å; H73-K94 VanDerWaalsContact CD2-CD 3.47Å; H73-K94 WeakPolarHBondContact CD2-CD 3.32Å; H73-K94 VanDerWaalsContact CD2-CE 3.43Å; H73-K94 WeakPolarHBondContact CD2-CE 3.49Å; H73-K94 PolarHBondContact CD2-NZ 3.24Å; H73-K94 PolarHBondContact NE2-NZ 2.76Å; S92-K94 PolarHBondContact O-N 3.27Å; S92-K94 PolarHBondContact OG-N 3.39Å; K94-P96 WeakPolarHBondContact O-CD 3.14Å
95	D	92.8	Very high	93.6	Very high	86 Å²	86	67.5 Å²	67.5	46%	0.46	36%	0.356	S	S	.	.	S	Bend	trans	-120.4	82.2	173.1	-179.3	17.5	0	0	0	110	S92 V93 S97 P98	S92-D95 CarbonylContact O-C 3.59Å; S92-D95 WeakPolarHBondContact O-CA 3.37Å; S92-D95 PolarHBondContact O-N 3.19Å; V93-D95 VanDerWaalsContact C-N 3.27Å; D95-S97 PolarHBondContact O-N 3.12Å; D95-S97 VanDerWaalsContact O-N 3.08Å; D95-S97 VanDerWaalsContact OD1-CB 3.3Å; D95-S97 WeakPolarHBondContact OD1-CB 3.38Å; D95-S97 PolarHBondContact OD1-N 3.07Å; D95-S97 PolarHBondContact OD1-OG 3.29Å; D95-P98 WeakPolarHBondContact O-CD 3.38Å
96	P	87.1	Confident	93.5	Very high	45 Å²	45	67.2 Å²	67.2	29%	0.292	35%	0.354	S	S	.	.			trans	-74.6	6.2	-175.6	32.5	-38	0	0	0	113.7	K94 P98 L99 Y100	K94-P96 WeakPolarHBondContact O-CD 3.14Å; P96-P98 VanDerWaalsContact C-CD 3.46Å; P96-L99 WeakPolarHBondContact O-CB 3.19Å; P96-L99 PolarHBondContact O-N 2.95Å; P96-Y100 HydrophobicContact CB-CD2 4.02Å; P96-Y100 HydrophobicContact CB-CE2 3.72Å; P96-Y100 HydrophobicContact CG-CD2 4.09Å; P96-Y100 HydrophobicContact CG-CE2 3.6Å; P96-Y100 WeakPolarHBondContact O-CD2 3.32Å; P96-Y100 PolarHBondContact O-N 2.65Å
97	S	93.4	Very high	93.3	Very high	58 Å²	58	67.4 Å²	67.4	41%	0.406	36%	0.355	S	S	.	.	H	α-helix	trans	-52.3	-45.6	-178.1	-53.6	0	0	0	0	113.5	D95 L99 Y100 D101	D95-S97 PolarHBondContact O-N 3.12Å; D95-S97 VanDerWaalsContact O-N 3.08Å; D95-S97 VanDerWaalsContact OD1-CB 3.3Å; D95-S97 WeakPolarHBondContact OD1-CB 3.38Å; D95-S97 PolarHBondContact OD1-N 3.07Å; D95-S97 PolarHBondContact OD1-OG 3.29Å; S97-L99 PolarHBondContact O-N 2.68Å; S97-Y100 PolarHBondContact O-N 3.46Å; S97-D101 PolarHBondContact O-N 3.33Å
98	P	92.8	Very high	93.1	Very high	41 Å²	41	68 Å²	68	27%	0.266	35%	0.345	S	S	.	.	H	α-helix	trans	-58.7	-37.1	176.8	-24.2	35.9	0	0	0	113	L86 F91 D95 P96 M102	L86-P98 WeakPolarHBondContact CD2-O 3.49Å; F91-P98 HydrophobicContact CB-CB 4.37Å; F91-P98 HydrophobicContact CB-CG 4.16Å; D95-P98 WeakPolarHBondContact O-CD 3.38Å; P96-P98 VanDerWaalsContact C-CD 3.46Å; P98-M102 WeakPolarHBondContact O-CB 3.34Å; P98-M102 PolarHBondContact O-N 3.41Å
99	L	92.6	Very high	92.6	Very high	16 Å²	16	70.6 Å²	70.6	8%	0.084	36%	0.36	C	S	.	.	H	α-helix	trans	-68.9	-47.3	178.8	-171	153.5	0	0	0	110.6	M54 P96 S97 D101 M102 L103	M54-L99 HydrophobicContact CE-CD2 3.88Å; M54-L99 HydrophobicContact SD-CD2 3.43Å; M54-L99 WeakPolarHBondContact SD-CD2 3.48Å; P96-L99 WeakPolarHBondContact O-CB 3.19Å; P96-L99 PolarHBondContact O-N 2.95Å; S97-L99 PolarHBondContact O-N 2.68Å; L99-D101 VanDerWaalsContact C-N 3.33Å; L99-D101 PolarHBondContact O-N 3.16Å; L99-M102 PolarHBondContact O-N 3.29Å; L99-L103 HydrophobicContact CD2-CD1 3.57Å; L99-L103 HydrophobicContact CD2-CG 3.99Å; L99-L103 WeakPolarHBondContact O-CG 3.47Å; L99-L103 PolarHBondContact O-N 3.09Å
100	Y	92	Very high	91.3	Very high	112 Å²	112	64.9 Å²	64.9	44%	0.439	34%	0.337	S	S	.	.	H	α-helix	trans	-63.7	-37.6	178.1	-72.3	-56.6	0	0	0	112.9	M54 P96 S97 L103 R104	M54-Y100 HydrophobicContact CE-CE1 4.36Å; M54-Y100 HydrophobicContact SD-CE1 4.42Å; P96-Y100 HydrophobicContact CB-CD2 4.02Å; P96-Y100 HydrophobicContact CB-CE2 3.72Å; P96-Y100 HydrophobicContact CG-CD2 4.09Å; P96-Y100 HydrophobicContact CG-CE2 3.6Å; P96-Y100 WeakPolarHBondContact O-CD2 3.32Å; P96-Y100 PolarHBondContact O-N 2.65Å; S97-Y100 PolarHBondContact O-N 3.46Å; Y100-L103 HydrophobicContact CD1-CD1 4.36Å; Y100-L103 PolarHBondContact O-N 2.86Å; Y100-R104 WeakPolarHBondContact O-CG 3.21Å; Y100-R104 PolarHBondContact O-N 3.37Å
101	D	92.8	Very high	89.5	Confident	69 Å²	69	66.9 Å²	66.9	37%	0.369	36%	0.356	S	S	.	.	H	α-helix	trans	-67.8	-37.7	176.4	-74.4	-18.6	0	0	0	112.2	S97 L99 R104 K105	S97-D101 PolarHBondContact O-N 3.33Å; L99-D101 VanDerWaalsContact C-N 3.33Å; L99-D101 PolarHBondContact O-N 3.16Å; D101-R104 IonicContact OD1-CZ 3.96Å; D101-R104 IonicContact OD1-NH1 2.95Å; D101-R104 PolarHBondContact OD1-NH1 3.4Å; D101-K105 WeakPolarHBondContact O-CG 3.43Å; D101-K105 PolarHBondContact O-N 2.88Å
102	M	94.9	Very high	87.4	Confident	4 Å²	4	71.3 Å²	71.3	2%	0.02	39%	0.389	C	S	.	.	H	α-helix	trans	-63	-44.8	171.5	177.6	-76.2	-72.2	0	0	111.4	L34 L57 L85 L86 P98 L99 R104 K105 N106	L34-M102 HydrophobicContact CD1-CE 4.24Å; L34-M102 HydrophobicContact CD1-SD 4.24Å; L34-M102 HydrophobicContact CD2-SD 4.37Å; L57-M102 HydrophobicContact CD1-CE 4.2Å; L57-M102 HydrophobicContact CD2-CE 4.17Å; L85-M102 HydrophobicContact CB-CG 4.48Å; L85-M102 HydrophobicContact CD2-CE 4.35Å; L85-M102 HydrophobicContact CD2-CG 4.14Å; L85-M102 HydrophobicContact CD2-SD 3.57Å; L85-M102 VanDerWaalsContact CD2-SD 3.57Å; L85-M102 HydrophobicContact CG-CG 3.76Å; L85-M102 HydrophobicContact CG-SD 3.87Å; L85-M102 WeakPolarHBondContact O-CG 3.19Å; L86-M102 HydrophobicContact CD2-CB 3.63Å; L86-M102 HydrophobicContact CD2-CE 4.22Å; L86-M102 HydrophobicContact CD2-CG 3.95Å; L86-M102 HydrophobicContact CG-CG 4.41Å; P98-M102 WeakPolarHBondContact O-CB 3.34Å; P98-M102 PolarHBondContact O-N 3.41Å; L99-M102 PolarHBondContact O-N 3.29Å; M102-R104 PolarHBondContact O-N 2.78Å; M102-K105 PolarHBondContact O-N 3.4Å; M102-K105 VanDerWaalsContact O-N 3.14Å; M102-N106 WeakPolarHBondContact CG-ND2 3.47Å; M102-N106 WeakPolarHBondContact O-CB 3.39Å; M102-N106 PolarHBondContact O-N 3.49Å; M102-N106 PolarHBondContact O-ND2 2.97Å; M102-N106 HydrophobicContact SD-CB 4.11Å
103	L	92.4	Very high	85	Confident	7 Å²	7	77 Å²	77	4%	0.037	42%	0.416	C	S	.	.	H	α-helix	trans	-60	-47	178.4	-72.4	-177.8	0	0	0	111.7	L34 V53 M54 L57 L99 Y100 K105 N106 L107	L34-L103 HydrophobicContact CD2-CD2 3.95Å; V53-L103 HydrophobicContact CG1-CD2 3.51Å; M54-L103 HydrophobicContact SD-CD1 3.71Å; L57-L103 HydrophobicContact CD1-CD2 3.89Å; L99-L103 HydrophobicContact CD2-CD1 3.57Å; L99-L103 HydrophobicContact CD2-CG 3.99Å; L99-L103 WeakPolarHBondContact O-CG 3.47Å; L99-L103 PolarHBondContact O-N 3.09Å; Y100-L103 HydrophobicContact CD1-CD1 4.36Å; Y100-L103 PolarHBondContact O-N 2.86Å; L103-K105 PolarHBondContact O-N 2.84Å; L103-K105 VanDerWaalsContact O-N 3.16Å; L103-N106 PolarHBondContact O-N 2.98Å; L103-L107 HydrophobicContact CB-CD1 3.81Å; L103-L107 HydrophobicContact CB-CG 4.5Å; L103-L107 HydrophobicContact CD2-CD1 4.16Å; L103-L107 HydrophobicContact CG-CD1 4.47Å; L103-L107 WeakPolarHBondContact O-CB 3.32Å; L103-L107 WeakPolarHBondContact O-CD1 3.3Å; L103-L107 WeakPolarHBondContact O-CG 3.3Å; L103-L107 PolarHBondContact O-N 3.09Å
104	R	90.1	Very high	82.7	Confident	188 Å²	188	79.5 Å²	79.5	71%	0.709	43%	0.426	S	S	*	.	H	α-helix	trans	-56.4	-34	176.9	-71.2	167.6	-177.7	165.2	-4.3	112.8	Y100 D101 M102	Y100-R104 WeakPolarHBondContact O-CG 3.21Å; Y100-R104 PolarHBondContact O-N 3.37Å; D101-R104 IonicContact OD1-CZ 3.96Å; D101-R104 IonicContact OD1-NH1 2.95Å; D101-R104 PolarHBondContact OD1-NH1 3.4Å; M102-R104 PolarHBondContact O-N 2.78Å
105	K	91.6	Very high	80.3	Confident	144 Å²	144	77.5 Å²	77.5	63%	0.626	43%	0.428	S	S	*	.	H	α-helix	trans	-81.8	-23.1	178.7	-66.6	168.8	-173	171.7	0	113.2	K31 D101 M102 L103	K31-K105 WeakPolarHBondContact CE-O 3.48Å; K31-K105 PolarHBondContact NZ-O 2.99Å; D101-K105 WeakPolarHBondContact O-CG 3.43Å; D101-K105 PolarHBondContact O-N 2.88Å; M102-K105 PolarHBondContact O-N 3.4Å; M102-K105 VanDerWaalsContact O-N 3.14Å; L103-K105 PolarHBondContact O-N 2.84Å; L103-K105 VanDerWaalsContact O-N 3.16Å
106	N	92.9	Very high	78.1	Confident	19 Å²	19	76.4 Å²	76.4	10%	0.102	44%	0.437	C	S	.	.	H	α-helix	trans	-112	0.5	-169.3	-74.1	-68.4	0	0	0	115.1	P30 K31 L34 L85 M102 L103	P30-N106 CarbonylContact C-O 3.47Å; P30-N106 WeakPolarHBondContact CA-O 3.34Å; K31-N106 PolarHBondContact N-O 2.77Å; L34-N106 HydrophobicContact CB-CB 4.14Å; L34-N106 HydrophobicContact CD2-CB 3.88Å; L85-N106 WeakPolarHBondContact CD1-OD1 3.45Å; M102-N106 WeakPolarHBondContact CG-ND2 3.47Å; M102-N106 WeakPolarHBondContact O-CB 3.39Å; M102-N106 PolarHBondContact O-N 3.49Å; M102-N106 PolarHBondContact O-ND2 2.97Å; M102-N106 HydrophobicContact SD-CB 4.11Å; L103-N106 PolarHBondContact O-N 2.98Å
107	L	91.7	Very high	75.8	Confident	29 Å²	29	79.4 Å²	79.4	15%	0.152	46%	0.459	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	140.3	179.1	-60.4	168.9	0	0	0	111.1	V28 P30 L34 M50 V53 L103	V28-L107 HydrophobicContact CB-CB 4.39Å; V28-L107 HydrophobicContact CB-CD2 4.25Å; V28-L107 HydrophobicContact CG2-CD2 3.88Å; P30-L107 HydrophobicContact CB-CD2 4.15Å; P30-L107 HydrophobicContact CG-CD2 3.94Å; L34-L107 HydrophobicContact CD2-CD2 3.76Å; L34-L107 HydrophobicContact CD2-CG 4.37Å; M50-L107 HydrophobicContact CE-CD1 3.28Å; M50-L107 HydrophobicContact CE-CD2 4.09Å; M50-L107 HydrophobicContact CE-CG 4.3Å; M50-L107 HydrophobicContact SD-CD1 3.32Å; M50-L107 WeakPolarHBondContact SD-CD1 3.48Å; V53-L107 HydrophobicContact CG2-CD2 4.45Å; L103-L107 HydrophobicContact CB-CD1 3.81Å; L103-L107 HydrophobicContact CB-CG 4.5Å; L103-L107 HydrophobicContact CD2-CD1 4.16Å; L103-L107 HydrophobicContact CG-CD1 4.47Å; L103-L107 WeakPolarHBondContact O-CB 3.32Å; L103-L107 WeakPolarHBondContact O-CD1 3.3Å; L103-L107 WeakPolarHBondContact O-CG 3.3Å; L103-L107 PolarHBondContact O-N 3.09Å
108	V	90.1	Very high	73.7	Confident	82 Å²	82	84.6 Å²	84.6	50%	0.497	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	119.7	168	-177.5	0	0	0	0	107.7	V28 R29 S110	V28-V108 WeakPolarHBondContact CA-O 3.41Å; R29-V108 PolarHBondContact N-O 2.93Å; R29-V108 PolarHBondContact O-N 3.06Å; V108-S110 PolarHBondContact O-N 2.91Å
109	T	83.5	Confident	71.3	Confident	92 Å²	92	92.9 Å²	92.9	56%	0.564	50%	0.504	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-67.1	121.6	174.7	-51.4	0	0	0	0	108.9
110	S	69.6	Low	69	Low	36 Å²	36	95.5 Å²	95.5	25%	0.252	54%	0.535	S	S	.	.	P	Polyproline II helix	trans	-75.4	132.1	168.3	64.2	0	0	0	0	108.3	Q27 V108 S112	Q27-S110 VanDerWaalsContact CB-OG 3.3Å; Q27-S110 WeakPolarHBondContact CB-OG 3.39Å; Q27-S110 PolarHBondContact O-N 3.3Å; Q27-S110 PolarHBondContact O-OG 2.98Å; V108-S110 PolarHBondContact O-N 2.91Å; S110-S112 PolarHBondContact O-N 2.89Å; S110-S112 VanDerWaalsContact O-N 3.12Å
111	A	58.8	Low	66.4	Low	91 Å²	91	100.2 Å²	100.2	75%	0.752	56%	0.558	S	S	*	*	P	Polyproline II helix	trans	-56	123.1	175.4	0	0	0	0	0	108.2	I113	A111-I113 PolarHBondContact O-N 3.07Å; A111-I113 VanDerWaalsContact O-N 3.09Å
112	S	52	Low	64.2	Low	107 Å²	107	101.5 Å²	101.5	75%	0.748	57%	0.572	S	S	*	*	P	Polyproline II helix	trans	-55	120.3	170.8	-176.9	0	0	0	0	107.3	S110 N114	S110-S112 PolarHBondContact O-N 2.89Å; S110-S112 VanDerWaalsContact O-N 3.12Å; S112-N114 PolarHBondContact O-N 3.14Å
113	I	46.1	Very low	61.8	Low	147 Å²	147	110.8 Å²	110.8	75%	0.754	61%	0.613	S	S	*	*			trans	-68.5	93.9	165.7	-52.3	174.8	0	0	0	104.4	A111 T115	A111-I113 PolarHBondContact O-N 3.07Å; A111-I113 VanDerWaalsContact O-N 3.09Å; I113-T115 HydrophobicContact CG2-CG2 3.91Å; I113-T115 PolarHBondContact O-N 3.22Å
114	N	44.5	Very low	59.3	Low	137 Å²	137	116.1 Å²	116.1	73%	0.733	65%	0.65	S	S	*	*			trans	-68.5	83.3	166.8	-169.3	-18.4	0	0	0	106.4	S112 G116	S112-N114 PolarHBondContact O-N 3.14Å; N114-G116 VanDerWaalsContact C-N 3.35Å; N114-G116 PolarHBondContact O-N 3.28Å
115	T	44.7	Very low	57.5	Low	118 Å²	118	118.7 Å²	118.7	72%	0.724	66%	0.66	S	S	*	*			trans	-64.4	103.4	165.8	44.7	0	0	0	0	106.4	I113 S117	I113-T115 HydrophobicContact CG2-CG2 3.91Å; I113-T115 PolarHBondContact O-N 3.22Å; T115-S117 PolarHBondContact O-N 3.15Å
116	G	46.1	Very low	55	Low	63 Å²	63	117.9 Å²	117.9	65%	0.649	67%	0.669	S	S	*	*			trans	-57	133.5	-168.8	0	0	0	0	0	113.9	N114	N114-G116 VanDerWaalsContact C-N 3.35Å; N114-G116 PolarHBondContact O-N 3.28Å
117	S	38.6	Very low	52.9	Low	108 Å²	108	123.3 Å²	123.3	76%	0.755	70%	0.703	S	S	*	*			trans	-89.6	98.5	151.5	-77.6	0	0	0	0	108.4	T115 Y119	T115-S117 PolarHBondContact O-N 3.15Å; S117-Y119 PolarHBondContact O-N 3.38Å
118	H	50	Low	50.6	Low	166 Å²	166	131.4 Å²	131.4	77%	0.769	74%	0.74	S	S	*	*			trans	-55.3	109.3	164	168.9	-80.9	0	0	0	111.1
119	Y	41.9	Very low	48.5	Very low	216 Å²	216	132 Å²	132	85%	0.847	76%	0.755	S	S	*	*			trans	-139.8	119.2	147.3	-63.2	-79.2	0	0	0	108.2	S117	S117-Y119 PolarHBondContact O-N 3.38Å
120	G	44.8	Very low	46.6	Very low	71 Å²	71	138.5 Å²	138.5	73%	0.732	77%	0.769	S	S	*	*			trans	-72.6	158.3	-164.4	0	0	0	0	0	115.7
121	F	36.9	Very low	45.3	Very low	211 Å²	211	142.7 Å²	142.7	93%	0.925	80%	0.796	S	S	*	*			trans	-140.7	125.7	152.2	-165.9	-102.9	0	0	0	109.8
122	S	46.2	Very low	44.3	Very low	96 Å²	96	144.2 Å²	144.2	67%	0.671	79%	0.792	S	S	*	*			trans	-72.9	146.2	-174.9	-63.1	0	0	0	0	112.8
123	K	45.3	Very low	44	Very low	199 Å²	199	149.4 Å²	149.4	87%	0.865	80%	0.795	S	S	*	*			trans	43.6	114.5	147.5	-74.5	176.3	175.1	175.4	0	118.3
124	S	39.9	Very low	43.9	Very low	119 Å²	119	150.3 Å²	150.3	83%	0.832	80%	0.8	S	S	*	*				-178.2	136.1	102.2	41	0	0	0	0	111.5
125	R	51.8	Low	44.1	Very low	241 Å²	241	151.4 Å²	151.4	91%	0.909	81%	0.805	S	S	*	*	P	Polyproline II helix	trans	-75.7	140.7	170.1	-70.6	179.1	179.6	-153.8	-0.8	109.2
126	P	40.6	Very low	44.2	Very low	127 Å²	127	153.6 Å²	153.6	83%	0.825	81%	0.807	S	S	*	*	P	Polyproline II helix	trans	-94.4	120.9	153.1	6	13.8	0	0	0	109.1
127	T	47	Very low	44.1	Very low	133 Å²	133	156.3 Å²	156.3	82%	0.816	82%	0.816	S	S	*	*	P	Polyproline II helix	trans	-62.7	141.4	171.2	-4.6	0	0	0	0	111.2	A129	T127-A129 PolarHBondContact O-N 3.27Å
128	E	44.3	Very low	44.4	Very low	199 Å²	199	160.3 Å²	160.3	93%	0.93	82%	0.823	S	S	*	*			trans	-43.5	122.1	161.9	-87.5	174.7	110.5	0	0	111.8
129	A	45.4	Very low	44.2	Very low	96 Å²	96	161.1 Å²	161.1	79%	0.793	82%	0.824	S	S	*	*			trans	-128.3	79.2	163.4	0	0	0	0	0	109.3	T127 C131	T127-A129 PolarHBondContact O-N 3.27Å; A129-C131 PolarHBondContact O-N 3.3Å
130	R	44.7	Very low	44.4	Very low	227 Å²	227	159.7 Å²	159.7	86%	0.857	82%	0.822	S	S	*	*			trans	22.4	88.7	136.7	-162.3	174.6	-172.5	168.8	1.6	115.5	N132	R130-N132 PolarHBondContact O-N 3.13Å; R130-N132 VanDerWaalsContact O-N 3.13Å
131	C	41	Very low	44.1	Very low	124 Å²	124	166.7 Å²	166.7	84%	0.838	84%	0.843	S	S	*	*			trans	-63.4	105.9	158.5	-171.6	0	0	0	0	108.6	A129	A129-C131 PolarHBondContact O-N 3.3Å
132	N	38.9	Very low	44.4	Very low	123 Å²	123	164.5 Å²	164.5	66%	0.658	84%	0.839	S	S	*	*			trans	-167.2	119.7	158.1	-98.7	-46.6	0	0	0	113.1	R130	R130-N132 PolarHBondContact O-N 3.13Å; R130-N132 VanDerWaalsContact O-N 3.13Å
133	R	45.4	Very low	44.3	Very low	216 Å²	216	168.1 Å²	168.1	82%	0.815	85%	0.848	S	S	*	*			trans	72.7	104.7	138.4	-155.8	-168.5	-59.5	172.3	-0.2	117.3
134	I	43.7	Very low	44.3	Very low	166 Å²	166	166.4 Å²	166.4	85%	0.851	85%	0.847	S	S	*	*				-149.6	96.2	123.2	-80.9	132.4	0	0	0	106.5
135	L	48.3	Very low	44.5	Very low	160 Å²	160	169.2 Å²	169.2	84%	0.838	85%	0.848	S	S	*	*			trans	-89.9	145.7	146.8	-132.9	102.4	0	0	0	105.5
136	Q	47.3	Very low	44.1	Very low	165 Å²	165	164.7 Å²	164.7	77%	0.771	84%	0.844	S	S	*	*			trans	97.9	94.1	169.9	-50.4	-118.7	51.1	0	0	116
137	S	43.4	Very low	44.3	Very low	120 Å²	120	167.2 Å²	167.2	84%	0.839	85%	0.845	S	S	*	*				-166.3	91.3	119.9	-86.3	0	0	0	0	110.7
138	Q	45.5	Very low	44.1	Very low	191 Å²	191	169.6 Å²	169.6	89%	0.893	85%	0.847	S	S	*	*			trans	-130.2	80.4	155.4	-83.2	-73	17.6	0	0	107.1
139	K	46.1	Very low	44.1	Very low	183 Å²	183	167.4 Å²	167.4	80%	0.796	84%	0.841	S	S	*	*			trans	-170.1	125.9	157.9	-150.5	171.6	175.4	77.4	0	112.7
140	K	46	Very low	44	Very low	186 Å²	186	173.3 Å²	173.3	81%	0.809	85%	0.845	S	S	*	*			trans	63.7	125.6	158.5	-90	175.8	160.8	-178	0	115.4
141	N	37.6	Very low	43.9	Very low	219 Å²	219	168.5 Å²	168.5	100%	1.171	84%	0.843	S	S	*	*			cis	-158.5	0	48.9	-168.8	85.7	0	0	0	111

Retrieved 141 of 141 residues in 52.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).