A0A087WQA2_MOUSE Loading...

RIKEN cDNA E130114P18 gene

AlphaFold DB , UniProt , Accession A0A087WQA2, Species MOUSE (Mus musculus, Mouse), Gene E130114P18Rik, Length 101 aa.

						>A0A087WQA2_MOUSE|A0A087WQA2|E130114P18Rik
AEAWHKSQPSSRAARYMTLHCAACHPGTASLSKVCLCLVIDTLPGAQDSKGKDSGLPSRCTLALAEEAGTGAGYQKITMQDAKIERQLIVLPSCDTFQPWQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	A	30.7	Very low	33.3	Very low	124 Å²	124	107.6 Å²	107.6	100%	1.025	61%	0.613	S	S	*	*				0	-44	0	0	0	0	0	0	112.2	A3 W4	A1-A3 PolarHBondContact O-N 3.13Å; A1-W4 PolarHBondContact O-N 2.87Å
2	E	25.7	Very low	34	Very low	174 Å²	174	117 Å²	117	81%	0.813	63%	0.631	S	S	*	*	H	α-helix	trans	-66.3	-32	-177	-74.3	176.7	118	0	0	115.8	W4 H5	E2-W4 PolarHBondContact O-N 3.25Å; E2-H5 PolarHBondContact O-N 3.42Å
3	A	29.7	Very low	34.4	Very low	85 Å²	85	109.5 Å²	109.5	70%	0.702	60%	0.595	S	S	*	*	H	α-helix	trans	-66.5	-24.2	176.6	0	0	0	0	0	113.1	A1	A1-A3 PolarHBondContact O-N 3.13Å
4	W	31.3	Very low	34.8	Very low	129 Å²	129	103.8 Å²	103.8	49%	0.489	57%	0.57	S	S	.	*	H	α-helix	trans	-79	-21	-177.2	-161.8	51.7	0	0	0	113.1	A1 E2 Q8 T18	A1-W4 PolarHBondContact O-N 2.87Å; E2-W4 PolarHBondContact O-N 3.25Å; W4-Q8 VanDerWaalsContact O-CG 3.24Å; W4-Q8 WeakPolarHBondContact O-CG 3.3Å; W4-T18 HydrophobicContact CZ2-CG2 4.49Å
5	H	29.6	Very low	35.3	Very low	138 Å²	138	105.3 Å²	105.3	64%	0.639	56%	0.564	S	S	*	*	H	α-helix	trans	-81.5	-24.5	179.9	-82.1	-123.7	0	0	0	113	E2	E2-H5 PolarHBondContact O-N 3.42Å
6	K	33.4	Very low	35.8	Very low	200 Å²	200	103.4 Å²	103.4	87%	0.87	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.7	-14.6	-177.1	-72.6	-176	178.1	178.6	0	114.3
7	S	36.6	Very low	36.5	Very low	81 Å²	81	98.9 Å²	98.9	57%	0.566	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-118.9	19.4	-178.7	55.8	0	0	0	0	113	P9	S7-P9 WeakPolarHBondContact O-CD 3.47Å
8	Q	33.8	Very low	37	Very low	47 Å²	47	94.1 Å²	94.1	22%	0.22	50%	0.497	C	S	.	.			trans	-68.8	123.5	173.3	-67.1	-128.6	-21.2	0	0	108.8	W4 S10 R15	W4-Q8 VanDerWaalsContact O-CG 3.24Å; W4-Q8 WeakPolarHBondContact O-CG 3.3Å; Q8-S10 PolarHBondContact O-N 3.06Å; Q8-R15 HydrophobicContact CB-CG 4.46Å
9	P	40.2	Very low	37.3	Very low	38 Å²	38	94.3 Å²	94.3	25%	0.247	50%	0.499	C	S	.	.			trans	-62.7	141.1	179.5	27.9	-35.2	0	0	0	109.4	S7 S11 A14	S7-P9 WeakPolarHBondContact O-CD 3.47Å; P9-S11 PolarHBondContact O-N 3.25Å; P9-A14 HydrophobicContact CB-CB 3.31Å; P9-A14 VanDerWaalsContact CG-C 3.4Å; P9-A14 HydrophobicContact CG-CB 3.23Å
10	S	38.2	Very low	37.7	Very low	130 Å²	130	92.2 Å²	92.2	91%	0.909	49%	0.485	S	S	*	.	S	Bend	trans	-66.1	-24	-167.5	50.3	0	0	0	0	113.6	Q8	Q8-S10 PolarHBondContact O-N 3.06Å
11	S	37.3	Very low	38	Very low	38 Å²	38	89 Å²	89	27%	0.266	47%	0.471	S	S	.	.	S	Bend	trans	-87.7	142	177.8	83.7	0	0	0	0	111.8	P9 A13 A14 R15 E67	P9-S11 PolarHBondContact O-N 3.25Å; S11-A13 PolarHBondContact O-N 2.84Å; S11-A14 PolarHBondContact O-N 3.35Å; S11-A14 VanDerWaalsContact O-N 3.14Å; S11-A14 WeakPolarHBondContact OG-CB 3.4Å; S11-A14 PolarHBondContact OG-N 3.17Å; S11-R15 PolarHBondContact O-N 2.88Å; S11-R15 VanDerWaalsContact O-N 3.09Å; S11-E67 PolarHBondContact OG-OE1 3.14Å
12	R	41.2	Very low	38.5	Very low	220 Å²	220	85.6 Å²	85.6	83%	0.83	44%	0.443	S	S	*	.	H	α-helix	trans	-57.7	-35.9	176.5	-171.9	177.8	-176.9	172.7	0.3	111.5	R15 Y16	R12-R15 PolarHBondContact O-N 3.43Å; R12-Y16 WeakPolarHBondContact O-CB 3.41Å; R12-Y16 PolarHBondContact O-N 3.16Å
13	A	39.8	Very low	39.3	Very low	19 Å²	19	81.1 Å²	81.1	16%	0.157	44%	0.435	C	S	.	.	H	α-helix	trans	-60.9	-50	175	0	0	0	0	0	110.8	S11 R15 Y16 M17 E67	S11-A13 PolarHBondContact O-N 2.84Å; A13-R15 VanDerWaalsContact C-N 3.31Å; A13-R15 PolarHBondContact O-N 3.15Å; A13-Y16 WeakPolarHBondContact O-CB 3.19Å; A13-Y16 PolarHBondContact O-N 3.21Å; A13-M17 WeakPolarHBondContact O-CB 3.32Å; A13-M17 WeakPolarHBondContact O-CG 3.49Å; A13-M17 PolarHBondContact O-N 3.07Å; A13-E67 HydrophobicContact CB-CG 4.06Å
14	A	40	Very low	39.6	Very low	30 Å²	30	81.7 Å²	81.7	25%	0.248	43%	0.433	C	S	.	.	H	α-helix	trans	-66.2	-32.8	-179	0	0	0	0	0	112.7	P9 S11 T18	P9-A14 HydrophobicContact CB-CB 3.31Å; P9-A14 VanDerWaalsContact CG-C 3.4Å; P9-A14 HydrophobicContact CG-CB 3.23Å; S11-A14 PolarHBondContact O-N 3.35Å; S11-A14 VanDerWaalsContact O-N 3.14Å; S11-A14 WeakPolarHBondContact OG-CB 3.4Å; S11-A14 PolarHBondContact OG-N 3.17Å; A14-T18 WeakPolarHBondContact O-CB 3.18Å; A14-T18 PolarHBondContact O-N 3.43Å; A14-T18 PolarHBondContact O-OG1 3.22Å
15	R	42.8	Very low	40.1	Very low	127 Å²	127	80.9 Å²	80.9	48%	0.479	43%	0.434	S	S	.	.	H	α-helix	trans	-63.2	-43	169	-79.4	178.4	152.2	173.7	-0.7	112.4	Q8 S11 R12 A13 T18 L19	Q8-R15 HydrophobicContact CB-CG 4.46Å; S11-R15 PolarHBondContact O-N 2.88Å; S11-R15 VanDerWaalsContact O-N 3.09Å; R12-R15 PolarHBondContact O-N 3.43Å; A13-R15 VanDerWaalsContact C-N 3.31Å; A13-R15 PolarHBondContact O-N 3.15Å; R15-T18 PolarHBondContact O-N 3.3Å; R15-L19 PolarHBondContact O-N 3.45Å
16	Y	43.4	Very low	40.6	Very low	75 Å²	75	79.9 Å²	79.9	29%	0.294	44%	0.44	S	S	.	.	H	α-helix	trans	-67	-41.7	-179.1	-151	-94.7	0	0	0	111.6	R12 A13 L19 H20	R12-Y16 WeakPolarHBondContact O-CB 3.41Å; R12-Y16 PolarHBondContact O-N 3.16Å; A13-Y16 WeakPolarHBondContact O-CB 3.19Å; A13-Y16 PolarHBondContact O-N 3.21Å; Y16-L19 PolarHBondContact O-N 3.49Å; Y16-H20 AromaticContact CD1-CD2 3.52Å; Y16-H20 AromaticContact CD1-NE2 3.89Å; Y16-H20 AromaticContact CE1-CD2 3.19Å; Y16-H20 WeakPolarHBondContact CE1-CD2 3.19Å; Y16-H20 AromaticContact CE1-NE2 3.19Å; Y16-H20 WeakPolarHBondContact CE1-NE2 2.96Å; Y16-H20 AromaticContact CZ-CD2 3.88Å; Y16-H20 AromaticContact CZ-NE2 3.35Å; Y16-H20 VanDerWaalsContact CZ-NE2 3.35Å; Y16-H20 PolarHBondContact O-N 3.01Å; Y16-H20 PolarHBondContact OH-NE2 2.75Å
17	M	46.8	Very low	40.7	Very low	27 Å²	27	74.1 Å²	74.1	13%	0.133	44%	0.437	C	S	.	.	H	α-helix	trans	-67.5	-39.1	175.8	-63.3	-59	-83	0	0	111.9	A13 H20 C21 L36 L38	A13-M17 WeakPolarHBondContact O-CB 3.32Å; A13-M17 WeakPolarHBondContact O-CG 3.49Å; A13-M17 PolarHBondContact O-N 3.07Å; M17-H20 PolarHBondContact O-N 3.34Å; M17-C21 WeakPolarHBondContact O-CB 3.24Å; M17-C21 PolarHBondContact O-N 3.02Å; M17-L36 HydrophobicContact CB-CD1 4.29Å; M17-L36 HydrophobicContact CE-CD1 3.21Å; M17-L36 HydrophobicContact CE-CD2 2.92Å; M17-L36 HydrophobicContact CE-CG 3.49Å; M17-L36 VanDerWaalsContact CE-CG 3.49Å; M17-L38 HydrophobicContact CE-CD1 3.34Å; M17-L38 HydrophobicContact SD-CD1 4.11Å
18	T	44.9	Very low	40.9	Very low	11 Å²	11	74.5 Å²	74.5	7%	0.067	44%	0.437	C	S	.	.	H	α-helix	trans	-60.3	-47.2	172.7	-58.9	0	0	0	0	111.4	W4 A14 R15 H20 A22 L31	W4-T18 HydrophobicContact CZ2-CG2 4.49Å; A14-T18 WeakPolarHBondContact O-CB 3.18Å; A14-T18 PolarHBondContact O-N 3.43Å; A14-T18 PolarHBondContact O-OG1 3.22Å; R15-T18 PolarHBondContact O-N 3.3Å; T18-H20 PolarHBondContact O-N 3.41Å; T18-A22 WeakPolarHBondContact O-CB 3.43Å; T18-A22 PolarHBondContact O-N 3.4Å; T18-L31 HydrophobicContact CG2-CD1 3.59Å; T18-L31 HydrophobicContact CG2-CD2 3.97Å; T18-L31 HydrophobicContact CG2-CG 4.27Å; T18-L31 WeakPolarHBondContact OG1-CD1 3.49Å; T18-L31 VanDerWaalsContact OG1-CD2 3.24Å; T18-L31 WeakPolarHBondContact OG1-CD2 3.27Å
19	L	43.3	Very low	41	Very low	99 Å²	99	77.6 Å²	77.6	52%	0.518	47%	0.47	S	S	.	.	H	α-helix	trans	-65.8	-36	-178.9	-96.9	149.3	0	0	0	113.1	R15 Y16	R15-L19 PolarHBondContact O-N 3.45Å; Y16-L19 PolarHBondContact O-N 3.49Å
20	H	46.2	Very low	40.9	Very low	51 Å²	51	78.1 Å²	78.1	24%	0.236	48%	0.475	C	S	.	.	H	α-helix	trans	-91.6	-35.2	-176.3	-70.4	-21.5	0	0	0	113.7	Y16 M17 T18 L56	Y16-H20 AromaticContact CD1-CD2 3.52Å; Y16-H20 AromaticContact CD1-NE2 3.89Å; Y16-H20 AromaticContact CE1-CD2 3.19Å; Y16-H20 WeakPolarHBondContact CE1-CD2 3.19Å; Y16-H20 AromaticContact CE1-NE2 3.19Å; Y16-H20 WeakPolarHBondContact CE1-NE2 2.96Å; Y16-H20 AromaticContact CZ-CD2 3.88Å; Y16-H20 AromaticContact CZ-NE2 3.35Å; Y16-H20 VanDerWaalsContact CZ-NE2 3.35Å; Y16-H20 PolarHBondContact O-N 3.01Å; Y16-H20 PolarHBondContact OH-NE2 2.75Å; M17-H20 PolarHBondContact O-N 3.34Å; T18-H20 PolarHBondContact O-N 3.41Å; H20-L56 HydrophobicContact CB-CD2 4.31Å
21	C	42.5	Very low	40.7	Very low	27 Å²	27	75.8 Å²	75.8	18%	0.182	45%	0.452	C	S	.	.	H	α-helix	trans	-77.2	-31.1	174.2	-66.4	0	0	0	0	112.5	M17 A23 C24 H25	M17-C21 WeakPolarHBondContact O-CB 3.24Å; M17-C21 PolarHBondContact O-N 3.02Å; C21-A23 PolarHBondContact O-N 3.03Å; C21-C24 PolarHBondContact O-N 3.47Å; C21-C24 VanDerWaalsContact O-N 3.16Å; C21-H25 PolarHBondContact O-CD2 2.95Å; C21-H25 PolarHBondContact O-N 3.42Å
22	A	42.4	Very low	40.5	Very low	52 Å²	52	79 Å²	79	43%	0.43	47%	0.474	S	S	.	.	H	α-helix	trans	-66.7	-26.3	175.5	0	0	0	0	0	112.9	T18 H25	T18-A22 WeakPolarHBondContact O-CB 3.43Å; T18-A22 PolarHBondContact O-N 3.4Å; A22-H25 CarbonylContact O-C 3.47Å
23	A	41	Very low	40	Very low	79 Å²	79	77.1 Å²	77.1	65%	0.653	47%	0.472	S	S	*	.	H	α-helix	trans	-70	-34.5	173.2	0	0	0	0	0	112.1	C21	C21-A23 PolarHBondContact O-N 3.03Å
24	C	37.8	Very low	39.7	Very low	98 Å²	98	77.9 Å²	77.9	66%	0.662	47%	0.474	S	S	*	.	H	α-helix	trans	-83.8	-23.7	176.4	-62.1	0	0	0	0	113.3	C21	C21-C24 PolarHBondContact O-N 3.47Å; C21-C24 VanDerWaalsContact O-N 3.16Å
25	H	40	Very low	39.4	Very low	111 Å²	111	78.9 Å²	78.9	51%	0.514	48%	0.479	S	S	.	.	S	Bend	trans	-128.1	69.9	-177.7	-58.8	-73.7	0	0	0	112.1	C21 A22 G27 T28	C21-H25 PolarHBondContact O-CD2 2.95Å; C21-H25 PolarHBondContact O-N 3.42Å; A22-H25 CarbonylContact O-C 3.47Å; H25-G27 PolarHBondContact O-N 2.86Å; H25-G27 VanDerWaalsContact O-N 3.15Å; H25-T28 PolarHBondContact O-OG1 3.45Å
26	P	40.5	Very low	39.3	Very low	117 Å²	117	73.7 Å²	73.7	76%	0.76	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.5	115.6	174.8	25.8	-31.5	0	0	0	110.2
27	G	36.9	Very low	39	Very low	79 Å²	79	73 Å²	73	81%	0.814	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	121.5	-8.6	172.7	0	0	0	0	0	116.4	H25 A29	H25-G27 PolarHBondContact O-N 2.86Å; H25-G27 VanDerWaalsContact O-N 3.15Å; G27-A29 PolarHBondContact O-N 3.03Å; G27-A29 VanDerWaalsContact O-N 3.17Å
28	T	40.1	Very low	38.7	Very low	90 Å²	90	73.1 Å²	73.1	55%	0.552	47%	0.467	S	S	*	.			trans	-83.2	94.6	175.5	37.6	0	0	0	0	110.9	H25 S30	H25-T28 PolarHBondContact O-OG1 3.45Å; T28-S30 PolarHBondContact O-N 3.5Å
29	A	36	Very low	38.5	Very low	112 Å²	112	76.8 Å²	76.8	93%	0.926	49%	0.49	S	S	*	.			trans	-69.4	5.5	-175.6	0	0	0	0	0	115.8	G27	G27-A29 PolarHBondContact O-N 3.03Å; G27-A29 VanDerWaalsContact O-N 3.17Å
30	S	37	Very low	38.5	Very low	48 Å²	48	73 Å²	73	34%	0.336	47%	0.469	S	S	.	.			trans	-139	95	-172.1	-155.4	0	0	0	0	110.6	T28 S32 K33	T28-S30 PolarHBondContact O-N 3.5Å; S30-S32 PolarHBondContact O-N 3Å; S30-S32 VanDerWaalsContact O-N 3.14Å; S30-S32 PolarHBondContact OG-OG 2.95Å; S30-K33 PolarHBondContact O-N 2.83Å
31	L	34.8	Very low	38.1	Very low	82 Å²	82	74.4 Å²	74.4	43%	0.429	48%	0.479	S	S	.	.	G	3₁₀ helix	trans	-54.5	-26.7	169.9	-77.9	155.7	0	0	0	112.6	T18 K33 V34	T18-L31 HydrophobicContact CG2-CD1 3.59Å; T18-L31 HydrophobicContact CG2-CD2 3.97Å; T18-L31 HydrophobicContact CG2-CG 4.27Å; T18-L31 WeakPolarHBondContact OG1-CD1 3.49Å; T18-L31 VanDerWaalsContact OG1-CD2 3.24Å; T18-L31 WeakPolarHBondContact OG1-CD2 3.27Å; L31-K33 PolarHBondContact O-N 3.14Å; L31-V34 HydrophobicContact CD2-CG2 4.47Å; L31-V34 PolarHBondContact O-N 2.91Å
32	S	33.1	Very low	38	Very low	105 Å²	105	75.2 Å²	75.2	73%	0.734	48%	0.483	S	S	*	.	G	3₁₀ helix	trans	-67	-7.3	172.2	52.8	0	0	0	0	114.8	S30	S30-S32 PolarHBondContact O-N 3Å; S30-S32 VanDerWaalsContact O-N 3.14Å; S30-S32 PolarHBondContact OG-OG 2.95Å
33	K	31	Very low	37.3	Very low	180 Å²	180	77.3 Å²	77.3	78%	0.783	49%	0.487	S	S	*	.	G	3₁₀ helix	trans	-117.6	3.4	173.1	-67.9	-161.4	176.3	-172	0	113.4	S30 L31 C35	S30-K33 PolarHBondContact O-N 2.83Å; L31-K33 PolarHBondContact O-N 3.14Å; K33-C35 VanDerWaalsContact C-N 3.28Å; K33-C35 PolarHBondContact O-N 3.02Å
34	V	34.1	Very low	36.9	Very low	35 Å²	35	79.6 Å²	79.6	21%	0.212	50%	0.495	C	S	.	.			trans	-77.5	90.9	176.9	179.5	0	0	0	0	107	L31 L36	L31-V34 HydrophobicContact CD2-CG2 4.47Å; L31-V34 PolarHBondContact O-N 2.91Å; V34-L36 HydrophobicContact CG1-CD1 4.2Å; V34-L36 PolarHBondContact O-N 3.25Å; V34-L36 VanDerWaalsContact O-N 3.13Å
35	C	32.9	Very low	36.4	Very low	52 Å²	52	78.2 Å²	78.2	35%	0.351	50%	0.497	S	S	.	.			trans	-63.6	112.6	165.4	-115.5	0	0	0	0	108	K33 C37 C94	K33-C35 VanDerWaalsContact C-N 3.28Å; K33-C35 PolarHBondContact O-N 3.02Å; C35-C37 PolarHBondContact O-N 2.98Å; C35-C94 WeakPolarHBondContact CA-SG 3.45Å; C35-C94 HydrophobicContact CB-CB 4.48Å; C35-C94 WeakPolarHBondContact CB-SG 3.41Å; C35-C94 WeakPolarHBondContact SG-CA 3.24Å; C35-C94 WeakPolarHBondContact SG-CB 3.2Å; C35-C94 CovalentContact SG-SG 2.05Å; C35-C94 PolarHBondContact SG-SG 3.47Å
36	L	40.2	Very low	36.2	Very low	18 Å²	18	76.4 Å²	76.4	9%	0.094	50%	0.501	C	S	.	.			trans	-96.9	95.9	-165.5	-161.7	122.6	0	0	0	108.9	M17 V34 L38 L91	M17-L36 HydrophobicContact CB-CD1 4.29Å; M17-L36 HydrophobicContact CE-CD1 3.21Å; M17-L36 HydrophobicContact CE-CD2 2.92Å; M17-L36 HydrophobicContact CE-CG 3.49Å; M17-L36 VanDerWaalsContact CE-CG 3.49Å; V34-L36 HydrophobicContact CG1-CD1 4.2Å; V34-L36 PolarHBondContact O-N 3.25Å; V34-L36 VanDerWaalsContact O-N 3.13Å; L36-L38 HydrophobicContact CD2-CB 4.31Å; L36-L38 HydrophobicContact CD2-CD1 3.84Å; L36-L91 HydrophobicContact CB-CD1 4.23Å; L36-L91 HydrophobicContact CD2-CD1 4.22Å
37	C	36.7	Very low	35.8	Very low	60 Å²	60	79.3 Å²	79.3	41%	0.405	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	94.4	172.9	-67.7	0	0	0	0	108.1	C35 L88 F97	C35-C37 PolarHBondContact O-N 2.98Å; C37-L88 HydrophobicContact CB-CD1 4.05Å; C37-F97 WeakPolarHBondContact SG-CD2 3.15Å; C37-F97 WeakPolarHBondContact SG-CE2 3.03Å
38	L	42.3	Very low	35.6	Very low	30 Å²	30	81.9 Å²	81.9	16%	0.157	50%	0.5	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.6	106.2	175.1	-137.4	118	0	0	0	108.6	M17 L36 I40 C60 L64 L88	M17-L38 HydrophobicContact CE-CD1 3.34Å; M17-L38 HydrophobicContact SD-CD1 4.11Å; L36-L38 HydrophobicContact CD2-CB 4.31Å; L36-L38 HydrophobicContact CD2-CD1 3.84Å; L38-I40 HydrophobicContact CD2-CD1 4.34Å; L38-I40 HydrophobicContact CD2-CG1 3.87Å; L38-I40 PolarHBondContact O-N 2.9Å; L38-C60 HydrophobicContact CD2-CB 3.97Å; L38-L64 HydrophobicContact CD1-CD1 4.04Å; L38-L64 HydrophobicContact CD2-CD1 3.86Å; L38-L64 HydrophobicContact CG-CD1 4.35Å; L38-L88 WeakPolarHBondContact O-CA 3.36Å
39	V	39.1	Very low	35.1	Very low	88 Å²	88	82.8 Å²	82.8	53%	0.533	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.9	109.6	172	-179.3	0	0	0	0	107.6	R86 L88	V39-R86 HydrophobicContact CG1-CB 4.25Å; V39-R86 HydrophobicContact CG1-CG 4.18Å; V39-L88 HydrophobicContact CG2-CD1 3.78Å
40	I	44.2	Very low	34.7	Very low	18 Å²	18	87.1 Å²	87.1	9%	0.092	51%	0.508	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.4	110.2	173.8	-55	174.2	0	0	0	107.3	L38 T42 R86 Q87 I89	L38-I40 HydrophobicContact CD2-CD1 4.34Å; L38-I40 HydrophobicContact CD2-CG1 3.87Å; L38-I40 PolarHBondContact O-N 2.9Å; I40-T42 HydrophobicContact CG2-CG2 4.11Å; I40-T42 PolarHBondContact O-N 2.99Å; I40-T42 VanDerWaalsContact O-N 3.14Å; I40-R86 CarbonylContact O-C 3.59Å; I40-R86 VanDerWaalsContact O-CA 3.27Å; I40-R86 WeakPolarHBondContact O-CA 3.46Å; I40-Q87 HydrophobicContact CB-CB 4.45Å; I40-Q87 WeakPolarHBondContact CB-O 3.4Å; I40-Q87 PolarHBondContact N-O 3.48Å; I40-Q87 PolarHBondContact O-N 2.95Å; I40-I89 HydrophobicContact CD1-CD1 4.01Å
41	D	38.1	Very low	34.4	Very low	82 Å²	82	87.7 Å²	87.7	44%	0.439	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.1	102.1	165.9	-74.4	-48.4	0	0	0	108.5	L43 I84 R86	D41-L43 PolarHBondContact O-N 2.68Å; D41-I84 HydrophobicContact CB-CG2 4.31Å; D41-R86 WeakPolarHBondContact OD1-CD 3.5Å; D41-R86 VanDerWaalsContact OD1-CG 3.3Å; D41-R86 WeakPolarHBondContact OD1-CG 3.18Å; D41-R86 IonicContact OD1-CZ 3.66Å; D41-R86 IonicContact OD1-NE 3.86Å; D41-R86 PolarHBondContact OD1-NE 3.48Å; D41-R86 IonicContact OD1-NH2 2.75Å
42	T	39.2	Very low	34.1	Very low	44 Å²	44	92.6 Å²	92.6	27%	0.27	54%	0.539	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.9	82.6	167.9	39.4	0	0	0	0	108.4	I40 E85	I40-T42 HydrophobicContact CG2-CG2 4.11Å; I40-T42 PolarHBondContact O-N 2.99Å; I40-T42 VanDerWaalsContact O-N 3.14Å; T42-E85 WeakPolarHBondContact CA-O 3.44Å; T42-E85 PolarHBondContact N-O 3.46Å; T42-E85 PolarHBondContact OG1-O 2.77Å
43	L	28.3	Very low	34	Very low	96 Å²	96	94.7 Å²	94.7	50%	0.503	54%	0.542	S	S	.	.			trans	-70.9	136.6	167.4	-77.2	167.5	0	0	0	109.5	D41 G45 A46 I84	D41-L43 PolarHBondContact O-N 2.68Å; L43-G45 PolarHBondContact O-N 3.16Å; L43-A46 HydrophobicContact CB-CB 4.41Å; L43-A46 WeakPolarHBondContact O-CB 3.16Å; L43-A46 PolarHBondContact O-N 3.09Å; L43-I84 HydrophobicContact CD2-CD1 4.13Å; L43-I84 HydrophobicContact CD2-CG1 3.93Å; L43-I84 HydrophobicContact CD2-CG2 4.15Å; L43-I84 HydrophobicContact CG-CG2 4.46Å
44	P	31.7	Very low	33.9	Very low	126 Å²	126	91.7 Å²	91.7	82%	0.818	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.4	105.6	168	-6.9	20.6	0	0	0	107.7
45	G	28.8	Very low	33.7	Very low	70 Å²	70	93.7 Å²	93.7	72%	0.722	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	117.6	0.5	-173.2	0	0	0	0	0	115.2	L43 Q47	L43-G45 PolarHBondContact O-N 3.16Å; G45-Q47 PolarHBondContact O-N 3.46Å
46	A	36.3	Very low	33.8	Very low	72 Å²	72	95.9 Å²	95.9	60%	0.595	58%	0.579	S	S	*	*			trans	-73.7	54.1	168.2	0	0	0	0	0	111.8	L43	L43-A46 HydrophobicContact CB-CB 4.41Å; L43-A46 WeakPolarHBondContact O-CB 3.16Å; L43-A46 PolarHBondContact O-N 3.09Å
47	Q	31.6	Very low	33.9	Very low	179 Å²	179	100.4 Å²	100.4	84%	0.836	61%	0.609	S	S	*	*	S	Bend	trans	-93.4	107.1	159.5	-76.8	-173.5	-54.7	0	0	107.1	G45 S49	G45-Q47 PolarHBondContact O-N 3.46Å; Q47-S49 PolarHBondContact O-N 3.14Å
48	D	32.8	Very low	33.8	Very low	132 Å²	132	100.8 Å²	100.8	71%	0.706	61%	0.612	S	S	*	*			trans	41.9	65.1	155	-83.1	-48.6	0	0	0	117.2	K50	D48-K50 VanDerWaalsContact C-N 3.27Å; D48-K50 PolarHBondContact O-N 3.29Å
49	S	28.7	Very low	33.3	Very low	109 Å²	109	108.2 Å²	108.2	76%	0.762	64%	0.638	S	S	*	*			trans	-78.8	84.5	155.5	47	0	0	0	0	109.5	Q47 G51	Q47-S49 PolarHBondContact O-N 3.14Å; S49-G51 PolarHBondContact O-N 3.25Å; S49-G51 VanDerWaalsContact O-N 3.13Å
50	K	28.7	Very low	33	Very low	204 Å²	204	104.7 Å²	104.7	89%	0.887	62%	0.618	S	S	*	*			trans	-59.7	110	157	-85.4	-174	177.7	176.8	0	108.4	D48	D48-K50 VanDerWaalsContact C-N 3.27Å; D48-K50 PolarHBondContact O-N 3.29Å
51	G	29.4	Very low	32.8	Very low	59 Å²	59	106.9 Å²	106.9	61%	0.608	63%	0.632	S	S	*	*			trans	94.8	134.1	173.5	0	0	0	0	0	111.2	S49	S49-G51 PolarHBondContact O-N 3.25Å; S49-G51 VanDerWaalsContact O-N 3.13Å
52	K	29.2	Very low	32.6	Very low	186 Å²	186	108.4 Å²	108.4	81%	0.809	64%	0.639	S	S	*	*			cis	-153.4	155.4	24.1	-87.2	169.7	168.8	177.5	0	107.8
53	D	30.5	Very low	32.4	Very low	148 Å²	148	108 Å²	108	79%	0.791	64%	0.64	S	S	*	*	S	Bend	trans	66.4	118.7	164.4	-60.1	-47.6	0	0	0	116.7
54	S	30	Very low	32.9	Very low	117 Å²	117	104.5 Å²	104.5	82%	0.818	62%	0.622	S	S	*	*	S	Bend	trans	80.2	43.2	174.3	74.5	0	0	0	0	119.2	L56	S54-L56 PolarHBondContact O-N 2.99Å
55	G	29.1	Very low	33.1	Very low	77 Å²	77	101.5 Å²	101.5	79%	0.794	61%	0.608	S	S	*	*				75.1	-14.2	124.3	0	0	0	0	0	122.1
56	L	34.7	Very low	33.4	Very low	98 Å²	98	105.2 Å²	105.2	51%	0.513	61%	0.607	S	S	.	*			trans	-170.9	145.1	173.8	-84.5	124.9	0	0	0	106.8	H20 S54	H20-L56 HydrophobicContact CB-CD2 4.31Å; S54-L56 PolarHBondContact O-N 2.99Å
57	P	41.7	Very low	33.5	Very low	114 Å²	114	105.8 Å²	105.8	74%	0.74	60%	0.597	S	S	*	*	S	Bend	cis	-139.2	142.8	19.3	38.1	-17	0	0	0	116
58	S	34.6	Very low	33.8	Very low	67 Å²	67	99.1 Å²	99.1	47%	0.469	57%	0.572	S	S	.	*	S	Bend	trans	-164.3	-26.7	159.8	64.4	0	0	0	0	111	T61	S58-T61 PolarHBondContact O-N 3.43Å
59	R	33	Very low	33.8	Very low	186 Å²	186	96 Å²	96	70%	0.702	57%	0.572	S	S	*	*	H	α-helix	trans	-74	-23.1	177	-76.8	-178.2	162.2	-176	-4.9	115.5	T61 L62 A63	R59-T61 VanDerWaalsContact C-N 3.29Å; R59-T61 PolarHBondContact O-N 3.5Å; R59-L62 PolarHBondContact O-N 2.85Å; R59-A63 PolarHBondContact O-N 3.29Å
60	C	33.6	Very low	34.2	Very low	15 Å²	15	95.7 Å²	95.7	10%	0.101	57%	0.566	C	S	.	*	H	α-helix	trans	-66.1	-34.7	174.4	-70.4	0	0	0	0	111.6	L38 L62 A63 L64	L38-C60 HydrophobicContact CD2-CB 3.97Å; C60-L62 PolarHBondContact O-N 2.65Å; C60-A63 PolarHBondContact O-N 3.47Å; C60-L64 WeakPolarHBondContact O-CB 3.4Å; C60-L64 PolarHBondContact O-N 3.03Å; C60-L64 VanDerWaalsContact O-N 3.09Å
61	T	38.6	Very low	34.4	Very low	64 Å²	64	88.4 Å²	88.4	39%	0.393	55%	0.548	S	S	.	.	H	α-helix	trans	-61.8	-41.8	177.4	-47.7	0	0	0	0	111.8	S58 R59 A65	S58-T61 PolarHBondContact O-N 3.43Å; R59-T61 VanDerWaalsContact C-N 3.29Å; R59-T61 PolarHBondContact O-N 3.5Å; T61-A65 WeakPolarHBondContact O-CB 3.19Å; T61-A65 PolarHBondContact O-N 3.5Å
62	L	33.5	Very low	34.7	Very low	113 Å²	113	90.6 Å²	90.6	59%	0.592	56%	0.56	S	S	*	*	H	α-helix	trans	-73.4	-41.8	179.5	-110.9	108.1	0	0	0	112.8	R59 C60 L64 A65 E66	R59-L62 PolarHBondContact O-N 2.85Å; C60-L62 PolarHBondContact O-N 2.65Å; L62-L64 PolarHBondContact O-N 3.32Å; L62-A65 PolarHBondContact O-N 3.23Å; L62-E66 WeakPolarHBondContact O-CB 3.43Å; L62-E66 PolarHBondContact O-N 3.09Å
63	A	36.4	Very low	35.2	Very low	35 Å²	35	84 Å²	84	29%	0.289	55%	0.546	S	S	.	.	H	α-helix	trans	-68.8	-36	-178.5	0	0	0	0	0	112.3	R59 C60 E67	R59-A63 PolarHBondContact O-N 3.29Å; C60-A63 PolarHBondContact O-N 3.47Å; A63-E67 PolarHBondContact O-N 3.19Å
64	L	38.6	Very low	35.7	Very low	23 Å²	23	81.2 Å²	81.2	12%	0.12	53%	0.525	C	S	.	.	H	α-helix	trans	-73	-35.1	172.4	-84	157.6	0	0	0	112.2	L38 C60 L62 A68 I89	L38-L64 HydrophobicContact CD1-CD1 4.04Å; L38-L64 HydrophobicContact CD2-CD1 3.86Å; L38-L64 HydrophobicContact CG-CD1 4.35Å; C60-L64 WeakPolarHBondContact O-CB 3.4Å; C60-L64 PolarHBondContact O-N 3.03Å; C60-L64 VanDerWaalsContact O-N 3.09Å; L62-L64 PolarHBondContact O-N 3.32Å; L64-A68 WeakPolarHBondContact O-CA 2.96Å; L64-A68 WeakPolarHBondContact O-CB 3.03Å; L64-A68 PolarHBondContact O-N 2.91Å; L64-I89 HydrophobicContact CB-CD1 4.12Å; L64-I89 HydrophobicContact CD1-CD1 4.26Å
65	A	35.1	Very low	36.3	Very low	63 Å²	63	82.2 Å²	82.2	52%	0.521	52%	0.517	S	S	.	.	H	α-helix	trans	-69.7	-36.4	175.3	0	0	0	0	0	112.7	T61 L62 A68 G69	T61-A65 WeakPolarHBondContact O-CB 3.19Å; T61-A65 PolarHBondContact O-N 3.5Å; L62-A65 PolarHBondContact O-N 3.23Å; A65-A68 PolarHBondContact O-N 3.13Å; A65-G69 PolarHBondContact O-N 2.84Å
66	E	35.7	Very low	37.2	Very low	148 Å²	148	84.6 Å²	84.6	69%	0.692	51%	0.505	S	S	*	.	H	α-helix	trans	-70.7	-41.2	174.1	-82	-174.7	142.2	0	0	112	L62 A68 G69	L62-E66 WeakPolarHBondContact O-CB 3.43Å; L62-E66 PolarHBondContact O-N 3.09Å; E66-A68 VanDerWaalsContact C-N 3.31Å; E66-G69 PolarHBondContact O-N 2.88Å
67	E	38.1	Very low	37.5	Very low	84 Å²	84	82.6 Å²	82.6	39%	0.393	49%	0.494	S	S	.	.	H	α-helix	trans	-71.2	-24.5	169.7	-93.8	-147.5	172.3	0	0	113	S11 A13 A63 G69 T70	S11-E67 PolarHBondContact OG-OE1 3.14Å; A13-E67 HydrophobicContact CB-CG 4.06Å; A63-E67 PolarHBondContact O-N 3.19Å; E67-G69 PolarHBondContact O-N 2.68Å; E67-T70 WeakPolarHBondContact CA-OG1 3.42Å; E67-T70 CarbonylContact O-C 3.2Å; E67-T70 WeakPolarHBondContact O-CA 3.4Å; E67-T70 PolarHBondContact O-N 3.31Å; E67-T70 VanDerWaalsContact O-O 3.12Å; E67-T70 PolarHBondContact O-OG1 2.88Å
68	A	38.1	Very low	37.6	Very low	39 Å²	39	80.7 Å²	80.7	32%	0.322	48%	0.48	S	S	.	.	T	Hydrogen-bonded Turn	trans	-72.1	-4.3	172.6	0	0	0	0	0	113.5	L64 A65 E66 T70 Y74	L64-A68 WeakPolarHBondContact O-CA 2.96Å; L64-A68 WeakPolarHBondContact O-CB 3.03Å; L64-A68 PolarHBondContact O-N 2.91Å; A65-A68 PolarHBondContact O-N 3.13Å; E66-A68 VanDerWaalsContact C-N 3.31Å; A68-T70 VanDerWaalsContact C-N 3.32Å; A68-Y74 WeakPolarHBondContact CA-OH 3.31Å; A68-Y74 HydrophobicContact CB-CE1 4.25Å; A68-Y74 HydrophobicContact CB-CE2 3.86Å; A68-Y74 PolarHBondContact O-OH 3.2Å
69	G	33.6	Very low	37.7	Very low	67 Å²	67	82 Å²	82	69%	0.691	48%	0.481	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83	-8.7	161.3	0	0	0	0	0	113.3	A65 E66 E67	A65-G69 PolarHBondContact O-N 2.84Å; E66-G69 PolarHBondContact O-N 2.88Å; E67-G69 PolarHBondContact O-N 2.68Å
70	T	35.6	Very low	37.8	Very low	103 Å²	103	81.3 Å²	81.3	63%	0.632	49%	0.485	S	S	*	.	S	Bend	trans	-138.3	76.6	-172.7	54.8	0	0	0	0	111.7	E67 A68	E67-T70 WeakPolarHBondContact CA-OG1 3.42Å; E67-T70 CarbonylContact O-C 3.2Å; E67-T70 WeakPolarHBondContact O-CA 3.4Å; E67-T70 PolarHBondContact O-N 3.31Å; E67-T70 VanDerWaalsContact O-O 3.12Å; E67-T70 PolarHBondContact O-OG1 2.88Å; A68-T70 VanDerWaalsContact C-N 3.32Å
71	G	33.7	Very low	38	Very low	51 Å²	51	85.4 Å²	85.4	53%	0.526	51%	0.506	S	S	.	.			trans	134	107	158.7	0	0	0	0	0	115.2	Y74	G71-Y74 WeakPolarHBondContact O-CE1 3.02Å
72	A	34.8	Very low	37.8	Very low	104 Å²	104	86.3 Å²	86.3	86%	0.86	52%	0.52	S	S	*	.	S	Bend	trans	-47.5	140.5	179.7	0	0	0	0	0	115.3
73	G	39.6	Very low	38.1	Very low	49 Å²	49	90.9 Å²	90.9	51%	0.505	54%	0.535	S	S	.	.			trans	133.9	0.9	156.2	0	0	0	0	0	118.5
74	Y	42.2	Very low	38	Very low	88 Å²	88	91.1 Å²	91.1	35%	0.345	53%	0.531	S	S	.	.			trans	-83.7	137.1	178	27.7	-92.5	0	0	0	112.8	A68 G71 V90	A68-Y74 WeakPolarHBondContact CA-OH 3.31Å; A68-Y74 HydrophobicContact CB-CE1 4.25Å; A68-Y74 HydrophobicContact CB-CE2 3.86Å; A68-Y74 PolarHBondContact O-OH 3.2Å; G71-Y74 WeakPolarHBondContact O-CE1 3.02Å; Y74-V90 WeakPolarHBondContact CA-O 3.5Å
75	Q	41.2	Very low	37.9	Very low	139 Å²	139	93.7 Å²	93.7	65%	0.65	54%	0.542	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.2	121.4	166	-81.7	-174.5	-9.1	0	0	109.5	V90	Q75-V90 PolarHBondContact N-O 3.45Å; Q75-V90 PolarHBondContact O-N 2.94Å; Q75-V90 VanDerWaalsContact O-N 3.15Å
76	K	48.3	Very low	38.1	Very low	126 Å²	126	93.6 Å²	93.6	55%	0.548	53%	0.529	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.5	115.1	167.9	-179	178.8	175.3	172.4	0	108.1	Q87 L88	K76-Q87 VanDerWaalsContact CE-NE2 3.27Å; K76-L88 WeakPolarHBondContact CA-O 3.46Å
77	I	42.1	Very low	38.4	Very low	57 Å²	57	88.4 Å²	88.4	29%	0.292	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	118.5	175.2	-50.9	179.6	0	0	0	107.9	M79 L88 V90	I77-M79 HydrophobicContact CG2-CG 4.2Å; I77-L88 HydrophobicContact CB-CB 4.15Å; I77-L88 HydrophobicContact CD1-CD2 4.23Å; I77-L88 PolarHBondContact N-O 3.15Å; I77-L88 PolarHBondContact O-N 3.37Å; I77-V90 HydrophobicContact CD1-CG2 4.04Å
78	T	43.2	Very low	38.7	Very low	73 Å²	73	84.9 Å²	84.9	45%	0.448	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	116.8	171.8	-59.7	0	0	0	0	108.6	E85 R86	T78-E85 HydrophobicContact CG2-CG 3.59Å; T78-R86 CarbonylContact C-O 3.59Å; T78-R86 WeakPolarHBondContact CA-O 3.37Å
79	M	37.1	Very low	39.2	Very low	96 Å²	96	84.7 Å²	84.7	47%	0.473	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	126.1	172.1	-65.3	-179.4	63.7	0	0	108.6	I77 R86	I77-M79 HydrophobicContact CG2-CG 4.2Å; M79-R86 HydrophobicContact CB-CB 4.33Å; M79-R86 PolarHBondContact N-O 2.99Å; M79-R86 PolarHBondContact O-N 3.07Å
80	Q	35.9	Very low	39.6	Very low	171 Å²	171	82.3 Å²	82.3	80%	0.799	45%	0.453	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.3	114.2	169.6	-79.1	-173.8	-9.6	0	0	108.4
81	D	37.4	Very low	40	Very low	101 Å²	101	80 Å²	80	54%	0.54	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139	135.6	170.6	-169.2	15.4	0	0	0	109.1	K83 I84 R86	D81-K83 VanDerWaalsContact C-N 3.28Å; D81-K83 PolarHBondContact O-N 2.05Å; D81-K83 VanDerWaalsContact O-N 3.07Å; D81-I84 PolarHBondContact N-O 3.37Å; D81-I84 PolarHBondContact O-N 3.46Å; D81-R86 IonicContact OD2-NH1 3.64Å
82	A	34.8	Very low	40.2	Very low	82 Å²	82	81.8 Å²	81.8	68%	0.678	44%	0.439	S	S	*	.	T	Hydrogen-bonded Turn	trans	45.1	40.5	179.1	0	0	0	0	0	116.7	I84	A82-I84 VanDerWaalsContact C-N 3.3Å; A82-I84 PolarHBondContact O-N 2.85Å
83	K	39.5	Very low	40.3	Very low	209 Å²	209	81.3 Å²	81.3	91%	0.909	43%	0.429	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.2	11.4	-178.8	-51.3	-177.4	177.8	-177.3	0	116.3	D81	D81-K83 VanDerWaalsContact C-N 3.28Å; D81-K83 PolarHBondContact O-N 2.05Å; D81-K83 VanDerWaalsContact O-N 3.07Å
84	I	33.2	Very low	40.3	Very low	41 Å²	41	79.9 Å²	79.9	21%	0.21	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	123.1	175.1	-55.8	177.5	0	0	0	107.5	D41 L43 D81 A82 R86	D41-I84 HydrophobicContact CB-CG2 4.31Å; L43-I84 HydrophobicContact CD2-CD1 4.13Å; L43-I84 HydrophobicContact CD2-CG1 3.93Å; L43-I84 HydrophobicContact CD2-CG2 4.15Å; L43-I84 HydrophobicContact CG-CG2 4.46Å; D81-I84 PolarHBondContact N-O 3.37Å; D81-I84 PolarHBondContact O-N 3.46Å; A82-I84 VanDerWaalsContact C-N 3.3Å; A82-I84 PolarHBondContact O-N 2.85Å; I84-R86 HydrophobicContact CG2-CG 4.23Å; I84-R86 PolarHBondContact O-N 3.37Å
85	E	37.1	Very low	39.9	Very low	77 Å²	77	83.3 Å²	83.3	36%	0.36	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.4	121.9	169.7	-170.6	-177.4	141.6	0	0	107.8	T42 T78 Q87	T42-E85 WeakPolarHBondContact CA-O 3.44Å; T42-E85 PolarHBondContact N-O 3.46Å; T42-E85 PolarHBondContact OG1-O 2.77Å; T78-E85 HydrophobicContact CG2-CG 3.59Å; E85-Q87 PolarHBondContact OE1-NE2 3.05Å
86	R	38.2	Very low	39.5	Very low	61 Å²	61	82.2 Å²	82.2	23%	0.23	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	131.5	175.2	-68.6	179.2	178.5	120.2	3.8	109.9	V39 I40 D41 T78 M79 D81 I84	V39-R86 HydrophobicContact CG1-CB 4.25Å; V39-R86 HydrophobicContact CG1-CG 4.18Å; I40-R86 CarbonylContact O-C 3.59Å; I40-R86 VanDerWaalsContact O-CA 3.27Å; I40-R86 WeakPolarHBondContact O-CA 3.46Å; D41-R86 WeakPolarHBondContact OD1-CD 3.5Å; D41-R86 VanDerWaalsContact OD1-CG 3.3Å; D41-R86 WeakPolarHBondContact OD1-CG 3.18Å; D41-R86 IonicContact OD1-CZ 3.66Å; D41-R86 IonicContact OD1-NE 3.86Å; D41-R86 PolarHBondContact OD1-NE 3.48Å; D41-R86 IonicContact OD1-NH2 2.75Å; T78-R86 CarbonylContact C-O 3.59Å; T78-R86 WeakPolarHBondContact CA-O 3.37Å; M79-R86 HydrophobicContact CB-CB 4.33Å; M79-R86 PolarHBondContact N-O 2.99Å; M79-R86 PolarHBondContact O-N 3.07Å; D81-R86 IonicContact OD2-NH1 3.64Å; I84-R86 HydrophobicContact CG2-CG 4.23Å; I84-R86 PolarHBondContact O-N 3.37Å
87	Q	42	Very low	38.9	Very low	39 Å²	39	79.7 Å²	79.7	18%	0.182	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	117.2	176	-64.6	-177.2	3.4	0	0	109	I40 K76 E85	I40-Q87 HydrophobicContact CB-CB 4.45Å; I40-Q87 WeakPolarHBondContact CB-O 3.4Å; I40-Q87 PolarHBondContact N-O 3.48Å; I40-Q87 PolarHBondContact O-N 2.95Å; K76-Q87 VanDerWaalsContact CE-NE2 3.27Å; E85-Q87 PolarHBondContact OE1-NE2 3.05Å
88	L	44.6	Very low	38.4	Very low	10 Å²	10	85 Å²	85	5%	0.052	45%	0.452	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	127.5	173.2	-164.2	82.8	0	0	0	108.8	C37 L38 V39 K76 I77 V90 F97	C37-L88 HydrophobicContact CB-CD1 4.05Å; L38-L88 WeakPolarHBondContact O-CA 3.36Å; V39-L88 HydrophobicContact CG2-CD1 3.78Å; K76-L88 WeakPolarHBondContact CA-O 3.46Å; I77-L88 HydrophobicContact CB-CB 4.15Å; I77-L88 HydrophobicContact CD1-CD2 4.23Å; I77-L88 PolarHBondContact N-O 3.15Å; I77-L88 PolarHBondContact O-N 3.37Å; L88-V90 HydrophobicContact CD2-CG2 3.61Å; L88-V90 HydrophobicContact CG-CG2 4.16Å; L88-F97 HydrophobicContact CD2-CD2 4.34Å; L88-F97 HydrophobicContact CD2-CE1 4.23Å; L88-F97 HydrophobicContact CD2-CE2 3.53Å; L88-F97 HydrophobicContact CD2-CZ 3.46Å; L88-F97 VanDerWaalsContact CD2-CZ 3.46Å
89	I	48.7	Very low	37.9	Very low	34 Å²	34	85.7 Å²	85.7	17%	0.174	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	113	171.1	-59.7	175.8	0	0	0	107.5	I40 L64	I40-I89 HydrophobicContact CD1-CD1 4.01Å; L64-I89 HydrophobicContact CB-CD1 4.12Å; L64-I89 HydrophobicContact CD1-CD1 4.26Å
90	V	43	Very low	37.6	Very low	18 Å²	18	93.4 Å²	93.4	11%	0.109	48%	0.481	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.7	119.8	176.6	-174.6	0	0	0	0	108.7	Y74 Q75 I77 L88 C94	Y74-V90 WeakPolarHBondContact CA-O 3.5Å; Q75-V90 PolarHBondContact N-O 3.45Å; Q75-V90 PolarHBondContact O-N 2.94Å; Q75-V90 VanDerWaalsContact O-N 3.15Å; I77-V90 HydrophobicContact CD1-CG2 4.04Å; L88-V90 HydrophobicContact CD2-CG2 3.61Å; L88-V90 HydrophobicContact CG-CG2 4.16Å; V90-C94 HydrophobicContact CG1-CB 3.97Å
91	L	42.7	Very low	37.1	Very low	54 Å²	54	97.9 Å²	97.9	28%	0.283	50%	0.502	S	S	.	.			trans	-79.9	143.8	176.5	-65	177.1	0	0	0	110.7	L36 S93 C94	L36-L91 HydrophobicContact CB-CD1 4.23Å; L36-L91 HydrophobicContact CD2-CD1 4.22Å; L91-S93 PolarHBondContact O-N 3.27Å; L91-C94 WeakPolarHBondContact O-CB 3.35Å; L91-C94 PolarHBondContact O-N 2.99Å
92	P	38.9	Very low	37.1	Very low	89 Å²	89	97.7 Å²	97.7	58%	0.578	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.4	-8	-172	22	-31.8	0	0	0	115.3	C94	P92-C94 PolarHBondContact O-N 3.27Å
93	S	37.3	Very low	37.3	Very low	93 Å²	93	98.5 Å²	98.5	65%	0.65	49%	0.491	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.5	4.3	171.4	59.7	0	0	0	0	113.7	L91 D95	L91-S93 PolarHBondContact O-N 3.27Å; S93-D95 PolarHBondContact O-N 2.81Å
94	C	38	Very low	37.1	Very low	20 Å²	20	92.4 Å²	92.4	14%	0.135	47%	0.467	C	S	.	.			trans	-92.4	88.1	177.8	-88.1	0	0	0	0	112.1	C35 V90 L91 P92 T96	C35-C94 WeakPolarHBondContact CA-SG 3.45Å; C35-C94 HydrophobicContact CB-CB 4.48Å; C35-C94 WeakPolarHBondContact CB-SG 3.41Å; C35-C94 WeakPolarHBondContact SG-CA 3.24Å; C35-C94 WeakPolarHBondContact SG-CB 3.2Å; C35-C94 CovalentContact SG-SG 2.05Å; C35-C94 PolarHBondContact SG-SG 3.47Å; V90-C94 HydrophobicContact CG1-CB 3.97Å; L91-C94 WeakPolarHBondContact O-CB 3.35Å; L91-C94 PolarHBondContact O-N 2.99Å; P92-C94 PolarHBondContact O-N 3.27Å; C94-T96 PolarHBondContact O-N 3.22Å
95	D	34.6	Very low	37.4	Very low	159 Å²	159	95.4 Å²	95.4	85%	0.85	48%	0.483	S	S	*	.	S	Bend	trans	-70.9	-10.8	174	-73.2	-35.7	0	0	0	113.3	S93	S93-D95 PolarHBondContact O-N 2.81Å
96	T	33.8	Very low	37.4	Very low	116 Å²	116	96.6 Å²	96.6	71%	0.712	49%	0.49	S	S	*	.			trans	-144	85.1	-179.7	35.4	0	0	0	0	111.4	C94	C94-T96 PolarHBondContact O-N 3.22Å
97	F	35.6	Very low	37.3	Very low	74 Å²	74	98.9 Å²	98.9	33%	0.325	51%	0.508	S	S	.	.			trans	-87.9	113.6	158.1	-178.7	-104.4	0	0	0	108.4	C37 L88 P99	C37-F97 WeakPolarHBondContact SG-CD2 3.15Å; C37-F97 WeakPolarHBondContact SG-CE2 3.03Å; L88-F97 HydrophobicContact CD2-CD2 4.34Å; L88-F97 HydrophobicContact CD2-CE1 4.23Å; L88-F97 HydrophobicContact CD2-CE2 3.53Å; L88-F97 HydrophobicContact CD2-CZ 3.46Å; L88-F97 VanDerWaalsContact CD2-CZ 3.46Å; F97-P99 HydrophobicContact CE1-CB 3.98Å; F97-P99 HydrophobicContact CZ-CB 4.47Å
98	Q	30.5	Very low	37	Very low	169 Å²	169	103.2 Å²	103.2	79%	0.79	53%	0.531	S	S	*	.	P	Polyproline II helix	trans	-100.5	120.8	161.9	-71.5	-153.5	-46.2	0	0	108.3	W100	Q98-W100 PolarHBondContact O-N 2.64Å
99	P	32.8	Very low	36.4	Very low	86 Å²	86	110.4 Å²	110.4	56%	0.558	57%	0.568	S	S	*	*	P	Polyproline II helix	trans	-59.9	137.7	173.7	24.1	-30.6	0	0	0	109.2	F97 Q101	F97-P99 HydrophobicContact CE1-CB 3.98Å; F97-P99 HydrophobicContact CZ-CB 4.47Å; P99-Q101 PolarHBondContact O-N 3.41Å; P99-Q101 VanDerWaalsContact O-N 3.16Å
100	W	31.6	Very low	35.4	Very low	259 Å²	259	116.8 Å²	116.8	98%	0.981	60%	0.6	S	S	*	*	P	Polyproline II helix	trans	-58	120.6	166.1	-93.6	23.4	0	0	0	108	Q98	Q98-W100 PolarHBondContact O-N 2.64Å
101	Q	25.7	Very low	34.7	Very low	264 Å²	264	125.7 Å²	125.7	100%	1.234	65%	0.645	S	S	*	*			trans	-82	0	166.2	-69.6	-159.7	-43.6	0	0	110.1	P99	P99-Q101 PolarHBondContact O-N 3.41Å; P99-Q101 VanDerWaalsContact O-N 3.16Å

Retrieved 101 of 101 residues in 378 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).