A0A087WQ96_MOUSE Loading...

EEF1A lysine methyltransferase 2

AlphaFold DB , UniProt , Accession A0A087WQ96, Species MOUSE (Mus musculus, Mouse), Gene Eef1akmt2, Length 104 aa.

						>A0A087WQ96_MOUSE|A0A087WQ96|Eef1akmt2
MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVGETWFL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.8	Very low	40.3	Very low	234 Å²	234	133.4 Å²	133.4	100%	1.153	83%	0.827	S	S	*	*				0	135.8	0	-76.5	163.6	169.1	0	0	107.3
2	N	34.8	Very low	40.9	Very low	162 Å²	162	133.4 Å²	133.4	87%	0.866	83%	0.826	S	S	*	*			trans	84.7	94.4	-172.5	-49.9	-14.8	0	0	0	112.4
3	A	37.6	Very low	42.1	Very low	84 Å²	84	132.8 Å²	132.8	69%	0.694	82%	0.821	S	S	*	*			cis	78.9	101.1	47.1	0	0	0	0	0	113.8
4	D	41.4	Very low	42	Very low	156 Å²	156	131.1 Å²	131.1	83%	0.834	81%	0.813	S	S	*	*			trans	63	121.1	136.7	-45	-36	0	0	0	122.4
5	A	42.3	Very low	42.6	Very low	106 Å²	106	128.5 Å²	128.5	88%	0.876	81%	0.81	S	S	*	*			trans	-152.1	115.1	134.5	0	0	0	0	0	109.5
6	E	40.1	Very low	42.9	Very low	197 Å²	197	132.1 Å²	132.1	92%	0.921	81%	0.813	S	S	*	*			trans	-70.6	159.3	178.1	-63.1	-176.6	120	0	0	113.4
7	G	37.3	Very low	43.6	Very low	62 Å²	62	130 Å²	130	64%	0.639	81%	0.805	S	S	*	*				102.5	100	129.8	0	0	0	0	0	117.3
8	H	40.3	Very low	44.2	Very low	190 Å²	190	129.6 Å²	129.6	88%	0.88	80%	0.804	S	S	*	*				164.9	88.9	117.5	-94.9	76.2	0	0	0	108.9	G10	H8-G10 VanDerWaalsContact C-N 3.3Å; H8-G10 PolarHBondContact O-N 3.5Å; H8-G10 VanDerWaalsContact O-N 3.07Å
9	S	44.8	Very low	44.6	Very low	128 Å²	128	132.5 Å²	132.5	90%	0.895	81%	0.808	S	S	*	*			trans	-76.6	92.4	161.1	-172.9	0	0	0	0	106.9	A11	S9-A11 PolarHBondContact O-N 3.29Å; S9-A11 VanDerWaalsContact O-N 3.07Å
10	G	40.5	Very low	45.1	Very low	57 Å²	57	129.3 Å²	129.3	59%	0.588	80%	0.802	S	S	*	*			trans	-54.4	114.1	173.7	0	0	0	0	0	109.6	H8 V12	H8-G10 VanDerWaalsContact C-N 3.3Å; H8-G10 PolarHBondContact O-N 3.5Å; H8-G10 VanDerWaalsContact O-N 3.07Å; G10-V12 PolarHBondContact O-N 3.05Å
11	A	44.5	Very low	45.5	Very low	91 Å²	91	128 Å²	128	75%	0.752	80%	0.799	S	S	*	*			trans	-64.4	105	165.3	0	0	0	0	0	106.8	S9 V13	S9-A11 PolarHBondContact O-N 3.29Å; S9-A11 VanDerWaalsContact O-N 3.07Å; A11-V13 VanDerWaalsContact C-N 3.3Å; A11-V13 PolarHBondContact O-N 3.16Å
12	V	47.8	Very low	46.4	Very low	134 Å²	134	121.1 Å²	121.1	81%	0.812	77%	0.773	S	S	*	*			trans	-68.4	97.3	168.1	-175.3	0	0	0	0	105.8	G10 P14	G10-V12 PolarHBondContact O-N 3.05Å; V12-P14 WeakPolarHBondContact O-CD 3.1Å
13	V	55.3	Low	47.5	Very low	125 Å²	125	118 Å²	118	76%	0.758	77%	0.77	S	S	*	*			trans	-63.5	117.7	165.1	-134.3	0	0	0	0	105.3	A11 A15	A11-V13 VanDerWaalsContact C-N 3.3Å; A11-V13 PolarHBondContact O-N 3.16Å; V13-A15 PolarHBondContact O-N 3.37Å
14	P	41.1	Very low	48.4	Very low	109 Å²	109	117.4 Å²	117.4	71%	0.708	77%	0.765	S	S	*	*			trans	-64.3	115.3	170.9	26.4	-28.9	0	0	0	105.9	V12 Q16	V12-P14 WeakPolarHBondContact O-CD 3.1Å; P14-Q16 VanDerWaalsContact C-N 3.31Å; P14-Q16 PolarHBondContact O-N 3.24Å
15	A	51.2	Low	49.3	Very low	93 Å²	93	116.7 Å²	116.7	77%	0.769	76%	0.761	S	S	*	*			trans	-57.7	104	165.2	0	0	0	0	0	105.8	V13 S17	V13-A15 PolarHBondContact O-N 3.37Å; A15-S17 VanDerWaalsContact C-N 3.33Å; A15-S17 PolarHBondContact O-N 3.26Å
16	Q	48.2	Very low	50.6	Low	185 Å²	185	118 Å²	118	86%	0.864	75%	0.753	S	S	*	*			trans	-56	108.4	164.6	-80.2	177.6	-43.2	0	0	105.2	P14	P14-Q16 VanDerWaalsContact C-N 3.31Å; P14-Q16 PolarHBondContact O-N 3.24Å
17	S	53.3	Low	52.4	Low	97 Å²	97	118.4 Å²	118.4	68%	0.678	75%	0.752	S	S	*	*			trans	-49.3	133.5	165.7	-53.4	0	0	0	0	106.4	A15 E19	A15-S17 VanDerWaalsContact C-N 3.33Å; A15-S17 PolarHBondContact O-N 3.26Å; S17-E19 PolarHBondContact O-N 3.03Å
18	P	54.4	Low	54.5	Low	122 Å²	122	121.5 Å²	121.5	79%	0.792	76%	0.759	S	S	*	*			trans	-54.7	120.4	170.9	25.2	-30.2	0	0	0	104.9	G20	P18-G20 PolarHBondContact O-N 3.32Å
19	E	53.3	Low	56.7	Low	186 Å²	186	118.3 Å²	118.3	87%	0.869	76%	0.755	S	S	*	*			trans	-45.4	122.7	-178	-66.9	-172.3	147.1	0	0	107	S17 S21	S17-E19 PolarHBondContact O-N 3.03Å; E19-S21 PolarHBondContact O-N 3Å; E19-S21 VanDerWaalsContact O-N 3.07Å
20	G	52.9	Low	58.8	Low	68 Å²	68	115.5 Å²	115.5	70%	0.701	74%	0.735	S	S	*	*			trans	-45.9	124.4	-177.4	0	0	0	0	0	107.8	P18 S22	P18-G20 PolarHBondContact O-N 3.32Å; G20-S22 PolarHBondContact O-N 3.25Å
21	S	55.1	Low	61.2	Low	103 Å²	103	115.5 Å²	115.5	72%	0.72	73%	0.729	S	S	*	*			trans	-25.6	104.5	173.5	177.4	0	0	0	0	108.7	E19 A23	E19-S21 PolarHBondContact O-N 3Å; E19-S21 VanDerWaalsContact O-N 3.07Å; S21-A23 PolarHBondContact O-N 2.97Å
22	S	58.1	Low	63.3	Low	88 Å²	88	115.7 Å²	115.7	62%	0.615	72%	0.717	S	S	*	*			trans	-49.7	136.6	179.4	52.3	0	0	0	0	106.9	G20 A24	G20-S22 PolarHBondContact O-N 3.25Å; S22-A24 PolarHBondContact O-N 3.26Å
23	A	58.3	Low	65.3	Low	97 Å²	97	112.8 Å²	112.8	80%	0.802	72%	0.715	S	S	*	*	S	Bend	trans	-58.2	63.2	175	0	0	0	0	0	112.1	S21	S21-A23 PolarHBondContact O-N 2.97Å
24	A	56.4	Low	67.2	Low	72 Å²	72	109.4 Å²	109.4	60%	0.595	70%	0.695	S	S	*	*			trans	-141.1	5.6	-167.2	0	0	0	0	0	111.6	S22	S22-A24 PolarHBondContact O-N 3.26Å
25	D	60.1	Low	69.7	Low	141 Å²	141	112.3 Å²	112.3	75%	0.754	69%	0.691	S	S	*	*			trans	-94.1	41.5	153.8	-86.4	-17.3	0	0	0	109.2	F27	D25-F27 PolarHBondContact O-N 3.3Å; D25-F27 VanDerWaalsContact O-N 3.16Å
26	D	69.2	Low	71.8	Confident	132 Å²	132	113.2 Å²	113.2	71%	0.706	68%	0.679	S	S	*	*	P	Polyproline II helix	trans	-63.5	116	164.9	-87	-14.2	0	0	0	107.3	V28	D26-V28 PolarHBondContact O-N 2.97Å; D26-V28 VanDerWaalsContact O-N 3.08Å
27	F	77.9	Confident	74.1	Confident	206 Å²	206	107.1 Å²	107.1	90%	0.904	65%	0.651	S	S	*	*	P	Polyproline II helix	trans	-51.6	118.9	179.6	-67.5	-83.6	0	0	0	110.1	D25	D25-F27 PolarHBondContact O-N 3.3Å; D25-F27 VanDerWaalsContact O-N 3.16Å
28	V	82.6	Confident	76	Confident	128 Å²	128	107.6 Å²	107.6	78%	0.776	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-61.1	133.7	174.4	-176.6	0	0	0	0	108.3	D26 S30	D26-V28 PolarHBondContact O-N 2.97Å; D26-V28 VanDerWaalsContact O-N 3.08Å; V28-S30 PolarHBondContact O-N 3.47Å
29	P	85.3	Confident	78	Confident	123 Å²	123	105.5 Å²	105.5	80%	0.799	62%	0.62	S	S	*	*	P	Polyproline II helix	trans	-52.5	126.8	177.6	-27.2	34.5	0	0	0	111.6
30	S	89.3	Confident	80	Confident	69 Å²	69	99.4 Å²	99.4	48%	0.483	60%	0.601	S	S	.	*	P	Polyproline II helix	trans	-83.4	141.6	179.1	178.4	0	0	0	0	110.9	V28 L32 G33	V28-S30 PolarHBondContact O-N 3.47Å; S30-L32 PolarHBondContact O-N 2.91Å; S30-L32 WeakPolarHBondContact OG-CB 3.12Å; S30-L32 PolarHBondContact OG-N 3.01Å; S30-G33 PolarHBondContact O-N 3.13Å
31	A	90.4	Very high	82	Confident	56 Å²	56	96.8 Å²	96.8	46%	0.463	57%	0.572	S	S	.	*	G	3₁₀ helix	trans	-56	-33.1	169.5	0	0	0	0	0	111.8	G33 T34 H37	A31-G33 PolarHBondContact O-N 2.91Å; A31-G33 VanDerWaalsContact O-N 3.11Å; A31-T34 PolarHBondContact O-N 3.07Å; A31-T34 PolarHBondContact O-OG1 3.39Å; A31-H37 WeakPolarHBondContact O-CB 3.38Å
32	L	89.7	Confident	83.7	Confident	95 Å²	95	99 Å²	99	50%	0.497	57%	0.566	S	S	.	*	G	3₁₀ helix	trans	-62.8	-16.8	176.3	-58.2	177.5	0	0	0	113.2	S30 H37 W38	S30-L32 PolarHBondContact O-N 2.91Å; S30-L32 WeakPolarHBondContact OG-CB 3.12Å; S30-L32 PolarHBondContact OG-N 3.01Å; L32-H37 WeakPolarHBondContact CD2-NE2 3.43Å; L32-W38 HydrophobicContact CB-CZ2 4.49Å; L32-W38 HydrophobicContact CD2-CZ2 4.24Å; L32-W38 PolarHBondContact O-NE1 3.37Å
33	G	89.9	Confident	85.5	Confident	73 Å²	73	100.7 Å²	100.7	75%	0.753	56%	0.564	S	S	*	*	G	3₁₀ helix	trans	-88.6	-0.2	175	0	0	0	0	0	114.1	S30 A31	S30-G33 PolarHBondContact O-N 3.13Å; A31-G33 PolarHBondContact O-N 2.91Å; A31-G33 VanDerWaalsContact O-N 3.11Å
34	T	93.9	Very high	87.3	Confident	55 Å²	55	102.4 Å²	102.4	34%	0.337	55%	0.549	S	S	.	.			trans	-106.2	141.3	-173.8	68.8	0	0	0	0	111.5	A31 E36 H37	A31-T34 PolarHBondContact O-N 3.07Å; A31-T34 PolarHBondContact O-OG1 3.39Å; T34-E36 VanDerWaalsContact C-N 3.3Å; T34-E36 PolarHBondContact O-N 3.16Å; T34-H37 PolarHBondContact O-N 3.07Å; T34-H37 VanDerWaalsContact OG1-CB 3.25Å; T34-H37 WeakPolarHBondContact OG1-CB 3.38Å; T34-H37 PolarHBondContact OG1-N 2.67Å
35	R	93.7	Very high	89.1	Confident	170 Å²	170	101.1 Å²	101.1	64%	0.642	53%	0.531	S	S	*	.	H	α-helix	trans	-63.9	-40.8	176	179.3	-171.8	58.1	-177.2	-3.8	110.7	H37 W38 D39	R35-H37 PolarHBondContact O-N 2.92Å; R35-W38 PolarHBondContact O-N 3.08Å; R35-D39 IonicContact NE-OD2 3.93Å; R35-D39 PolarHBondContact O-N 3.34Å
36	E	96.7	Very high	90.7	Very high	111 Å²	111	97.7 Å²	97.7	52%	0.519	51%	0.512	S	S	.	.	H	α-helix	trans	-59.6	-34.6	-177.1	-66.5	65.4	-142.9	0	0	111.7	T34 A40	T34-E36 VanDerWaalsContact C-N 3.3Å; T34-E36 PolarHBondContact O-N 3.16Å; E36-A40 PolarHBondContact O-N 3.42Å
37	H	94.9	Very high	92	Very high	57 Å²	57	97.6 Å²	97.6	26%	0.264	50%	0.502	S	S	.	.	H	α-helix	trans	-63.8	-48.1	172.2	178.2	78.8	0	0	0	112	A31 L32 T34 R35 A40 V41	A31-H37 WeakPolarHBondContact O-CB 3.38Å; L32-H37 WeakPolarHBondContact CD2-NE2 3.43Å; T34-H37 PolarHBondContact O-N 3.07Å; T34-H37 VanDerWaalsContact OG1-CB 3.25Å; T34-H37 WeakPolarHBondContact OG1-CB 3.38Å; T34-H37 PolarHBondContact OG1-N 2.67Å; R35-H37 PolarHBondContact O-N 2.92Å; H37-A40 PolarHBondContact O-N 3.48Å; H37-V41 WeakPolarHBondContact O-CG2 3.4Å; H37-V41 PolarHBondContact O-N 3.12Å
38	W	93.9	Very high	92.8	Very high	107 Å²	107	89.7 Å²	89.7	41%	0.405	47%	0.471	S	S	.	.	H	α-helix	trans	-71.2	-33.8	-177.5	-68	112.2	0	0	0	113.1	L32 R35 A40 V41 Y42 W59	L32-W38 HydrophobicContact CB-CZ2 4.49Å; L32-W38 HydrophobicContact CD2-CZ2 4.24Å; L32-W38 PolarHBondContact O-NE1 3.37Å; R35-W38 PolarHBondContact O-N 3.08Å; W38-A40 VanDerWaalsContact C-N 3.33Å; W38-A40 PolarHBondContact O-N 2.96Å; W38-V41 HydrophobicContact CE3-CB 4.41Å; W38-V41 HydrophobicContact CE3-CG1 4.42Å; W38-V41 PolarHBondContact O-N 3.44Å; W38-Y42 WeakPolarHBondContact O-CB 3.33Å; W38-Y42 PolarHBondContact O-N 2.99Å; W38-W59 HydrophobicContact CZ3-CZ2 4.27Å
39	D	95.6	Very high	93.4	Very high	78 Å²	78	88.9 Å²	88.9	42%	0.417	46%	0.457	S	S	.	.	H	α-helix	trans	-60.3	-45.3	172.2	-70.3	-15.3	0	0	0	110.3	R35 V41 Y42 E43	R35-D39 IonicContact NE-OD2 3.93Å; R35-D39 PolarHBondContact O-N 3.34Å; D39-V41 PolarHBondContact O-N 3.11Å; D39-Y42 PolarHBondContact O-N 3.14Å; D39-E43 WeakPolarHBondContact O-CG 3.3Å; D39-E43 PolarHBondContact O-N 3.36Å
40	A	96.3	Very high	93.9	Very high	58 Å²	58	89.7 Å²	89.7	48%	0.479	45%	0.45	S	S	.	.	H	α-helix	trans	-66.2	-37.8	177.4	0	0	0	0	0	113	E36 H37 W38 R44	E36-A40 PolarHBondContact O-N 3.42Å; H37-A40 PolarHBondContact O-N 3.48Å; W38-A40 VanDerWaalsContact C-N 3.33Å; W38-A40 PolarHBondContact O-N 2.96Å; A40-R44 WeakPolarHBondContact O-CB 3.33Å; A40-R44 PolarHBondContact O-N 2.93Å; A40-R44 VanDerWaalsContact O-N 3.15Å
41	V	93.8	Very high	94.3	Very high	14 Å²	14	92 Å²	92	9%	0.085	45%	0.453	C	S	.	.	H	α-helix	trans	-63.3	-47	174	169.6	0	0	0	0	110.4	H37 W38 D39 E43 R44 E45	H37-V41 WeakPolarHBondContact O-CG2 3.4Å; H37-V41 PolarHBondContact O-N 3.12Å; W38-V41 HydrophobicContact CE3-CB 4.41Å; W38-V41 HydrophobicContact CE3-CG1 4.42Å; W38-V41 PolarHBondContact O-N 3.44Å; D39-V41 PolarHBondContact O-N 3.11Å; V41-E43 PolarHBondContact O-N 3.12Å; V41-R44 WeakPolarHBondContact O-CB 3.22Å; V41-R44 PolarHBondContact O-N 2.88Å; V41-E45 HydrophobicContact CG1-CG 4.42Å; V41-E45 WeakPolarHBondContact O-CG 3.41Å; V41-E45 PolarHBondContact O-N 2.96Å
42	Y	92.7	Very high	94.5	Very high	150 Å²	150	98 Å²	98	59%	0.588	47%	0.465	S	S	*	.	H	α-helix	trans	-59.5	-47.5	178.3	176.2	-100.3	0	0	0	112.1	W38 D39 R44 E45 L46	W38-Y42 WeakPolarHBondContact O-CB 3.33Å; W38-Y42 PolarHBondContact O-N 2.99Å; D39-Y42 PolarHBondContact O-N 3.14Å; Y42-R44 VanDerWaalsContact C-N 3.27Å; Y42-R44 PolarHBondContact O-N 3.17Å; Y42-E45 PolarHBondContact O-N 3.01Å; Y42-L46 HydrophobicContact CE1-CD2 4.18Å; Y42-L46 VanDerWaalsContact O-CB 3.32Å; Y42-L46 WeakPolarHBondContact O-CB 3.45Å; Y42-L46 PolarHBondContact O-N 3.34Å
43	E	95.8	Very high	94.7	Very high	123 Å²	123	95.7 Å²	95.7	58%	0.575	47%	0.465	S	S	*	.	H	α-helix	trans	-60.7	-36.6	177.5	-75.3	-179.2	-177.7	0	0	112.9	D39 V41 R47	D39-E43 WeakPolarHBondContact O-CG 3.3Å; D39-E43 PolarHBondContact O-N 3.36Å; V41-E43 PolarHBondContact O-N 3.12Å; E43-R47 PolarHBondContact O-N 3.05Å
44	R	94.9	Very high	94.8	Very high	132 Å²	132	96 Å²	96	50%	0.498	45%	0.449	S	S	.	.	H	α-helix	trans	-66.8	-52.3	175.8	-178.8	-169.8	66.4	-170.1	0.3	110.6	A40 V41 Y42 L46 R47 T48	A40-R44 WeakPolarHBondContact O-CB 3.33Å; A40-R44 PolarHBondContact O-N 2.93Å; A40-R44 VanDerWaalsContact O-N 3.15Å; V41-R44 WeakPolarHBondContact O-CB 3.22Å; V41-R44 PolarHBondContact O-N 2.88Å; Y42-R44 VanDerWaalsContact C-N 3.27Å; Y42-R44 PolarHBondContact O-N 3.17Å; R44-L46 VanDerWaalsContact C-N 3.34Å; R44-L46 PolarHBondContact O-N 3.15Å; R44-R47 WeakPolarHBondContact O-CB 3.34Å; R44-R47 PolarHBondContact O-N 2.91Å; R44-T48 PolarHBondContact O-N 2.9Å; R44-T48 PolarHBondContact O-OG1 3Å; R44-T48 VanDerWaalsContact O-OG1 3.05Å
45	E	94	Very high	94.6	Very high	46 Å²	46	98.2 Å²	98.2	22%	0.215	46%	0.463	C	S	.	.	H	α-helix	trans	-62.7	-41.1	-177.7	-72.2	179.7	179.7	0	0	112	V41 Y42 R47 T48 F49	V41-E45 HydrophobicContact CG1-CG 4.42Å; V41-E45 WeakPolarHBondContact O-CG 3.41Å; V41-E45 PolarHBondContact O-N 2.96Å; Y42-E45 PolarHBondContact O-N 3.01Å; E45-R47 VanDerWaalsContact C-N 3.3Å; E45-R47 PolarHBondContact O-N 3.24Å; E45-T48 PolarHBondContact O-N 3.18Å; E45-F49 WeakPolarHBondContact O-CB 3.49Å; E45-F49 PolarHBondContact O-N 3.03Å
46	L	94.3	Very high	94.3	Very high	68 Å²	68	91.1 Å²	91.1	36%	0.356	44%	0.442	S	S	.	.	H	α-helix	trans	-59.2	-42.3	176	-179.9	61.3	0	0	0	111.9	Y42 R44 F49 Q50	Y42-L46 HydrophobicContact CE1-CD2 4.18Å; Y42-L46 VanDerWaalsContact O-CB 3.32Å; Y42-L46 WeakPolarHBondContact O-CB 3.45Å; Y42-L46 PolarHBondContact O-N 3.34Å; R44-L46 VanDerWaalsContact C-N 3.34Å; R44-L46 PolarHBondContact O-N 3.15Å; L46-F49 PolarHBondContact O-N 2.57Å; L46-Q50 VanDerWaalsContact O-CG 3.29Å; L46-Q50 WeakPolarHBondContact O-CG 3.35Å; L46-Q50 PolarHBondContact O-N 3.47Å
47	R	96.6	Very high	93.8	Very high	131 Å²	131	91.3 Å²	91.3	49%	0.494	44%	0.443	S	S	.	.	H	α-helix	trans	-65.1	-46.1	176.5	-169.8	-164.7	-27.7	-109.5	-11.7	111.3	E43 R44 E45 F49 Q50 E51	E43-R47 PolarHBondContact O-N 3.05Å; R44-R47 WeakPolarHBondContact O-CB 3.34Å; R44-R47 PolarHBondContact O-N 2.91Å; E45-R47 VanDerWaalsContact C-N 3.3Å; E45-R47 PolarHBondContact O-N 3.24Å; R47-F49 VanDerWaalsContact C-N 3.29Å; R47-F49 PolarHBondContact O-N 3.5Å; R47-Q50 PolarHBondContact O-N 3.19Å; R47-Q50 VanDerWaalsContact O-N 3.14Å; R47-E51 WeakPolarHBondContact CG-OE1 3.31Å; R47-E51 WeakPolarHBondContact O-CG 3.15Å; R47-E51 PolarHBondContact O-N 3.35Å
48	T	94.5	Very high	93.3	Very high	40 Å²	40	91.3 Å²	91.3	25%	0.245	45%	0.445	C	S	.	.	H	α-helix	trans	-61.1	-40.2	178.2	-52	0	0	0	0	111.3	R44 E45 E51 Y52 D54	R44-T48 PolarHBondContact O-N 2.9Å; R44-T48 PolarHBondContact O-OG1 3Å; R44-T48 VanDerWaalsContact O-OG1 3.05Å; E45-T48 PolarHBondContact O-N 3.18Å; T48-E51 PolarHBondContact O-N 2.91Å; T48-Y52 HydrophobicContact CG2-CD2 4.01Å; T48-Y52 PolarHBondContact O-N 3.24Å; T48-D54 HydrophobicContact CG2-CB 3.6Å
49	F	94.9	Very high	92.7	Very high	111 Å²	111	92.2 Å²	92.2	49%	0.487	45%	0.448	S	S	.	.	H	α-helix	trans	-61.2	-45.3	173.4	179.6	-104.3	0	0	0	111.9	E45 L46 R47 E51 G53 D54 T55	E45-F49 WeakPolarHBondContact O-CB 3.49Å; E45-F49 PolarHBondContact O-N 3.03Å; L46-F49 PolarHBondContact O-N 2.57Å; R47-F49 VanDerWaalsContact C-N 3.29Å; R47-F49 PolarHBondContact O-N 3.5Å; F49-E51 PolarHBondContact O-N 2.88Å; F49-G53 WeakPolarHBondContact O-CA 3.4Å; F49-G53 PolarHBondContact O-N 2.86Å; F49-D54 WeakPolarHBondContact CA-O 3.47Å; F49-D54 WeakPolarHBondContact CB-O 3.44Å; F49-D54 WeakPolarHBondContact CD2-O 3.2Å; F49-T55 HydrophobicContact CE2-CG2 4.44Å
50	Q	96.4	Very high	92	Very high	140 Å²	140	96.7 Å²	96.7	65%	0.654	46%	0.464	S	S	*	.	H	α-helix	trans	-66.1	-35.7	179.5	-72.9	173.3	0.2	0	0	113.2	L46 R47	L46-Q50 VanDerWaalsContact O-CG 3.29Å; L46-Q50 WeakPolarHBondContact O-CG 3.35Å; L46-Q50 PolarHBondContact O-N 3.47Å; R47-Q50 PolarHBondContact O-N 3.19Å; R47-Q50 VanDerWaalsContact O-N 3.14Å
51	E	97.1	Very high	91.6	Very high	117 Å²	117	95.3 Å²	95.3	55%	0.547	46%	0.456	S	S	.	.	H	α-helix	trans	-84.5	-38.6	-176.6	-71.3	176.1	-176.8	0	0	113.1	R47 T48 F49	R47-E51 WeakPolarHBondContact CG-OE1 3.31Å; R47-E51 WeakPolarHBondContact O-CG 3.15Å; R47-E51 PolarHBondContact O-N 3.35Å; T48-E51 PolarHBondContact O-N 2.91Å; F49-E51 PolarHBondContact O-N 2.88Å
52	Y	95.3	Very high	91.3	Very high	181 Å²	181	100.5 Å²	100.5	71%	0.71	48%	0.479	S	S	*	.	H	α-helix	trans	-125.4	-8.6	-168.9	-55.6	-72.4	0	0	0	114.3	T48 D54	T48-Y52 HydrophobicContact CG2-CD2 4.01Å; T48-Y52 PolarHBondContact O-N 3.24Å; Y52-D54 PolarHBondContact O-N 3.35Å
53	G	93.8	Very high	91.1	Very high	47 Å²	47	100.2 Å²	100.2	49%	0.485	48%	0.483	S	S	.	.			trans	72.5	17.3	-173	0	0	0	0	0	113.8	F49 T55	F49-G53 WeakPolarHBondContact O-CA 3.4Å; F49-G53 PolarHBondContact O-N 2.86Å; G53-T55 PolarHBondContact O-N 3.33Å
54	D	92.4	Very high	90.8	Very high	81 Å²	81	96.9 Å²	96.9	43%	0.433	47%	0.474	S	S	.	.			trans	-69.7	117.9	178.2	-171.7	-7.3	0	0	0	110.7	T48 F49 Y52 G56	T48-D54 HydrophobicContact CG2-CB 3.6Å; F49-D54 WeakPolarHBondContact CA-O 3.47Å; F49-D54 WeakPolarHBondContact CB-O 3.44Å; F49-D54 WeakPolarHBondContact CD2-O 3.2Å; Y52-D54 PolarHBondContact O-N 3.35Å; D54-G56 PolarHBondContact O-N 2.96Å; D54-G56 PolarHBondContact OD1-N 2.94Å
55	T	88.9	Confident	90.5	Very high	101 Å²	101	91.5 Å²	91.5	62%	0.62	45%	0.454	S	S	*	.			trans	-78.1	-0.2	-178.6	53.7	0	0	0	0	113.8	F49 G53 N90	F49-T55 HydrophobicContact CE2-CG2 4.44Å; G53-T55 PolarHBondContact O-N 3.33Å; T55-N90 WeakPolarHBondContact O-CB 3.47Å; T55-N90 PolarHBondContact O-ND2 2.91Å
56	G	86.9	Confident	90.3	Very high	21 Å²	21	91.5 Å²	91.5	22%	0.216	46%	0.456	C	S	.	.			trans	89.8	178	177.4	0	0	0	0	0	113.9	D54	D54-G56 PolarHBondContact O-N 2.96Å; D54-G56 PolarHBondContact OD1-N 2.94Å
57	E	85.9	Confident	90.2	Very high	114 Å²	114	96 Å²	96	53%	0.533	47%	0.468	S	S	.	.			trans	-85.4	143.1	-171.4	-176.3	175.8	-179.3	0	0	113.4	W59	E57-W59 PolarHBondContact O-N 3.5Å
58	I	85.6	Confident	90	Very high	57 Å²	57	93.5 Å²	93.5	29%	0.292	46%	0.464	S	S	.	.			trans	-93.9	91.5	168.9	-50.1	-177.5	0	0	0	109.3	F60 G61 E62 V92	I58-F60 VanDerWaalsContact C-N 3.34Å; I58-F60 PolarHBondContact O-N 3.45Å; I58-G61 PolarHBondContact O-N 3.16Å; I58-G61 VanDerWaalsContact O-N 3.08Å; I58-E62 HydrophobicContact CD1-CG 3.82Å; I58-V92 HydrophobicContact CD1-CG1 4.46Å; I58-V92 HydrophobicContact CD1-CG2 4.3Å; I58-V92 HydrophobicContact CG1-CG1 4.19Å; I58-V92 HydrophobicContact CG2-CG1 4.18Å
59	W	80.8	Confident	89.7	Confident	126 Å²	126	91.9 Å²	91.9	48%	0.477	45%	0.454	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56	-38.3	-171.7	-71.4	82.4	0	0	0	115.6	W38 E57	W38-W59 HydrophobicContact CZ3-CZ2 4.27Å; E57-W59 PolarHBondContact O-N 3.5Å
60	F	82	Confident	89.5	Confident	172 Å²	172	94.1 Å²	94.1	75%	0.754	46%	0.459	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.6	1.8	-179.5	-64	-70.2	0	0	0	113.5	I58 S64	I58-F60 VanDerWaalsContact C-N 3.34Å; I58-F60 PolarHBondContact O-N 3.45Å; F60-S64 WeakPolarHBondContact O-CB 3.49Å; F60-S64 PolarHBondContact O-OG 3.35Å
61	G	86.6	Confident	89.4	Confident	30 Å²	30	93.8 Å²	93.8	31%	0.309	45%	0.452	S	S	.	.	H	α-helix	trans	68.4	157.9	-174.6	0	0	0	0	0	114.6	I58 E63 S64	I58-G61 PolarHBondContact O-N 3.16Å; I58-G61 VanDerWaalsContact O-N 3.08Å; G61-E63 PolarHBondContact O-N 3.31Å; G61-S64 PolarHBondContact O-N 2.85Å
62	E	87.1	Confident	89.1	Confident	122 Å²	122	89.7 Å²	89.7	57%	0.57	43%	0.433	S	S	*	.	H	α-helix	trans	-62.9	-29.4	-179.7	-65.8	175	-148.8	0	0	113.1	I58 S64 M65 N66	I58-E62 HydrophobicContact CD1-CG 3.82Å; E62-S64 PolarHBondContact O-N 3.07Å; E62-M65 HydrophobicContact CB-CE 4.35Å; E62-M65 HydrophobicContact CG-CE 4.37Å; E62-M65 PolarHBondContact O-N 3.49Å; E62-N66 WeakPolarHBondContact O-CB 3.41Å; E62-N66 PolarHBondContact O-N 3.23Å; E62-N66 PolarHBondContact O-ND2 2.6Å
63	E	89.4	Confident	88.8	Confident	145 Å²	145	85 Å²	85	68%	0.678	42%	0.417	S	S	*	.	H	α-helix	trans	-63.7	-42.9	179.5	-168.3	-171.7	163.5	0	0	111.8	G61 M65 N66 R67	G61-E63 PolarHBondContact O-N 3.31Å; E63-M65 PolarHBondContact O-N 2.98Å; E63-N66 PolarHBondContact O-N 3.45Å; E63-R67 WeakPolarHBondContact O-CG 3.37Å; E63-R67 PolarHBondContact O-N 3.18Å
64	S	89.8	Confident	88.8	Confident	53 Å²	53	90.8 Å²	90.8	37%	0.371	43%	0.429	S	S	.	.	H	α-helix	trans	-63.7	-43.2	179.8	-61.1	0	0	0	0	111.4	F60 G61 E62 R67 L68	F60-S64 WeakPolarHBondContact O-CB 3.49Å; F60-S64 PolarHBondContact O-OG 3.35Å; G61-S64 PolarHBondContact O-N 2.85Å; E62-S64 PolarHBondContact O-N 3.07Å; S64-R67 PolarHBondContact O-N 3.31Å; S64-L68 PolarHBondContact O-N 3.1Å
65	M	89	Confident	88.9	Confident	18 Å²	18	91.9 Å²	91.9	9%	0.089	43%	0.431	C	S	.	.	H	α-helix	trans	-59.5	-50.7	173.3	161.7	170.9	86.1	0	0	111.8	E62 E63 R67 L68 I69 F93 E96	E62-M65 HydrophobicContact CB-CE 4.35Å; E62-M65 HydrophobicContact CG-CE 4.37Å; E62-M65 PolarHBondContact O-N 3.49Å; E63-M65 PolarHBondContact O-N 2.98Å; M65-R67 PolarHBondContact O-N 3.06Å; M65-L68 WeakPolarHBondContact O-CB 3.49Å; M65-L68 PolarHBondContact O-N 2.98Å; M65-I69 HydrophobicContact CG-CD1 3.89Å; M65-I69 WeakPolarHBondContact O-CG1 3.23Å; M65-I69 PolarHBondContact O-N 3.23Å; M65-F93 HydrophobicContact CB-CD2 4.3Å; M65-F93 HydrophobicContact CG-CD2 3.8Å; M65-F93 HydrophobicContact CG-CE2 4.4Å; M65-F93 HydrophobicContact SD-CD2 4.26Å; M65-E96 HydrophobicContact CE-CB 3.93Å; M65-E96 HydrophobicContact CE-CG 3.52Å; M65-E96 HydrophobicContact CG-CB 4.49Å; M65-E96 HydrophobicContact SD-CB 3.49Å; M65-E96 WeakPolarHBondContact SD-CB 3.47Å; M65-E96 HydrophobicContact SD-CG 3.55Å; M65-E96 VanDerWaalsContact SD-CG 3.55Å
66	N	89	Confident	89	Confident	46 Å²	46	95.6 Å²	95.6	25%	0.246	44%	0.439	C	S	.	.	H	α-helix	trans	-61	-32.2	179.4	-80.9	-46.2	0	0	0	113.1	E62 E63 R70	E62-N66 WeakPolarHBondContact O-CB 3.41Å; E62-N66 PolarHBondContact O-N 3.23Å; E62-N66 PolarHBondContact O-ND2 2.6Å; E63-N66 PolarHBondContact O-N 3.45Å; N66-R70 WeakPolarHBondContact O-CB 3.17Å; N66-R70 VanDerWaalsContact O-CG 3.31Å; N66-R70 WeakPolarHBondContact O-CG 3.34Å; N66-R70 PolarHBondContact O-N 2.78Å; N66-R70 VanDerWaalsContact O-N 3.12Å; N66-R70 PolarHBondContact O-NE 3.18Å
67	R	92.8	Very high	89.2	Confident	164 Å²	164	97.6 Å²	97.6	62%	0.619	44%	0.444	S	S	*	.	H	α-helix	trans	-67.2	-40.1	173.3	-76.1	174.3	57	-157.7	-7.1	111.7	E63 S64 M65 W71	E63-R67 WeakPolarHBondContact O-CG 3.37Å; E63-R67 PolarHBondContact O-N 3.18Å; S64-R67 PolarHBondContact O-N 3.31Å; M65-R67 PolarHBondContact O-N 3.06Å; R67-W71 WeakPolarHBondContact O-CB 3.37Å; R67-W71 PolarHBondContact O-N 2.9Å
68	L	90.9	Very high	89.4	Confident	78 Å²	78	96 Å²	96	41%	0.408	44%	0.443	S	S	.	.	H	α-helix	trans	-68	-45.1	178.2	-174.8	58.5	0	0	0	111.4	S64 M65 R70 W71 M72 F93	S64-L68 PolarHBondContact O-N 3.1Å; M65-L68 WeakPolarHBondContact O-CB 3.49Å; M65-L68 PolarHBondContact O-N 2.98Å; L68-R70 PolarHBondContact O-N 3.11Å; L68-W71 HydrophobicContact CD1-CE3 4.23Å; L68-W71 WeakPolarHBondContact O-CB 3.46Å; L68-W71 PolarHBondContact O-N 2.96Å; L68-W71 VanDerWaalsContact O-N 3.12Å; L68-M72 HydrophobicContact CG-SD 4.47Å; L68-M72 WeakPolarHBondContact O-CG 3.39Å; L68-M72 PolarHBondContact O-N 3.22Å; L68-F93 HydrophobicContact CB-CE2 4.4Å; L68-F93 HydrophobicContact CD2-CE1 4.07Å; L68-F93 HydrophobicContact CD2-CE2 3.72Å; L68-F93 HydrophobicContact CD2-CZ 3.4Å; L68-F93 VanDerWaalsContact CD2-CZ 3.4Å; L68-F93 HydrophobicContact CG-CE2 4.21Å; L68-F93 HydrophobicContact CG-CZ 4.05Å
69	I	88.7	Confident	89.4	Confident	6 Å²	6	99.6 Å²	99.6	3%	0.031	46%	0.463	C	S	.	.	H	α-helix	trans	-58.3	-48.3	176.2	-65.4	173.3	0	0	0	110.5	M65 W71 M72 Q73 F93 E96 L97 E100	M65-I69 HydrophobicContact CG-CD1 3.89Å; M65-I69 WeakPolarHBondContact O-CG1 3.23Å; M65-I69 PolarHBondContact O-N 3.23Å; I69-W71 VanDerWaalsContact C-N 3.29Å; I69-W71 PolarHBondContact O-N 3.49Å; I69-M72 PolarHBondContact O-N 3.08Å; I69-M72 VanDerWaalsContact O-N 3.13Å; I69-Q73 HydrophobicContact CG2-CG 4.45Å; I69-Q73 WeakPolarHBondContact O-CG 3.37Å; I69-Q73 PolarHBondContact O-N 3.49Å; I69-F93 HydrophobicContact CG1-CE2 4.16Å; I69-E96 HydrophobicContact CD1-CB 4.4Å; I69-L97 HydrophobicContact CG1-CD1 4.39Å; I69-E100 HydrophobicContact CD1-CG 4.15Å; I69-E100 HydrophobicContact CG2-CB 4.2Å; I69-E100 HydrophobicContact CG2-CG 4.37Å
70	R	91.1	Very high	89.8	Confident	158 Å²	158	100.3 Å²	100.3	60%	0.596	48%	0.476	S	S	*	.	H	α-helix	trans	-60.8	-37.2	176.2	-77.6	-173.7	-107	-145.5	-2.5	113	N66 L68 K74	N66-R70 WeakPolarHBondContact O-CB 3.17Å; N66-R70 VanDerWaalsContact O-CG 3.31Å; N66-R70 WeakPolarHBondContact O-CG 3.34Å; N66-R70 PolarHBondContact O-N 2.78Å; N66-R70 VanDerWaalsContact O-N 3.12Å; N66-R70 PolarHBondContact O-NE 3.18Å; L68-R70 PolarHBondContact O-N 3.11Å; R70-K74 VanDerWaalsContact O-CB 3.3Å; R70-K74 WeakPolarHBondContact O-CB 3.46Å; R70-K74 PolarHBondContact O-N 3.29Å
71	W	93.8	Very high	90.3	Very high	133 Å²	133	94 Å²	94	50%	0.504	46%	0.455	S	S	.	.	H	α-helix	trans	-63.7	-46.1	174.2	178.2	89.1	0	0	0	111	R67 L68 I69 Q73 K74 H75	R67-W71 WeakPolarHBondContact O-CB 3.37Å; R67-W71 PolarHBondContact O-N 2.9Å; L68-W71 HydrophobicContact CD1-CE3 4.23Å; L68-W71 WeakPolarHBondContact O-CB 3.46Å; L68-W71 PolarHBondContact O-N 2.96Å; L68-W71 VanDerWaalsContact O-N 3.12Å; I69-W71 VanDerWaalsContact C-N 3.29Å; I69-W71 PolarHBondContact O-N 3.49Å; W71-Q73 PolarHBondContact O-N 3.33Å; W71-K74 PolarHBondContact O-N 2.99Å; W71-H75 AromaticContact CD1-CD2 3.62Å; W71-H75 AromaticContact CD1-NE2 3.79Å; W71-H75 AromaticContact CD2-CD2 3.86Å; W71-H75 AromaticContact CE2-CD2 3.42Å; W71-H75 VanDerWaalsContact CE2-CD2 3.42Å; W71-H75 AromaticContact CE2-NE2 3.8Å; W71-H75 AromaticContact CG-CD2 3.97Å; W71-H75 AromaticContact CZ2-CD2 3.91Å; W71-H75 AromaticContact NE1-CD2 3.26Å; W71-H75 PolarHBondContact NE1-CD2 3.5Å; W71-H75 VanDerWaalsContact NE1-CD2 3.26Å; W71-H75 AromaticContact NE1-NE2 3.25Å; W71-H75 PolarHBondContact NE1-NE2 3.5Å; W71-H75 PolarHBondContact O-CD2 3.26Å; W71-H75 VanDerWaalsContact O-CD2 3.24Å; W71-H75 PolarHBondContact O-N 3.08Å
72	M	91.6	Very high	90.5	Very high	30 Å²	30	98.5 Å²	98.5	15%	0.148	48%	0.482	C	S	.	.	H	α-helix	trans	-61	-44.8	177.3	-66.3	175.8	73.7	0	0	112	L68 I69 H75 K76 I77 V83 F93 L97	L68-M72 HydrophobicContact CG-SD 4.47Å; L68-M72 WeakPolarHBondContact O-CG 3.39Å; L68-M72 PolarHBondContact O-N 3.22Å; I69-M72 PolarHBondContact O-N 3.08Å; I69-M72 VanDerWaalsContact O-N 3.13Å; M72-H75 CarbonylContact O-C 3.5Å; M72-H75 PolarHBondContact O-N 2.7Å; M72-K76 PolarHBondContact O-N 3.23Å; M72-I77 HydrophobicContact CB-CB 4.37Å; M72-I77 HydrophobicContact CB-CG1 3.92Å; M72-I77 HydrophobicContact CE-CB 4.43Å; M72-I77 HydrophobicContact CE-CG2 4.15Å; M72-I77 HydrophobicContact CG-CG1 4.19Å; M72-I77 PolarHBondContact O-N 3.34Å; M72-I77 VanDerWaalsContact O-N 3.16Å; M72-V83 HydrophobicContact CE-CG2 4.32Å; M72-F93 HydrophobicContact SD-CZ 4.5Å; M72-L97 HydrophobicContact CE-CD1 4.06Å; M72-L97 HydrophobicContact CE-CD2 4.34Å; M72-L97 HydrophobicContact SD-CD1 3.95Å
73	Q	89.1	Confident	90.7	Very high	82 Å²	82	96 Å²	96	38%	0.383	48%	0.475	S	S	.	.	H	α-helix	trans	-59.9	-47.2	175.7	-71.6	171.4	-13.3	0	0	111.7	I69 W71 H75 K76 L104	I69-Q73 HydrophobicContact CG2-CG 4.45Å; I69-Q73 WeakPolarHBondContact O-CG 3.37Å; I69-Q73 PolarHBondContact O-N 3.49Å; W71-Q73 PolarHBondContact O-N 3.33Å; Q73-H75 VanDerWaalsContact C-N 3.25Å; Q73-H75 PolarHBondContact O-N 3.35Å; Q73-K76 PolarHBondContact O-N 2.97Å; Q73-L104 HydrophobicContact CG-CD1 4.17Å
74	K	94	Very high	90.8	Very high	169 Å²	169	96 Å²	96	74%	0.735	48%	0.479	S	S	*	.	H	α-helix	trans	-59.2	-38.1	177.8	179.1	179.1	177.5	-178.4	0	112.1	R70 W71 K76	R70-K74 VanDerWaalsContact O-CB 3.3Å; R70-K74 WeakPolarHBondContact O-CB 3.46Å; R70-K74 PolarHBondContact O-N 3.29Å; W71-K74 PolarHBondContact O-N 2.99Å; K74-K76 VanDerWaalsContact C-N 3.3Å
75	H	94.3	Very high	90.9	Very high	104 Å²	104	95.7 Å²	95.7	48%	0.481	47%	0.473	S	S	.	.	H	α-helix	trans	-85.9	-0.7	178.7	-77.3	-79.2	0	0	0	113.9	W71 M72 Q73 I77	W71-H75 AromaticContact CD1-CD2 3.62Å; W71-H75 AromaticContact CD1-NE2 3.79Å; W71-H75 AromaticContact CD2-CD2 3.86Å; W71-H75 AromaticContact CE2-CD2 3.42Å; W71-H75 VanDerWaalsContact CE2-CD2 3.42Å; W71-H75 AromaticContact CE2-NE2 3.8Å; W71-H75 AromaticContact CG-CD2 3.97Å; W71-H75 AromaticContact CZ2-CD2 3.91Å; W71-H75 AromaticContact NE1-CD2 3.26Å; W71-H75 PolarHBondContact NE1-CD2 3.5Å; W71-H75 VanDerWaalsContact NE1-CD2 3.26Å; W71-H75 AromaticContact NE1-NE2 3.25Å; W71-H75 PolarHBondContact NE1-NE2 3.5Å; W71-H75 PolarHBondContact O-CD2 3.26Å; W71-H75 VanDerWaalsContact O-CD2 3.24Å; W71-H75 PolarHBondContact O-N 3.08Å; M72-H75 CarbonylContact O-C 3.5Å; M72-H75 PolarHBondContact O-N 2.7Å; Q73-H75 VanDerWaalsContact C-N 3.25Å; Q73-H75 PolarHBondContact O-N 3.35Å; H75-I77 VanDerWaalsContact C-N 3.28Å; H75-I77 HydrophobicContact CB-CD1 4.29Å; H75-I77 PolarHBondContact O-N 2.85Å
76	K	91.1	Very high	91	Very high	180 Å²	180	101.8 Å²	101.8	78%	0.783	50%	0.504	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.3	47	178.9	-54.2	-177.7	-179.2	-177.7	0	111.9	M72 Q73 K74	M72-K76 PolarHBondContact O-N 3.23Å; Q73-K76 PolarHBondContact O-N 2.97Å; K74-K76 VanDerWaalsContact C-N 3.3Å
77	I	90.6	Very high	91	Very high	63 Å²	63	103 Å²	103	32%	0.323	53%	0.528	S	S	.	.			trans	-56.2	130.2	173.2	-58.1	-58.5	0	0	0	108.2	M72 H75 A81	M72-I77 HydrophobicContact CB-CB 4.37Å; M72-I77 HydrophobicContact CB-CG1 3.92Å; M72-I77 HydrophobicContact CE-CB 4.43Å; M72-I77 HydrophobicContact CE-CG2 4.15Å; M72-I77 HydrophobicContact CG-CG1 4.19Å; M72-I77 PolarHBondContact O-N 3.34Å; M72-I77 VanDerWaalsContact O-N 3.16Å; H75-I77 VanDerWaalsContact C-N 3.28Å; H75-I77 HydrophobicContact CB-CD1 4.29Å; H75-I77 PolarHBondContact O-N 2.85Å; I77-A81 HydrophobicContact CG2-CB 3.76Å
78	P	89.7	Confident	90.9	Very high	79 Å²	79	97.6 Å²	97.6	51%	0.513	51%	0.513	S	S	.	.			trans	-57.4	142.5	179.4	-24.9	34	0	0	0	112	D80 A81	P78-D80 WeakPolarHBondContact CB-OD1 3.42Å; P78-D80 PolarHBondContact O-N 3.33Å; P78-A81 HydrophobicContact CB-CB 4.36Å; P78-A81 WeakPolarHBondContact O-CB 3.37Å; P78-A81 PolarHBondContact O-N 3.3Å
79	L	86.8	Confident	90.9	Very high	134 Å²	134	96.4 Å²	96.4	70%	0.702	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.9	-21.9	179.3	-64.5	177.2	0	0	0	112.9	T101	L79-T101 HydrophobicContact CD2-CG2 3.85Å
80	D	89.4	Confident	90.9	Very high	141 Å²	141	99.1 Å²	99.1	75%	0.754	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.4	6.5	175.1	65.3	-22.5	0	0	0	113	P78 S82	P78-D80 WeakPolarHBondContact CB-OD1 3.42Å; P78-D80 PolarHBondContact O-N 3.33Å; D80-S82 PolarHBondContact O-N 2.89Å
81	A	91.3	Very high	90.9	Very high	39 Å²	39	92.2 Å²	92.2	32%	0.322	51%	0.513	S	S	.	.			trans	-63.7	137.3	174.9	0	0	0	0	0	110.6	I77 P78	I77-A81 HydrophobicContact CG2-CB 3.76Å; P78-A81 HydrophobicContact CB-CB 4.36Å; P78-A81 WeakPolarHBondContact O-CB 3.37Å; P78-A81 PolarHBondContact O-N 3.3Å
82	S	91.9	Very high	90.7	Very high	125 Å²	125	87.5 Å²	87.5	87%	0.874	50%	0.498	S	S	*	.			trans	-76.1	131.6	172.6	-57.4	0	0	0	0	110.4	D80	D80-S82 PolarHBondContact O-N 2.89Å
83	V	89.8	Confident	90.6	Very high	69 Å²	69	87.3 Å²	87.3	42%	0.418	50%	0.497	S	S	.	.			trans	-118.5	134.4	179.6	-179.6	0	0	0	0	109.5	M72 L94 L97	M72-V83 HydrophobicContact CE-CG2 4.32Å; V83-L94 HydrophobicContact CG1-CD2 4.21Å; V83-L97 HydrophobicContact CG1-CD2 4.3Å; V83-L97 HydrophobicContact CG2-CD2 4.09Å
84	L	92.8	Very high	90.7	Very high	145 Å²	145	86.6 Å²	86.6	76%	0.759	50%	0.495	S	S	*	.			trans	-118.1	120.3	172	174.3	64.9	0	0	0	108.5	I86	L84-I86 HydrophobicContact CD2-CD1 4.18Å; L84-I86 HydrophobicContact CD2-CG1 4.1Å; L84-I86 HydrophobicContact CG-CG1 3.99Å
85	D	91.3	Very high	90.4	Very high	47 Å²	47	83.2 Å²	83.2	25%	0.251	49%	0.489	S	S	.	.			trans	-104.3	118.3	173.4	-173.7	10.2	0	0	0	109.7	T88 F93 L94	D85-T88 WeakPolarHBondContact OD2-CA 3.25Å; D85-T88 WeakPolarHBondContact OD2-CB 3.37Å; D85-T88 PolarHBondContact OD2-OG1 3.36Å; D85-F93 HydrophobicContact CB-CD1 4.32Å; D85-L94 HydrophobicContact CB-CD1 4.1Å; D85-L94 HydrophobicContact CB-CD2 4.06Å; D85-L94 HydrophobicContact CB-CG 4.08Å
86	I	92	Very high	90.1	Very high	145 Å²	145	81.7 Å²	81.7	74%	0.744	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.2	123	-175.3	-57.5	-178.3	0	0	0	108.4	L84	L84-I86 HydrophobicContact CD2-CD1 4.18Å; L84-I86 HydrophobicContact CD2-CG1 4.1Å; L84-I86 HydrophobicContact CG-CG1 3.99Å
87	G	89	Confident	89.9	Confident	72 Å²	72	74.2 Å²	74.2	74%	0.742	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	73.3	36.7	-173.1	0	0	0	0	0	112.1	G89	G87-G89 PolarHBondContact O-N 2.74Å
88	T	90.1	Very high	89.6	Confident	50 Å²	50	74.8 Å²	74.8	31%	0.307	46%	0.456	S	S	.	.			trans	-62	-14.1	-174.8	-162.6	0	0	0	0	114.6	D85 N90 G91	D85-T88 WeakPolarHBondContact OD2-CA 3.25Å; D85-T88 WeakPolarHBondContact OD2-CB 3.37Å; D85-T88 PolarHBondContact OD2-OG1 3.36Å; T88-N90 PolarHBondContact O-N 3.33Å; T88-G91 PolarHBondContact O-N 2.88Å; T88-G91 WeakPolarHBondContact OG1-CA 3.11Å
89	G	89.9	Confident	89.2	Confident	54 Å²	54	72.4 Å²	72.4	56%	0.557	45%	0.447	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.4	-120.9	-178.4	0	0	0	0	0	111.2	G87 G91	G87-G89 PolarHBondContact O-N 2.74Å; G89-G91 PolarHBondContact O-N 3.02Å
90	N	89.6	Confident	88.3	Confident	62 Å²	62	69.8 Å²	69.8	33%	0.332	43%	0.431	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.8	-3.3	176.8	68.3	4.4	0	0	0	114.7	T55 T88 V92	T55-N90 WeakPolarHBondContact O-CB 3.47Å; T55-N90 PolarHBondContact O-ND2 2.91Å; T88-N90 PolarHBondContact O-N 3.33Å; N90-V92 WeakPolarHBondContact OD1-CB 3.29Å; N90-V92 WeakPolarHBondContact OD1-CG1 3.49Å; N90-V92 PolarHBondContact OD1-N 3.47Å; N90-V92 VanDerWaalsContact OD1-N 3.1Å
91	G	90.8	Very high	86.9	Confident	13 Å²	13	65.4 Å²	65.4	13%	0.134	41%	0.409	C	S	.	.			trans	83.5	8	175.8	0	0	0	0	0	115.4	T88 G89 F93 L94 V95	T88-G91 PolarHBondContact O-N 2.88Å; T88-G91 WeakPolarHBondContact OG1-CA 3.11Å; G89-G91 PolarHBondContact O-N 3.02Å; G91-F93 PolarHBondContact O-N 3.47Å; G91-F93 VanDerWaalsContact O-N 3.15Å; G91-L94 PolarHBondContact O-N 3.03Å; G91-V95 PolarHBondContact O-N 3.14Å
92	V	90.4	Very high	85.1	Confident	34 Å²	34	73 Å²	73	21%	0.206	43%	0.43	C	S	.	.	H	α-helix	trans	-54.9	-37.7	-173.6	69.4	0	0	0	0	112.9	I58 N90 L94 V95 E96	I58-V92 HydrophobicContact CD1-CG1 4.46Å; I58-V92 HydrophobicContact CD1-CG2 4.3Å; I58-V92 HydrophobicContact CG1-CG1 4.19Å; I58-V92 HydrophobicContact CG2-CG1 4.18Å; N90-V92 WeakPolarHBondContact OD1-CB 3.29Å; N90-V92 WeakPolarHBondContact OD1-CG1 3.49Å; N90-V92 PolarHBondContact OD1-N 3.47Å; N90-V92 VanDerWaalsContact OD1-N 3.1Å; V92-L94 VanDerWaalsContact C-N 3.33Å; V92-L94 PolarHBondContact O-N 3.15Å; V92-V95 PolarHBondContact O-N 3.31Å; V92-E96 HydrophobicContact CG2-CG 4.06Å; V92-E96 WeakPolarHBondContact O-CB 3.32Å; V92-E96 WeakPolarHBondContact O-CG 3.17Å; V92-E96 PolarHBondContact O-N 3.49Å
93	F	89.4	Confident	83.2	Confident	26 Å²	26	76.2 Å²	76.2	11%	0.114	43%	0.428	C	S	.	.	H	α-helix	trans	-59.3	-43.2	178.5	173.8	-116.5	0	0	0	112.6	M65 L68 I69 M72 D85 G91 E96 L97	M65-F93 HydrophobicContact CB-CD2 4.3Å; M65-F93 HydrophobicContact CG-CD2 3.8Å; M65-F93 HydrophobicContact CG-CE2 4.4Å; M65-F93 HydrophobicContact SD-CD2 4.26Å; L68-F93 HydrophobicContact CB-CE2 4.4Å; L68-F93 HydrophobicContact CD2-CE1 4.07Å; L68-F93 HydrophobicContact CD2-CE2 3.72Å; L68-F93 HydrophobicContact CD2-CZ 3.4Å; L68-F93 VanDerWaalsContact CD2-CZ 3.4Å; L68-F93 HydrophobicContact CG-CE2 4.21Å; L68-F93 HydrophobicContact CG-CZ 4.05Å; I69-F93 HydrophobicContact CG1-CE2 4.16Å; M72-F93 HydrophobicContact SD-CZ 4.5Å; D85-F93 HydrophobicContact CB-CD1 4.32Å; G91-F93 PolarHBondContact O-N 3.47Å; G91-F93 VanDerWaalsContact O-N 3.15Å; F93-E96 PolarHBondContact O-N 3.37Å; F93-L97 WeakPolarHBondContact O-CB 3.37Å; F93-L97 PolarHBondContact O-N 2.85Å
94	L	90.1	Very high	81.2	Confident	67 Å²	67	80.3 Å²	80.3	35%	0.351	45%	0.447	S	S	.	.	H	α-helix	trans	-71.8	-36.7	-179.8	-65	172.7	0	0	0	111.5	V83 D85 G91 V92 E96 L97 V98	V83-L94 HydrophobicContact CG1-CD2 4.21Å; D85-L94 HydrophobicContact CB-CD1 4.1Å; D85-L94 HydrophobicContact CB-CD2 4.06Å; D85-L94 HydrophobicContact CB-CG 4.08Å; G91-L94 PolarHBondContact O-N 3.03Å; V92-L94 VanDerWaalsContact C-N 3.33Å; V92-L94 PolarHBondContact O-N 3.15Å; L94-E96 VanDerWaalsContact C-N 3.35Å; L94-L97 PolarHBondContact O-N 3.22Å; L94-V98 WeakPolarHBondContact O-CG2 3.46Å; L94-V98 PolarHBondContact O-N 3.46Å; L94-V98 VanDerWaalsContact O-N 3.11Å
95	V	89.2	Confident	80.6	Confident	98 Å²	98	77.1 Å²	77.1	59%	0.594	43%	0.431	S	S	*	.	H	α-helix	trans	-61.5	-45.8	174	175	0	0	0	0	110.6	G91 V92 V98 G99	G91-V95 PolarHBondContact O-N 3.14Å; V92-V95 PolarHBondContact O-N 3.31Å; V95-V98 PolarHBondContact O-N 3.22Å; V95-G99 PolarHBondContact O-N 3.33Å
96	E	87.6	Confident	80.1	Confident	73 Å²	73	78.7 Å²	78.7	34%	0.341	44%	0.441	S	S	.	.	H	α-helix	trans	-69.7	-38.6	-179.8	-70	-71.7	142.2	0	0	112	M65 I69 V92 F93 L94 V98 G99 E100	M65-E96 HydrophobicContact CE-CB 3.93Å; M65-E96 HydrophobicContact CE-CG 3.52Å; M65-E96 HydrophobicContact CG-CB 4.49Å; M65-E96 HydrophobicContact SD-CB 3.49Å; M65-E96 WeakPolarHBondContact SD-CB 3.47Å; M65-E96 HydrophobicContact SD-CG 3.55Å; M65-E96 VanDerWaalsContact SD-CG 3.55Å; I69-E96 HydrophobicContact CD1-CB 4.4Å; V92-E96 HydrophobicContact CG2-CG 4.06Å; V92-E96 WeakPolarHBondContact O-CB 3.32Å; V92-E96 WeakPolarHBondContact O-CG 3.17Å; V92-E96 PolarHBondContact O-N 3.49Å; F93-E96 PolarHBondContact O-N 3.37Å; L94-E96 VanDerWaalsContact C-N 3.35Å; E96-V98 VanDerWaalsContact C-N 3.27Å; E96-V98 PolarHBondContact O-N 2.85Å; E96-G99 PolarHBondContact O-N 3.5Å; E96-E100 WeakPolarHBondContact O-CB 3.44Å; E96-E100 WeakPolarHBondContact O-CG 3.37Å; E96-E100 PolarHBondContact O-N 2.96Å
97	L	86.9	Confident	79.4	Confident	22 Å²	22	75 Å²	75	12%	0.115	42%	0.424	C	S	.	.	H	α-helix	trans	-59.1	-42.1	173.8	-174.5	67.4	0	0	0	111.2	I69 M72 V83 F93 L94 T101	I69-L97 HydrophobicContact CG1-CD1 4.39Å; M72-L97 HydrophobicContact CE-CD1 4.06Å; M72-L97 HydrophobicContact CE-CD2 4.34Å; M72-L97 HydrophobicContact SD-CD1 3.95Å; V83-L97 HydrophobicContact CG1-CD2 4.3Å; V83-L97 HydrophobicContact CG2-CD2 4.09Å; F93-L97 WeakPolarHBondContact O-CB 3.37Å; F93-L97 PolarHBondContact O-N 2.85Å; L94-L97 PolarHBondContact O-N 3.22Å; L97-T101 WeakPolarHBondContact O-CB 3.46Å; L97-T101 VanDerWaalsContact O-CG2 3.22Å; L97-T101 WeakPolarHBondContact O-CG2 3.44Å; L97-T101 PolarHBondContact O-N 3.22Å; L97-T101 VanDerWaalsContact O-N 3.14Å; L97-T101 PolarHBondContact O-OG1 2.93Å
98	V	84.5	Confident	78.9	Confident	75 Å²	75	75.2 Å²	75.2	46%	0.455	41%	0.405	S	S	.	.	H	α-helix	trans	-64.5	-50.9	173.9	171.6	0	0	0	0	109.9	L94 V95 E96 E100 T101 W102	L94-V98 WeakPolarHBondContact O-CG2 3.46Å; L94-V98 PolarHBondContact O-N 3.46Å; L94-V98 VanDerWaalsContact O-N 3.11Å; V95-V98 PolarHBondContact O-N 3.22Å; E96-V98 VanDerWaalsContact C-N 3.27Å; E96-V98 PolarHBondContact O-N 2.85Å; V98-E100 PolarHBondContact O-N 2.95Å; V98-T101 WeakPolarHBondContact CA-OG1 3.39Å; V98-T101 PolarHBondContact O-N 3.05Å; V98-T101 VanDerWaalsContact O-N 3.16Å; V98-T101 PolarHBondContact O-OG1 3.01Å; V98-W102 VanDerWaalsContact CG1-CD1 3.49Å; V98-W102 PolarHBondContact O-N 3.33Å; V98-W102 VanDerWaalsContact O-N 3.08Å
99	G	79.8	Confident	78.2	Confident	30 Å²	30	76.8 Å²	76.8	31%	0.309	41%	0.411	S	S	.	.	H	α-helix	trans	-54.5	-48.5	179.6	0	0	0	0	0	114.2	V95 E96 T101 W102 F103	V95-G99 PolarHBondContact O-N 3.33Å; E96-G99 PolarHBondContact O-N 3.5Å; G99-T101 VanDerWaalsContact C-N 3.33Å; G99-T101 PolarHBondContact O-N 3.4Å; G99-W102 PolarHBondContact O-N 3.42Å; G99-F103 VanDerWaalsContact O-CD2 3.23Å; G99-F103 WeakPolarHBondContact O-CD2 3.43Å
100	E	68.9	Low	77.4	Confident	79 Å²	79	78.3 Å²	78.3	37%	0.369	40%	0.402	S	S	.	.	H	α-helix	trans	-71	-26.6	179.6	-74	-75.3	144.4	0	0	112.8	I69 E96 V98	I69-E100 HydrophobicContact CD1-CG 4.15Å; I69-E100 HydrophobicContact CG2-CB 4.2Å; I69-E100 HydrophobicContact CG2-CG 4.37Å; E96-E100 WeakPolarHBondContact O-CB 3.44Å; E96-E100 WeakPolarHBondContact O-CG 3.37Å; E96-E100 PolarHBondContact O-N 2.96Å; V98-E100 PolarHBondContact O-N 2.95Å
101	T	59	Low	76.5	Confident	48 Å²	48	79.4 Å²	79.4	29%	0.294	41%	0.407	S	S	.	.	H	α-helix	trans	-81.4	-22.6	176.4	49.2	0	0	0	0	113.5	L79 L97 V98 G99 F103	L79-T101 HydrophobicContact CD2-CG2 3.85Å; L97-T101 WeakPolarHBondContact O-CB 3.46Å; L97-T101 VanDerWaalsContact O-CG2 3.22Å; L97-T101 WeakPolarHBondContact O-CG2 3.44Å; L97-T101 PolarHBondContact O-N 3.22Å; L97-T101 VanDerWaalsContact O-N 3.14Å; L97-T101 PolarHBondContact O-OG1 2.93Å; V98-T101 WeakPolarHBondContact CA-OG1 3.39Å; V98-T101 PolarHBondContact O-N 3.05Å; V98-T101 VanDerWaalsContact O-N 3.16Å; V98-T101 PolarHBondContact O-OG1 3.01Å; G99-T101 VanDerWaalsContact C-N 3.33Å; G99-T101 PolarHBondContact O-N 3.4Å; T101-F103 PolarHBondContact O-N 2.89Å
102	W	55	Low	75.4	Confident	200 Å²	200	84.5 Å²	84.5	76%	0.758	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.4	-18.3	175	-76.5	108.8	0	0	0	114.2	V98 G99	V98-W102 VanDerWaalsContact CG1-CD1 3.49Å; V98-W102 PolarHBondContact O-N 3.33Å; V98-W102 VanDerWaalsContact O-N 3.08Å; G99-W102 PolarHBondContact O-N 3.42Å
103	F	51.2	Low	74.2	Confident	191 Å²	191	88.8 Å²	88.8	84%	0.838	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.9	6	-179	-65.2	-69.7	0	0	0	114.3	G99 T101	G99-F103 VanDerWaalsContact O-CD2 3.23Å; G99-F103 WeakPolarHBondContact O-CD2 3.43Å; T101-F103 PolarHBondContact O-N 2.89Å
104	L	48.4	Very low	72.8	Confident	156 Å²	156	94.5 Å²	94.5	82%	0.817	48%	0.476	S	S	*	.			trans	-104.9	0	174.1	-77.7	166.5	0	0	0	111.4	Q73	Q73-L104 HydrophobicContact CG-CD1 4.17Å

Retrieved 104 of 104 residues in 40.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).