A0A087WQG0_MOUSE Loading...

D-2-hydroxyglutarate dehydrogenase

AlphaFold DB , UniProt , Accession A0A087WQG0, Species MOUSE (Mus musculus, Mouse), Gene D2hgdh, Length 50 aa.

						>A0A087WQG0_MOUSE|A0A087WQG0|D2hgdh
MVLPLVSRWSARVLWASPGWRRTYTQRACVGLKRLGCPRGVYSPLAHRAY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.3	Very low	53.2	Low	241 Å²	241	133.4 Å²	133.4	100%	1.187	70%	0.702	S	S	*	*				0	101.1	0	-85.3	169.7	145.9	0	0	108.2	L3	M1-L3 PolarHBondContact O-N 3.49Å
2	V	43.1	Very low	53.8	Low	141 Å²	141	134.3 Å²	134.3	86%	0.855	69%	0.689	S	S	*	*			trans	-88.7	104.9	176	175	0	0	0	0	106.8	P4	V2-P4 WeakPolarHBondContact O-CD 3.33Å
3	L	55.1	Low	54.2	Low	158 Å²	158	130.9 Å²	130.9	83%	0.827	68%	0.678	S	S	*	*			trans	-71.4	113.3	165.5	-78.7	151.5	0	0	0	106	M1 L5	M1-L3 PolarHBondContact O-N 3.49Å; L3-L5 PolarHBondContact O-N 3.07Å
4	P	56.9	Low	54.7	Low	102 Å²	102	127.1 Å²	127.1	66%	0.662	66%	0.659	S	S	*	*			trans	-62.1	121.1	178.5	25.1	-30.3	0	0	0	107	V2 V6	V2-P4 WeakPolarHBondContact O-CD 3.33Å; P4-V6 PolarHBondContact O-N 2.73Å
5	L	56.9	Low	54.9	Low	168 Å²	168	132.6 Å²	132.6	88%	0.88	67%	0.667	S	S	*	*			trans	-57.4	90.7	168.9	-125.9	85.5	0	0	0	106.1	L3 S7	L3-L5 PolarHBondContact O-N 3.07Å; L5-S7 VanDerWaalsContact C-N 3.27Å; L5-S7 PolarHBondContact O-N 3.12Å
6	V	57.3	Low	55.2	Low	100 Å²	100	129.3 Å²	129.3	61%	0.606	67%	0.667	S	S	*	*			trans	-64.4	100.7	172.2	177.3	0	0	0	0	104.5	P4 R8	P4-V6 PolarHBondContact O-N 2.73Å; V6-R8 PolarHBondContact O-N 2.82Å; V6-R8 VanDerWaalsContact O-N 3.12Å
7	S	57	Low	55.7	Low	70 Å²	70	124.1 Å²	124.1	49%	0.49	64%	0.644	S	S	.	*			trans	-43.4	123.7	-179.7	-65.1	0	0	0	0	108.3	L5 W9 S10 A11	L5-S7 VanDerWaalsContact C-N 3.27Å; L5-S7 PolarHBondContact O-N 3.12Å; S7-W9 CarbonylContact O-C 3.52Å; S7-W9 PolarHBondContact O-N 3.48Å; S7-S10 WeakPolarHBondContact O-CB 3.45Å; S7-S10 PolarHBondContact O-N 3.41Å; S7-A11 PolarHBondContact O-N 3.14Å
8	R	56.7	Low	55.9	Low	193 Å²	193	123.3 Å²	123.3	73%	0.728	65%	0.648	S	S	*	*	H	α-helix	trans	-48.8	-23	-178.3	-162	176.7	-166.3	-174.4	5.6	113	V6 R12	V6-R8 PolarHBondContact O-N 2.82Å; V6-R8 VanDerWaalsContact O-N 3.12Å; R8-R12 PolarHBondContact O-N 2.81Å
9	W	51.7	Low	56.4	Low	194 Å²	194	119.2 Å²	119.2	74%	0.735	64%	0.639	S	S	*	*	H	α-helix	trans	-66.5	-46.6	170.8	-75.5	90	0	0	0	114.4	S7 A11 R12 V13	S7-W9 CarbonylContact O-C 3.52Å; S7-W9 PolarHBondContact O-N 3.48Å; W9-A11 VanDerWaalsContact C-N 3.3Å; W9-A11 PolarHBondContact O-N 2.95Å; W9-R12 PolarHBondContact O-N 2.75Å; W9-R12 VanDerWaalsContact O-N 3.14Å; W9-V13 WeakPolarHBondContact O-CG2 3.37Å; W9-V13 PolarHBondContact O-N 3.29Å
10	S	55.4	Low	56.5	Low	61 Å²	61	120.2 Å²	120.2	43%	0.427	63%	0.633	S	S	.	*	H	α-helix	trans	-62.4	-38.6	176.9	-56.6	0	0	0	0	111.6	S7 V13 L14	S7-S10 WeakPolarHBondContact O-CB 3.45Å; S7-S10 PolarHBondContact O-N 3.41Å; S10-V13 PolarHBondContact O-N 2.93Å; S10-L14 WeakPolarHBondContact O-CB 3.48Å; S10-L14 VanDerWaalsContact O-CG 3.26Å; S10-L14 WeakPolarHBondContact O-CG 3.11Å; S10-L14 PolarHBondContact O-N 2.98Å
11	A	57.9	Low	56.6	Low	39 Å²	39	123.6 Å²	123.6	32%	0.322	64%	0.637	S	S	.	*	H	α-helix	trans	-62.9	-41.9	173.8	0	0	0	0	0	111.9	S7 W9 L14 W15	S7-A11 PolarHBondContact O-N 3.14Å; W9-A11 VanDerWaalsContact C-N 3.3Å; W9-A11 PolarHBondContact O-N 2.95Å; A11-L14 PolarHBondContact O-N 3.32Å; A11-W15 WeakPolarHBondContact O-CB 3.47Å; A11-W15 PolarHBondContact O-N 2.75Å
12	R	60	Low	57.7	Low	145 Å²	145	120.9 Å²	120.9	55%	0.547	61%	0.614	S	S	.	*	H	α-helix	trans	-65.4	-39.9	175.1	-77.4	-174.9	-148.3	174.9	5.1	112.8	R8 W9 L14 W15 A16	R8-R12 PolarHBondContact O-N 2.81Å; W9-R12 PolarHBondContact O-N 2.75Å; W9-R12 VanDerWaalsContact O-N 3.14Å; R12-L14 VanDerWaalsContact C-N 3.35Å; R12-W15 PolarHBondContact O-N 2.98Å; R12-A16 WeakPolarHBondContact O-CB 3.26Å; R12-A16 PolarHBondContact O-N 3.43Å
13	V	59.4	Low	58.6	Low	90 Å²	90	117.4 Å²	117.4	55%	0.545	59%	0.593	S	S	.	*	H	α-helix	trans	-65.9	-39.6	177.7	173.5	0	0	0	0	111	W9 S10 A16 S17	W9-V13 WeakPolarHBondContact O-CG2 3.37Å; W9-V13 PolarHBondContact O-N 3.29Å; S10-V13 PolarHBondContact O-N 2.93Å; V13-A16 PolarHBondContact O-N 3.35Å; V13-S17 PolarHBondContact O-N 2.81Å; V13-S17 PolarHBondContact O-OG 3.38Å
14	L	60.4	Low	58.8	Low	78 Å²	78	117.7 Å²	117.7	41%	0.408	58%	0.584	S	S	.	*	H	α-helix	trans	-64.8	-41.5	174.3	-71	169.4	0	0	0	111.6	S10 A11 R12 S17 W20	S10-L14 WeakPolarHBondContact O-CB 3.48Å; S10-L14 VanDerWaalsContact O-CG 3.26Å; S10-L14 WeakPolarHBondContact O-CG 3.11Å; S10-L14 PolarHBondContact O-N 2.98Å; A11-L14 PolarHBondContact O-N 3.32Å; R12-L14 VanDerWaalsContact C-N 3.35Å; L14-S17 WeakPolarHBondContact O-CB 3.19Å; L14-S17 PolarHBondContact O-N 3.38Å; L14-W20 WeakPolarHBondContact O-CB 3.25Å; L14-W20 VanDerWaalsContact O-CG 3.28Å
15	W	57.9	Low	58.9	Low	209 Å²	209	116.2 Å²	116.2	79%	0.792	57%	0.574	S	S	*	*	H	α-helix	trans	-69.8	-32.7	176	-82.3	57.2	0	0	0	113.4	A11 R12 S17	A11-W15 WeakPolarHBondContact O-CB 3.47Å; A11-W15 PolarHBondContact O-N 2.75Å; R12-W15 PolarHBondContact O-N 2.98Å; W15-S17 VanDerWaalsContact C-N 3.31Å
16	A	59.5	Low	59.1	Low	79 Å²	79	113.7 Å²	113.7	65%	0.653	56%	0.557	S	S	*	*	H	α-helix	trans	-79.2	-14.4	177.2	0	0	0	0	0	113	R12 V13 P18	R12-A16 WeakPolarHBondContact O-CB 3.26Å; R12-A16 PolarHBondContact O-N 3.43Å; V13-A16 PolarHBondContact O-N 3.35Å; A16-P18 WeakPolarHBondContact O-CD 3.46Å
17	S	64.8	Low	59.2	Low	41 Å²	41	118.3 Å²	118.3	29%	0.287	56%	0.564	S	S	.	*			trans	-68.4	122.1	179.1	-69.7	0	0	0	0	110.4	V13 L14 W15 G19 W20 R21	V13-S17 PolarHBondContact O-N 2.81Å; V13-S17 PolarHBondContact O-OG 3.38Å; L14-S17 WeakPolarHBondContact O-CB 3.19Å; L14-S17 PolarHBondContact O-N 3.38Å; W15-S17 VanDerWaalsContact C-N 3.31Å; S17-G19 PolarHBondContact O-N 2.83Å; S17-G19 VanDerWaalsContact O-N 3.08Å; S17-W20 PolarHBondContact O-N 3.38Å; S17-R21 PolarHBondContact O-N 3.26Å
18	P	59.1	Low	59.2	Low	111 Å²	111	116.8 Å²	116.8	72%	0.721	56%	0.555	S	S	*	*	H	α-helix	trans	-56.3	-30.9	-179.6	-24.9	32.9	0	0	0	113	A16 R21 R22	A16-P18 WeakPolarHBondContact O-CD 3.46Å; P18-R21 PolarHBondContact O-N 3.01Å; P18-R22 PolarHBondContact O-N 3.03Å
19	G	64.6	Low	59.2	Low	45 Å²	45	110.8 Å²	110.8	46%	0.464	54%	0.542	S	S	.	.	H	α-helix	trans	-61.8	-43.9	175.8	0	0	0	0	0	113.1	S17 R22 T23	S17-G19 PolarHBondContact O-N 2.83Å; S17-G19 VanDerWaalsContact O-N 3.08Å; G19-R22 PolarHBondContact O-N 3.47Å; G19-T23 PolarHBondContact O-N 3.36Å; G19-T23 PolarHBondContact O-OG1 3.04Å
20	W	59.1	Low	59.5	Low	138 Å²	138	106.1 Å²	106.1	52%	0.523	54%	0.535	S	S	.	.	H	α-helix	trans	-65.5	-41.9	178.4	-107.8	87.7	0	0	0	111.9	L14 S17 R22 T23 Y24	L14-W20 WeakPolarHBondContact O-CB 3.25Å; L14-W20 VanDerWaalsContact O-CG 3.28Å; S17-W20 PolarHBondContact O-N 3.38Å; W20-R22 VanDerWaalsContact C-N 3.31Å; W20-R22 PolarHBondContact O-N 3.45Å; W20-T23 PolarHBondContact O-N 2.98Å; W20-Y24 VanDerWaalsContact O-CB 3.25Å; W20-Y24 WeakPolarHBondContact O-CB 3.39Å; W20-Y24 PolarHBondContact O-N 2.88Å
21	R	58.8	Low	59.6	Low	193 Å²	193	104.6 Å²	104.6	73%	0.728	53%	0.529	S	S	*	.	H	α-helix	trans	-62.1	-40.5	175.4	-161.3	175.7	-174.7	-157.1	1.6	111.1	S17 P18 T25	S17-R21 PolarHBondContact O-N 3.26Å; P18-R21 PolarHBondContact O-N 3.01Å; R21-T25 VanDerWaalsContact O-CB 3.28Å; R21-T25 WeakPolarHBondContact O-CB 3.37Å; R21-T25 PolarHBondContact O-N 3.14Å; R21-T25 PolarHBondContact O-OG1 3.08Å
22	R	60.7	Low	59.5	Low	183 Å²	183	108.3 Å²	108.3	69%	0.691	54%	0.543	S	S	*	.	H	α-helix	trans	-66.5	-44.2	177.9	-157.6	170.8	-169.2	167.5	1.7	111.9	P18 G19 W20 Q26	P18-R22 PolarHBondContact O-N 3.03Å; G19-R22 PolarHBondContact O-N 3.47Å; W20-R22 VanDerWaalsContact C-N 3.31Å; W20-R22 PolarHBondContact O-N 3.45Å; R22-Q26 VanDerWaalsContact O-CB 3.3Å; R22-Q26 WeakPolarHBondContact O-CB 3.46Å; R22-Q26 VanDerWaalsContact O-CG 3.25Å; R22-Q26 WeakPolarHBondContact O-CG 3.39Å; R22-Q26 PolarHBondContact O-N 3.38Å
23	T	61.9	Low	59.2	Low	69 Å²	69	109 Å²	109	42%	0.423	55%	0.55	S	S	.	.	H	α-helix	trans	-68.4	-39.9	177.6	-50.7	0	0	0	0	112.2	G19 W20 R27	G19-T23 PolarHBondContact O-N 3.36Å; G19-T23 PolarHBondContact O-OG1 3.04Å; W20-T23 PolarHBondContact O-N 2.98Å; T23-R27 WeakPolarHBondContact O-CB 3.21Å; T23-R27 WeakPolarHBondContact O-CG 3.41Å; T23-R27 PolarHBondContact O-N 2.86Å
24	Y	59.7	Low	59	Low	163 Å²	163	113.3 Å²	113.3	64%	0.639	56%	0.556	S	S	*	*	H	α-helix	trans	-67.3	-46.7	177	-172.6	-94.7	0	0	0	111.3	W20 Q26 R27 A28	W20-Y24 VanDerWaalsContact O-CB 3.25Å; W20-Y24 WeakPolarHBondContact O-CB 3.39Å; W20-Y24 PolarHBondContact O-N 2.88Å; Y24-Q26 VanDerWaalsContact C-N 3.35Å; Y24-Q26 PolarHBondContact O-N 3.41Å; Y24-R27 PolarHBondContact O-N 3.4Å; Y24-A28 WeakPolarHBondContact O-CB 3.3Å; Y24-A28 PolarHBondContact O-N 2.8Å
25	T	59	Low	58.9	Low	71 Å²	71	116.8 Å²	116.8	44%	0.436	57%	0.574	S	S	.	*	H	α-helix	trans	-62.6	-41.6	175.5	-56.8	0	0	0	0	111.2	R21 A28 C29	R21-T25 VanDerWaalsContact O-CB 3.28Å; R21-T25 WeakPolarHBondContact O-CB 3.37Å; R21-T25 PolarHBondContact O-N 3.14Å; R21-T25 PolarHBondContact O-OG1 3.08Å; T25-A28 PolarHBondContact O-N 3.43Å; T25-C29 VanDerWaalsContact O-CB 3.25Å; T25-C29 WeakPolarHBondContact O-CB 3.49Å; T25-C29 PolarHBondContact O-N 3.46Å; T25-C29 PolarHBondContact O-SG 2.81Å
26	Q	59.9	Low	58.6	Low	116 Å²	116	109.7 Å²	109.7	54%	0.542	57%	0.566	S	S	.	*	H	α-helix	trans	-62.7	-46.2	175.2	-79.1	178.5	-17.8	0	0	112.2	R22 Y24 C29 V30	R22-Q26 VanDerWaalsContact O-CB 3.3Å; R22-Q26 WeakPolarHBondContact O-CB 3.46Å; R22-Q26 VanDerWaalsContact O-CG 3.25Å; R22-Q26 WeakPolarHBondContact O-CG 3.39Å; R22-Q26 PolarHBondContact O-N 3.38Å; Y24-Q26 VanDerWaalsContact C-N 3.35Å; Y24-Q26 PolarHBondContact O-N 3.41Å; Q26-C29 PolarHBondContact O-N 2.9Å; Q26-V30 WeakPolarHBondContact O-CB 3.45Å; Q26-V30 WeakPolarHBondContact O-CG2 3.45Å; Q26-V30 PolarHBondContact O-N 3.31Å
27	R	58.7	Low	58	Low	197 Å²	197	109.7 Å²	109.7	74%	0.743	56%	0.56	S	S	*	*	H	α-helix	trans	-66.1	-39.1	177.3	-78.7	-175.4	177.6	-170.7	0.4	112.3	T23 Y24 V30 G31	T23-R27 WeakPolarHBondContact O-CB 3.21Å; T23-R27 WeakPolarHBondContact O-CG 3.41Å; T23-R27 PolarHBondContact O-N 2.86Å; Y24-R27 PolarHBondContact O-N 3.4Å; R27-V30 PolarHBondContact O-N 2.81Å; R27-G31 PolarHBondContact O-N 3.18Å
28	A	58.3	Low	57.3	Low	37 Å²	37	112.9 Å²	112.9	31%	0.306	58%	0.58	S	S	.	*	H	α-helix	trans	-66	-42.6	175.7	0	0	0	0	0	111.1	Y24 T25 G31 L32	Y24-A28 WeakPolarHBondContact O-CB 3.3Å; Y24-A28 PolarHBondContact O-N 2.8Å; T25-A28 PolarHBondContact O-N 3.43Å; A28-G31 PolarHBondContact O-N 2.89Å; A28-L32 VanDerWaalsContact O-CB 3.26Å; A28-L32 WeakPolarHBondContact O-CB 3.33Å; A28-L32 WeakPolarHBondContact O-CG 3.37Å; A28-L32 PolarHBondContact O-N 2.78Å
29	C	56.8	Low	56.9	Low	68 Å²	68	118.4 Å²	118.4	46%	0.459	59%	0.587	S	S	.	*	H	α-helix	trans	-66.7	-36.9	174.6	-71	0	0	0	0	112.5	T25 Q26 K33	T25-C29 VanDerWaalsContact O-CB 3.25Å; T25-C29 WeakPolarHBondContact O-CB 3.49Å; T25-C29 PolarHBondContact O-N 3.46Å; T25-C29 PolarHBondContact O-SG 2.81Å; Q26-C29 PolarHBondContact O-N 2.9Å; C29-K33 WeakPolarHBondContact O-CB 3.16Å; C29-K33 PolarHBondContact O-N 3.37Å
30	V	58.6	Low	56.2	Low	96 Å²	96	119 Å²	119	58%	0.582	59%	0.593	S	S	*	*	H	α-helix	trans	-68.6	-42.7	174.1	170.6	0	0	0	0	110.7	Q26 R27 K33 R34	Q26-V30 WeakPolarHBondContact O-CB 3.45Å; Q26-V30 WeakPolarHBondContact O-CG2 3.45Å; Q26-V30 PolarHBondContact O-N 3.31Å; R27-V30 PolarHBondContact O-N 2.81Å; V30-K33 PolarHBondContact O-N 2.91Å; V30-R34 WeakPolarHBondContact O-CB 3.25Å; V30-R34 PolarHBondContact O-N 2.97Å
31	G	56.9	Low	55.8	Low	28 Å²	28	118.3 Å²	118.3	29%	0.289	60%	0.604	S	S	.	*	H	α-helix	trans	-61.9	-44	174.5	0	0	0	0	0	112.3	R27 A28 R34 L35	R27-G31 PolarHBondContact O-N 3.18Å; A28-G31 PolarHBondContact O-N 2.89Å; G31-R34 CarbonylContact O-C 3.55Å; G31-R34 WeakPolarHBondContact O-CA 3.26Å; G31-R34 WeakPolarHBondContact O-CB 3.19Å; G31-R34 PolarHBondContact O-N 2.85Å; G31-R34 VanDerWaalsContact O-N 3.14Å; G31-L35 WeakPolarHBondContact O-CB 3.25Å; G31-L35 WeakPolarHBondContact O-CD1 3.28Å; G31-L35 PolarHBondContact O-N 3.24Å
32	L	56	Low	55.3	Low	118 Å²	118	120.5 Å²	120.5	62%	0.618	61%	0.614	S	S	*	*	H	α-helix	trans	-68.7	-39.2	175.7	-78.5	164.3	0	0	0	112.5	A28 R34 L35 G36	A28-L32 VanDerWaalsContact O-CB 3.26Å; A28-L32 WeakPolarHBondContact O-CB 3.33Å; A28-L32 WeakPolarHBondContact O-CG 3.37Å; A28-L32 PolarHBondContact O-N 2.78Å; L32-R34 PolarHBondContact O-N 3.42Å; L32-L35 PolarHBondContact O-N 2.8Å; L32-G36 PolarHBondContact O-N 2.82Å
33	K	54	Low	54.5	Low	159 Å²	159	114.9 Å²	114.9	69%	0.691	60%	0.602	S	S	*	*	H	α-helix	trans	-59.2	-37	168.3	-97.2	-175.3	171.6	-171.8	0	111.2	C29 V30 C37	C29-K33 WeakPolarHBondContact O-CB 3.16Å; C29-K33 PolarHBondContact O-N 3.37Å; V30-K33 PolarHBondContact O-N 2.91Å; K33-C37 WeakPolarHBondContact O-CB 3.32Å; K33-C37 PolarHBondContact O-N 2.91Å; K33-C37 PolarHBondContact O-SG 3.41Å; K33-C37 VanDerWaalsContact O-SG 3.41Å
34	R	54.9	Low	54	Low	181 Å²	181	117.3 Å²	117.3	68%	0.683	62%	0.62	S	S	*	*	H	α-helix	trans	-73.5	-29.7	178.3	-146.7	178	-164.7	-173.3	4	113.2	V30 G31 L32	V30-R34 WeakPolarHBondContact O-CB 3.25Å; V30-R34 PolarHBondContact O-N 2.97Å; G31-R34 CarbonylContact O-C 3.55Å; G31-R34 WeakPolarHBondContact O-CA 3.26Å; G31-R34 WeakPolarHBondContact O-CB 3.19Å; G31-R34 PolarHBondContact O-N 2.85Å; G31-R34 VanDerWaalsContact O-N 3.14Å; L32-R34 PolarHBondContact O-N 3.42Å
35	L	57.7	Low	53.6	Low	150 Å²	150	116.6 Å²	116.6	79%	0.785	63%	0.626	S	S	*	*	H	α-helix	trans	-85.8	-28.1	178	-82.3	151.6	0	0	0	112.8	G31 L32	G31-L35 WeakPolarHBondContact O-CB 3.25Å; G31-L35 WeakPolarHBondContact O-CD1 3.28Å; G31-L35 PolarHBondContact O-N 3.24Å; L32-L35 PolarHBondContact O-N 2.8Å
36	G	51.8	Low	52.9	Low	61 Å²	61	117.1 Å²	117.1	63%	0.629	64%	0.637	S	S	*	*	H	α-helix	trans	-97.6	-13.3	179.2	0	0	0	0	0	115	L32 P38	L32-G36 PolarHBondContact O-N 2.82Å; G36-P38 WeakPolarHBondContact O-CD 3.35Å
37	C	47.4	Very low	52.3	Low	78 Å²	78	120.2 Å²	120.2	53%	0.527	65%	0.651	S	S	.	*	S	Bend	trans	-99	107.3	169.5	-68.2	0	0	0	0	109.2	K33 R39	K33-C37 WeakPolarHBondContact O-CB 3.32Å; K33-C37 PolarHBondContact O-N 2.91Å; K33-C37 PolarHBondContact O-SG 3.41Å; K33-C37 VanDerWaalsContact O-SG 3.41Å; C37-R39 PolarHBondContact O-N 2.74Å
38	P	49	Very low	51.6	Low	109 Å²	109	122.2 Å²	122.2	71%	0.708	66%	0.659	S	S	*	*			trans	-56.2	120.1	157.5	25.4	-30.6	0	0	0	106.2	G36 G40	G36-P38 WeakPolarHBondContact O-CD 3.35Å; P38-G40 PolarHBondContact O-N 3.04Å
39	R	51.1	Low	51.1	Low	226 Å²	226	124 Å²	124	85%	0.853	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.1	48.9	178.4	-156.3	174.9	-172.8	-174.1	-3.3	109.8	C37	C37-R39 PolarHBondContact O-N 2.74Å
40	G	50.9	Low	50.4	Low	58 Å²	58	135.2 Å²	135.2	60%	0.598	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-124.3	3.9	-168.9	0	0	0	0	0	114.6	P38	P38-G40 PolarHBondContact O-N 3.04Å
41	V	50.2	Low	50	Low	123 Å²	123	137.2 Å²	137.2	75%	0.745	72%	0.715	S	S	*	*	S	Bend	trans	-123.8	17.3	-179.3	-159.7	0	0	0	0	113
42	Y	47.6	Very low	49.6	Very low	239 Å²	239	142.9 Å²	142.9	94%	0.937	74%	0.737	S	S	*	*			trans	-113.8	57.3	161.8	-94.1	-90.7	0	0	0	109
43	S	44.7	Very low	49.3	Very low	65 Å²	65	144.3 Å²	144.3	46%	0.455	74%	0.744	S	S	.	*			trans	-102.1	113.7	162.6	-149	0	0	0	0	106.3	L45 A46	S43-L45 PolarHBondContact O-N 3.44Å; S43-A46 PolarHBondContact O-N 3.23Å
44	P	51.1	Low	49	Very low	121 Å²	121	143.5 Å²	143.5	79%	0.786	75%	0.747	S	S	*	*	G	3₁₀ helix	trans	-57.5	-9	179	-22.5	32.6	0	0	0	114.1	A46	P44-A46 VanDerWaalsContact C-N 3.29Å; P44-A46 PolarHBondContact O-N 2.88Å
45	L	50.2	Low	48.6	Very low	148 Å²	148	141.1 Å²	141.1	78%	0.775	75%	0.751	S	S	*	*	G	3₁₀ helix	trans	-73.1	-13.8	178.7	-68.8	166.9	0	0	0	114.2	S43	S43-L45 PolarHBondContact O-N 3.44Å
46	A	44.5	Very low	48	Very low	81 Å²	81	140.5 Å²	140.5	67%	0.669	75%	0.749	S	S	*	*	G	3₁₀ helix	trans	-83.9	-10.4	-179	0	0	0	0	0	114.6	S43 P44	S43-A46 PolarHBondContact O-N 3.23Å; P44-A46 VanDerWaalsContact C-N 3.29Å; P44-A46 PolarHBondContact O-N 2.88Å
47	H	46.9	Very low	47.8	Very low	182 Å²	182	146.2 Å²	146.2	84%	0.843	76%	0.757	S	S	*	*	G	3₁₀ helix	trans	-90.7	5.7	179.5	-160.6	-72.7	0	0	0	113.1
48	R	45.9	Very low	47.8	Very low	239 Å²	239	151.5 Å²	151.5	90%	0.902	78%	0.775	S	S	*	*	G	3₁₀ helix	trans	-115.5	22.6	-178.2	-142.6	-179.2	-171.6	179.7	2.3	114.4
49	A	46.2	Very low	47.7	Very low	74 Å²	74	155 Å²	155	61%	0.612	78%	0.781	S	S	*	*			trans	-146.2	83.8	167.5	0	0	0	0	0	108
50	Y	43	Very low	47.4	Very low	304 Å²	304	148.5 Å²	148.5	100%	1.192	77%	0.774	S	S	*	*			trans	165.3	0	138.4	-100.5	-79.9	0	0	0	109.6

Retrieved 50 of 50 residues in 242 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).