A0A087WQQ2_MOUSE Loading...

Crystallin, beta A2

AlphaFold DB , UniProt , Accession A0A087WQQ2, Species MOUSE (Mus musculus, Mouse), Gene Cryba2, Length 54 aa.

						>A0A087WQQ2_MOUSE|A0A087WQQ2|Cryba2
MSSAPAPGSAPVCLTLWDEEDFQGRRCRLLSDCANVCERGALRRVRSVKVENGA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.3	Very low	60.3	Low	246 Å²	246	101.3 Å²	101.3	100%	1.212	70%	0.697	S	S	*	*				0	103.5	0	-63.5	173.8	176.9	0	0	106.8
2	S	54.2	Low	62.2	Low	104 Å²	104	97.2 Å²	97.2	73%	0.727	67%	0.665	S	S	*	*	P	Polyproline II helix	trans	-83.2	120.6	169.7	-87.1	0	0	0	0	107.5	A4	S2-A4 PolarHBondContact O-N 2.83Å
3	S	58.4	Low	64.5	Low	55 Å²	55	90.6 Å²	90.6	39%	0.385	62%	0.62	S	S	.	*	P	Polyproline II helix	trans	-58.4	125.7	166.3	34.8	0	0	0	0	108.4	D32	S3-D32 WeakPolarHBondContact OG-CB 3.06Å; S3-D32 PolarHBondContact OG-OD2 2.88Å
4	A	60.7	Low	66.6	Low	89 Å²	89	87.8 Å²	87.8	74%	0.736	60%	0.595	S	S	*	*	P	Polyproline II helix	trans	-70.8	138.4	167.8	0	0	0	0	0	108.2	S2	S2-A4 PolarHBondContact O-N 2.83Å
5	P	58.3	Low	68.5	Low	95 Å²	95	82.1 Å²	82.1	62%	0.617	56%	0.557	S	S	*	*	P	Polyproline II helix	trans	-61.1	141.4	175.4	24.6	-31.6	0	0	0	110.1
6	A	60	Low	70.3	Confident	68 Å²	68	78.1 Å²	78.1	56%	0.562	53%	0.527	S	S	*	.	P	Polyproline II helix	trans	-59.1	137.2	176.9	0	0	0	0	0	110.5	G8 S9	A6-G8 PolarHBondContact O-N 3.37Å; A6-G8 VanDerWaalsContact O-N 3.09Å; A6-S9 PolarHBondContact O-N 3.45Å; A6-S9 VanDerWaalsContact O-N 3.14Å
7	P	55.5	Low	71.9	Confident	142 Å²	142	74.8 Å²	74.8	92%	0.922	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.4	117	178.4	23.4	-30.7	0	0	0	109.7
8	G	63.1	Low	73.3	Confident	87 Å²	87	71.9 Å²	71.9	90%	0.897	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	111.3	-9.4	-178.9	0	0	0	0	0	115.4	A6	A6-G8 PolarHBondContact O-N 3.37Å; A6-G8 VanDerWaalsContact O-N 3.09Å
9	S	66.2	Low	74.6	Confident	75 Å²	75	73.5 Å²	73.5	52%	0.524	48%	0.48	S	S	.	.	S	Bend	trans	-84.5	130.7	170.4	-170.4	0	0	0	0	110.1	A6	A6-S9 PolarHBondContact O-N 3.45Å; A6-S9 VanDerWaalsContact O-N 3.14Å
10	A	68.1	Low	75.7	Confident	52 Å²	52	75.5 Å²	75.5	43%	0.43	48%	0.483	S	S	.	.	P	Polyproline II helix	trans	-57	146.7	172.3	0	0	0	0	0	109.9	V12 N52	A10-V12 PolarHBondContact O-N 3.32Å; A10-N52 WeakPolarHBondContact CB-OD1 3.42Å
11	P	74.3	Confident	76.8	Confident	101 Å²	101	78 Å²	78	66%	0.656	49%	0.492	S	S	*	.	P	Polyproline II helix	trans	-59	116.1	179.8	21.6	-30.5	0	0	0	109.9	C13 N52	P11-C13 PolarHBondContact O-N 3.14Å; P11-N52 WeakPolarHBondContact O-CB 3.43Å; P11-N52 VanDerWaalsContact O-CG 3.31Å; P11-N52 PolarHBondContact O-OD1 2.98Å
12	V	84.1	Confident	79.3	Confident	52 Å²	52	71.2 Å²	71.2	32%	0.315	46%	0.456	S	S	.	.	P	Polyproline II helix	trans	-62.8	134.2	175.7	-67.2	0	0	0	0	109.3	A10 L30	A10-V12 PolarHBondContact O-N 3.32Å; V12-L30 CarbonylContact O-C 3.54Å; V12-L30 VanDerWaalsContact O-CA 3.27Å; V12-L30 WeakPolarHBondContact O-CA 3.44Å
13	C	91.4	Very high	81.3	Confident	12 Å²	12	71.8 Å²	71.8	8%	0.081	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.5	114.1	-178.3	-165.8	0	0	0	0	109.8	P11 R28 L29 L30 E51 N52	P11-C13 PolarHBondContact O-N 3.14Å; C13-R28 VanDerWaalsContact SG-CZ 3.6Å; C13-R28 PolarHBondContact SG-NE 3.01Å; C13-R28 PolarHBondContact SG-NH2 2.9Å; C13-L29 WeakPolarHBondContact CA-O 3.11Å; C13-L30 HydrophobicContact CB-CD2 4.31Å; C13-L30 VanDerWaalsContact SG-CD2 3.56Å; C13-E51 HydrophobicContact CB-CB 4.1Å; C13-E51 WeakPolarHBondContact O-CA 3.18Å; C13-E51 WeakPolarHBondContact O-CB 3.25Å; C13-E51 PolarHBondContact O-N 3.43Å; C13-E51 PolarHBondContact SG-OE2 2.85Å; C13-N52 HydrophobicContact CB-CB 3.99Å; C13-N52 PolarHBondContact N-O 2.85Å; C13-N52 PolarHBondContact O-N 3.32Å
14	L	94.3	Very high	83.1	Confident	51 Å²	51	71.2 Å²	71.2	27%	0.267	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	152.1	174.8	67.9	92.4	0	0	0	110.7	L16 L29 K49 V50	L14-L16 HydrophobicContact CD1-CD1 4.47Å; L14-L16 HydrophobicContact CD1-CD2 3.47Å; L14-L16 VanDerWaalsContact CD1-CD2 3.47Å; L14-L16 HydrophobicContact CD1-CG 3.77Å; L14-L29 HydrophobicContact CD1-CB 4.11Å; L14-L29 HydrophobicContact CD1-CD1 3.96Å; L14-L29 HydrophobicContact CD1-CG 4.19Å; L14-L29 HydrophobicContact CG-CB 4.11Å; L14-L29 PolarHBondContact N-O 2.82Å; L14-L29 VanDerWaalsContact N-O 3.08Å; L14-L29 PolarHBondContact O-N 3.48Å; L14-K49 CarbonylContact C-O 3.53Å; L14-K49 VanDerWaalsContact CA-O 3.28Å; L14-K49 WeakPolarHBondContact CA-O 3.31Å; L14-V50 HydrophobicContact CB-CG2 4.43Å
15	T	95.6	Very high	84.7	Confident	3 Å²	3	74.4 Å²	74.4	2%	0.018	44%	0.443	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	134.7	176.2	-56.1	0	0	0	0	109.1	W17 R26 C27 V48 K49	T15-W17 VanDerWaalsContact C-CZ3 3.46Å; T15-W17 HydrophobicContact CG2-CD2 4.04Å; T15-W17 HydrophobicContact CG2-CE3 3.86Å; T15-W17 HydrophobicContact CG2-CH2 3.26Å; T15-W17 HydrophobicContact CG2-CZ2 3.46Å; T15-W17 VanDerWaalsContact CG2-CZ2 3.46Å; T15-W17 HydrophobicContact CG2-CZ3 3.47Å; T15-W17 VanDerWaalsContact CG2-CZ3 3.47Å; T15-W17 WeakPolarHBondContact O-CZ3 3.32Å; T15-R26 HydrophobicContact CG2-CB 3.93Å; T15-R26 HydrophobicContact CG2-CG 4.35Å; T15-C27 WeakPolarHBondContact CA-O 3.45Å; T15-V48 WeakPolarHBondContact O-CA 3.24Å; T15-K49 PolarHBondContact N-O 3.25Å; T15-K49 PolarHBondContact O-N 2.92Å
16	L	96.6	Very high	86.5	Confident	17 Å²	17	77.9 Å²	77.9	9%	0.089	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	143.6	177.2	-53.6	176.9	0	0	0	108.9	L14 R26 C27 L29 V36 L42 V45 V48	L14-L16 HydrophobicContact CD1-CD1 4.47Å; L14-L16 HydrophobicContact CD1-CD2 3.47Å; L14-L16 VanDerWaalsContact CD1-CD2 3.47Å; L14-L16 HydrophobicContact CD1-CG 3.77Å; L16-R26 CarbonylContact O-C 3.4Å; L16-R26 WeakPolarHBondContact O-CA 3.24Å; L16-R26 WeakPolarHBondContact O-CB 3.5Å; L16-C27 PolarHBondContact N-O 3.35Å; L16-C27 PolarHBondContact O-N 3.04Å; L16-L29 HydrophobicContact CD1-CD1 3.85Å; L16-L29 HydrophobicContact CD1-CG 4.4Å; L16-L29 HydrophobicContact CG-CD1 4.48Å; L16-V36 HydrophobicContact CD1-CB 4.29Å; L16-V36 HydrophobicContact CD1-CG1 3.71Å; L16-L42 HydrophobicContact CB-CD1 3.65Å; L16-V45 HydrophobicContact CB-CG1 4.14Å; L16-V45 HydrophobicContact CB-CG2 4.16Å; L16-V45 HydrophobicContact CD1-CG2 4.24Å; L16-V45 HydrophobicContact CD2-CG1 4.2Å; L16-V48 HydrophobicContact CD2-CB 4.33Å; L16-V48 HydrophobicContact CD2-CG1 3.89Å; L16-V48 HydrophobicContact CD2-CG2 3.66Å
17	W	97.3	Very high	88.1	Confident	23 Å²	23	75.1 Å²	75.1	9%	0.087	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	147.2	175.4	-73.4	-100.1	0	0	0	112.1	T15 F22 Q23 R25 R26 V45 R46 S47 K49	T15-W17 VanDerWaalsContact C-CZ3 3.46Å; T15-W17 HydrophobicContact CG2-CD2 4.04Å; T15-W17 HydrophobicContact CG2-CE3 3.86Å; T15-W17 HydrophobicContact CG2-CH2 3.26Å; T15-W17 HydrophobicContact CG2-CZ2 3.46Å; T15-W17 VanDerWaalsContact CG2-CZ2 3.46Å; T15-W17 HydrophobicContact CG2-CZ3 3.47Å; T15-W17 VanDerWaalsContact CG2-CZ3 3.47Å; T15-W17 WeakPolarHBondContact O-CZ3 3.32Å; W17-F22 VanDerWaalsContact CD1-C 3.43Å; W17-F22 HydrophobicContact CD2-CB 4.15Å; W17-F22 HydrophobicContact CD2-CD1 4.46Å; W17-F22 HydrophobicContact CE3-CB 4.46Å; W17-F22 AromaticContact CE3-CD1 3.96Å; W17-F22 HydrophobicContact CE3-CD1 3.96Å; W17-F22 HydrophobicContact CH2-CB 4.39Å; W17-F22 HydrophobicContact CH2-CD1 4.24Å; W17-F22 HydrophobicContact CZ2-CB 4.08Å; W17-F22 AromaticContact CZ3-CD1 3.84Å; W17-F22 HydrophobicContact CZ3-CD1 3.84Å; W17-F22 PolarHBondContact NE1-O 3.29Å; W17-Q23 WeakPolarHBondContact CB-O 3.49Å; W17-R25 VanDerWaalsContact CA-O 3.26Å; W17-R25 WeakPolarHBondContact CA-O 3.41Å; W17-R26 HydrophobicContact CD2-CB 4.19Å; W17-R26 HydrophobicContact CG-CB 4.03Å; W17-V45 CarbonylContact O-C 3.49Å; W17-V45 VanDerWaalsContact O-CA 3.3Å; W17-V45 WeakPolarHBondContact O-CA 3.46Å; W17-R46 PolarHBondContact O-N 3.01Å; W17-S47 WeakPolarHBondContact CB-OG 3.26Å; W17-S47 PolarHBondContact N-O 3.32Å; W17-S47 PolarHBondContact O-N 2.96Å; W17-K49 HydrophobicContact CH2-CB 3.6Å; W17-K49 HydrophobicContact CH2-CD 4.19Å; W17-K49 HydrophobicContact CZ3-CB 3.38Å
18	D	96.8	Very high	89.9	Confident	22 Å²	22	74.1 Å²	74.1	12%	0.118	40%	0.398	C	S	.	.	S	Bend	trans	-82.5	-11.3	175.1	66.8	-11.9	0	0	0	114.6	R25 L42 R44 R46	D18-R25 PolarHBondContact N-O 2.94Å; D18-R25 PolarHBondContact OD1-N 3.49Å; D18-R25 IonicContact OD2-CZ 3.32Å; D18-R25 IonicContact OD2-NE 2.85Å; D18-R25 PolarHBondContact OD2-NE 2.72Å; D18-R25 IonicContact OD2-NH2 2.9Å; D18-R25 PolarHBondContact OD2-NH2 3.36Å; D18-L42 HydrophobicContact CB-CD2 3.93Å; D18-R44 VanDerWaalsContact CA-O 3.31Å; D18-R44 WeakPolarHBondContact CA-O 3.28Å; D18-R44 VanDerWaalsContact CB-O 3.32Å; D18-R44 WeakPolarHBondContact CB-O 3.5Å; D18-R46 VanDerWaalsContact O-CD 3.24Å; D18-R46 WeakPolarHBondContact O-CD 3.44Å; D18-R46 VanDerWaalsContact O-CG 3.24Å; D18-R46 WeakPolarHBondContact O-CG 3.3Å
19	E	98	Very high	91.2	Very high	103 Å²	103	70.7 Å²	70.7	48%	0.481	36%	0.36	S	S	.	.	S	Bend	trans	-113.7	167.1	172.5	-59.5	-179.3	-178.1	0	0	113	Q23 R46 S47	E19-Q23 HydrophobicContact CB-CB 4.1Å; E19-Q23 WeakPolarHBondContact CB-O 3.38Å; E19-R46 VanDerWaalsContact C-CB 3.41Å; E19-R46 WeakPolarHBondContact O-CB 3.44Å; E19-S47 WeakPolarHBondContact O-CB 3.49Å; E19-S47 PolarHBondContact O-N 3.03Å; E19-S47 PolarHBondContact O-OG 3.35Å
20	E	97.8	Very high	92.4	Very high	113 Å²	113	72 Å²	72	53%	0.528	36%	0.36	S	S	.	.	S	Bend	trans	-72.8	167.4	174.9	-70.1	164.5	-153.4	0	0	110	F22 Q23 R46	E20-F22 PolarHBondContact O-N 3.37Å; E20-Q23 WeakPolarHBondContact O-CB 3.38Å; E20-Q23 PolarHBondContact O-N 3.04Å; E20-Q23 VanDerWaalsContact O-N 3.13Å; E20-R46 HydrophobicContact CG-CB 4.04Å; E20-R46 IonicContact OE1-NH1 3.32Å; E20-R46 PolarHBondContact OE1-NH1 3.37Å
21	D	97.6	Very high	93.3	Very high	127 Å²	127	70.9 Å²	70.9	68%	0.679	35%	0.349	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.1	32.2	175.6	-55.8	-45.9	0	0	0	115.6	Q23	D21-Q23 VanDerWaalsContact C-N 3.26Å; D21-Q23 PolarHBondContact O-N 2.75Å; D21-Q23 PolarHBondContact O-NE2 2.83Å
22	F	97.1	Very high	93.8	Very high	104 Å²	104	71.4 Å²	71.4	46%	0.456	35%	0.347	S	S	.	.	T	Hydrogen-bonded Turn	trans	60.4	32.3	178.9	-39.7	-70.3	0	0	0	113.9	W17 E20 S47 V48 K49	W17-F22 VanDerWaalsContact CD1-C 3.43Å; W17-F22 HydrophobicContact CD2-CB 4.15Å; W17-F22 HydrophobicContact CD2-CD1 4.46Å; W17-F22 HydrophobicContact CE3-CB 4.46Å; W17-F22 AromaticContact CE3-CD1 3.96Å; W17-F22 HydrophobicContact CE3-CD1 3.96Å; W17-F22 HydrophobicContact CH2-CB 4.39Å; W17-F22 HydrophobicContact CH2-CD1 4.24Å; W17-F22 HydrophobicContact CZ2-CB 4.08Å; W17-F22 AromaticContact CZ3-CD1 3.84Å; W17-F22 HydrophobicContact CZ3-CD1 3.84Å; W17-F22 PolarHBondContact NE1-O 3.29Å; E20-F22 PolarHBondContact O-N 3.37Å; F22-S47 WeakPolarHBondContact CA-OG 3.4Å; F22-S47 PolarHBondContact N-OG 3.48Å; F22-S47 VanDerWaalsContact N-OG 3.1Å; F22-V48 WeakPolarHBondContact CE1-O 3.41Å; F22-K49 HydrophobicContact CD1-CB 4.29Å; F22-K49 HydrophobicContact CE1-CB 4.16Å
23	Q	96.9	Very high	94	Very high	116 Å²	116	70.6 Å²	70.6	54%	0.542	34%	0.343	S	S	.	.			trans	-101.3	173.4	177.8	-60.1	-57.1	-49.3	0	0	112.6	W17 E19 E20 D21	W17-Q23 WeakPolarHBondContact CB-O 3.49Å; E19-Q23 HydrophobicContact CB-CB 4.1Å; E19-Q23 WeakPolarHBondContact CB-O 3.38Å; E20-Q23 WeakPolarHBondContact O-CB 3.38Å; E20-Q23 PolarHBondContact O-N 3.04Å; E20-Q23 VanDerWaalsContact O-N 3.13Å; D21-Q23 VanDerWaalsContact C-N 3.26Å; D21-Q23 PolarHBondContact O-N 2.75Å; D21-Q23 PolarHBondContact O-NE2 2.83Å
24	G	95.2	Very high	93.9	Very high	44 Å²	44	75.6 Å²	75.6	45%	0.454	39%	0.385	S	S	.	.	S	Bend	trans	77	-154.7	176.2	0	0	0	0	0	113.9
25	R	95.2	Very high	93.7	Very high	155 Å²	155	76 Å²	76	59%	0.585	39%	0.387	S	S	*	.			trans	-74.5	143.8	179.4	-70.9	179.2	-69.2	-161.6	-7.5	109.9	W17 D18 L42	W17-R25 VanDerWaalsContact CA-O 3.26Å; W17-R25 WeakPolarHBondContact CA-O 3.41Å; D18-R25 PolarHBondContact N-O 2.94Å; D18-R25 PolarHBondContact OD1-N 3.49Å; D18-R25 IonicContact OD2-CZ 3.32Å; D18-R25 IonicContact OD2-NE 2.85Å; D18-R25 PolarHBondContact OD2-NE 2.72Å; D18-R25 IonicContact OD2-NH2 2.9Å; D18-R25 PolarHBondContact OD2-NH2 3.36Å; R25-L42 HydrophobicContact CB-CD2 3.97Å
26	R	94.7	Very high	93.4	Very high	168 Å²	168	77.9 Å²	77.9	63%	0.634	40%	0.399	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-130.5	149.9	-178.2	73	-174.1	-179.2	113.2	-0.8	113.9	T15 L16 W17	T15-R26 HydrophobicContact CG2-CB 3.93Å; T15-R26 HydrophobicContact CG2-CG 4.35Å; L16-R26 CarbonylContact O-C 3.4Å; L16-R26 WeakPolarHBondContact O-CA 3.24Å; L16-R26 WeakPolarHBondContact O-CB 3.5Å; W17-R26 HydrophobicContact CD2-CB 4.19Å; W17-R26 HydrophobicContact CG-CB 4.03Å
27	C	94.6	Very high	93.1	Very high	10 Å²	10	80.1 Å²	80.1	7%	0.068	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	125.1	172.9	-174.6	0	0	0	0	109.7	T15 L16 G40 L42	T15-C27 WeakPolarHBondContact CA-O 3.45Å; L16-C27 PolarHBondContact N-O 3.35Å; L16-C27 PolarHBondContact O-N 3.04Å; C27-G40 WeakPolarHBondContact SG-CA 3.45Å; C27-L42 HydrophobicContact CB-CD1 3.5Å; C27-L42 HydrophobicContact CB-CG 4.12Å
28	R	93.2	Very high	92.6	Very high	121 Å²	121	86.7 Å²	86.7	46%	0.457	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	127.4	175.5	-164	-179.8	-164.8	-173.2	6.4	110	C13 L30 R39 E51	C13-R28 VanDerWaalsContact SG-CZ 3.6Å; C13-R28 PolarHBondContact SG-NE 3.01Å; C13-R28 PolarHBondContact SG-NH2 2.9Å; R28-L30 HydrophobicContact CG-CD2 4.27Å; R28-R39 PolarHBondContact O-NH1 2.79Å; R28-E51 IonicContact CZ-OE2 3.39Å; R28-E51 IonicContact NE-OE2 3.17Å; R28-E51 PolarHBondContact NE-OE2 2.61Å; R28-E51 IonicContact NH2-OE1 3.75Å; R28-E51 IonicContact NH2-OE2 2.8Å; R28-E51 PolarHBondContact NH2-OE2 2.8Å
29	L	91.3	Very high	91.8	Very high	16 Å²	16	91.9 Å²	91.9	8%	0.084	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	125	175.7	-57.9	-173.4	0	0	0	108.9	C13 L14 L16 C33 V36	C13-L29 WeakPolarHBondContact CA-O 3.11Å; L14-L29 HydrophobicContact CD1-CB 4.11Å; L14-L29 HydrophobicContact CD1-CD1 3.96Å; L14-L29 HydrophobicContact CD1-CG 4.19Å; L14-L29 HydrophobicContact CG-CB 4.11Å; L14-L29 PolarHBondContact N-O 2.82Å; L14-L29 VanDerWaalsContact N-O 3.08Å; L14-L29 PolarHBondContact O-N 3.48Å; L16-L29 HydrophobicContact CD1-CD1 3.85Å; L16-L29 HydrophobicContact CD1-CG 4.4Å; L16-L29 HydrophobicContact CG-CD1 4.48Å; L29-C33 HydrophobicContact CD1-CB 3.79Å; L29-C33 HydrophobicContact CD2-CB 3.74Å; L29-C33 HydrophobicContact CG-CB 4.39Å; L29-V36 HydrophobicContact CD1-CG1 4.26Å
30	L	89.9	Confident	90.7	Very high	101 Å²	101	88 Å²	88	53%	0.529	45%	0.452	S	S	.	.	S	Bend	trans	-112.1	-0.2	177.6	-59.7	178.3	0	0	0	112	V12 C13 R28	V12-L30 CarbonylContact O-C 3.54Å; V12-L30 VanDerWaalsContact O-CA 3.27Å; V12-L30 WeakPolarHBondContact O-CA 3.44Å; C13-L30 HydrophobicContact CB-CD2 4.31Å; C13-L30 VanDerWaalsContact SG-CD2 3.56Å; R28-L30 HydrophobicContact CG-CD2 4.27Å
31	S	87.1	Confident	89.8	Confident	30 Å²	30	85.6 Å²	85.6	21%	0.21	45%	0.451	C	S	.	.	S	Bend	trans	-164.7	173.3	-178.5	59.1	0	0	0	0	108.5	C33	S31-C33 PolarHBondContact O-N 2.89Å
32	D	86.4	Confident	89.5	Confident	112 Å²	112	79.6 Å²	79.6	60%	0.599	42%	0.419	S	S	*	.			trans	-55.7	138.6	179.6	-57.4	-25	0	0	0	111.8	S3	S3-D32 WeakPolarHBondContact OG-CB 3.06Å; S3-D32 PolarHBondContact OG-OD2 2.88Å
33	C	87.8	Confident	89.3	Confident	34 Å²	34	86 Å²	86	23%	0.23	44%	0.44	C	S	.	.			trans	-129.2	104.9	178.5	-174.4	0	0	0	0	109.3	L29 S31 N35 R39	L29-C33 HydrophobicContact CD1-CB 3.79Å; L29-C33 HydrophobicContact CD2-CB 3.74Å; L29-C33 HydrophobicContact CG-CB 4.39Å; S31-C33 PolarHBondContact O-N 2.89Å; C33-N35 PolarHBondContact O-N 2.92Å; C33-N35 VanDerWaalsContact SG-C 3.53Å; C33-N35 PolarHBondContact SG-O 2.97Å; C33-N35 VanDerWaalsContact SG-O 3.35Å; C33-R39 VanDerWaalsContact SG-CD 3.53Å
34	A	89.2	Confident	89.2	Confident	117 Å²	117	88.5 Å²	88.5	97%	0.967	45%	0.445	S	S	*	.	S	Bend	trans	-66.5	-27.3	179.4	0	0	0	0	0	112.9
35	N	90.6	Very high	89.2	Confident	60 Å²	60	88.9 Å²	88.9	32%	0.321	44%	0.438	S	S	.	.			trans	-142.8	103.6	178.6	-169.2	-14.1	0	0	0	111.9	C33 C37 E38 R39	C33-N35 PolarHBondContact O-N 2.92Å; C33-N35 VanDerWaalsContact SG-C 3.53Å; C33-N35 PolarHBondContact SG-O 2.97Å; C33-N35 VanDerWaalsContact SG-O 3.35Å; N35-C37 VanDerWaalsContact C-N 3.29Å; N35-C37 PolarHBondContact O-N 3.34Å; N35-C37 VanDerWaalsContact OD1-CB 3.25Å; N35-C37 WeakPolarHBondContact OD1-CB 3.38Å; N35-C37 PolarHBondContact OD1-N 3.34Å; N35-E38 HydrophobicContact CB-CB 4.26Å; N35-E38 HydrophobicContact CB-CG 4.26Å; N35-E38 WeakPolarHBondContact ND2-CG 3.27Å; N35-E38 PolarHBondContact ND2-OE1 3.28Å; N35-E38 PolarHBondContact O-N 3.08Å; N35-E38 PolarHBondContact OD1-N 3.17Å; N35-R39 PolarHBondContact O-N 3.01Å
36	V	89.3	Confident	89.3	Confident	43 Å²	43	87.5 Å²	87.5	26%	0.261	43%	0.433	S	S	.	.	H	α-helix	trans	-70	-24.3	178.8	-64.6	0	0	0	0	113.2	L16 L29 G40	L16-V36 HydrophobicContact CD1-CB 4.29Å; L16-V36 HydrophobicContact CD1-CG1 3.71Å; L29-V36 HydrophobicContact CD1-CG1 4.26Å; V36-G40 PolarHBondContact O-N 2.83Å
37	C	89.2	Confident	89.5	Confident	63 Å²	63	80.2 Å²	80.2	43%	0.426	41%	0.408	S	S	.	.	H	α-helix	trans	-68.5	-37.2	176.1	-61.4	0	0	0	0	111.2	N35 A41 L42	N35-C37 VanDerWaalsContact C-N 3.29Å; N35-C37 PolarHBondContact O-N 3.34Å; N35-C37 VanDerWaalsContact OD1-CB 3.25Å; N35-C37 WeakPolarHBondContact OD1-CB 3.38Å; N35-C37 PolarHBondContact OD1-N 3.34Å; C37-A41 WeakPolarHBondContact O-CA 3.47Å; C37-A41 PolarHBondContact O-N 3.13Å; C37-A41 VanDerWaalsContact O-N 3.14Å; C37-L42 PolarHBondContact SG-O 3.1Å
38	E	86.3	Confident	89.6	Confident	161 Å²	161	83.2 Å²	83.2	75%	0.752	43%	0.426	S	S	*	.	H	α-helix	trans	-75	-41.6	178.1	-75.4	169.7	-157.5	0	0	112	N35	N35-E38 HydrophobicContact CB-CB 4.26Å; N35-E38 HydrophobicContact CB-CG 4.26Å; N35-E38 WeakPolarHBondContact ND2-CG 3.27Å; N35-E38 PolarHBondContact ND2-OE1 3.28Å; N35-E38 PolarHBondContact O-N 3.08Å; N35-E38 PolarHBondContact OD1-N 3.17Å
39	R	79.8	Confident	89.7	Confident	132 Å²	132	82.6 Å²	82.6	50%	0.498	43%	0.426	S	S	.	.	H	α-helix	trans	-82.1	-33.7	-173.5	-163.3	171.3	-165.2	-90.5	1.5	113.9	R28 C33 N35	R28-R39 PolarHBondContact O-NH1 2.79Å; C33-R39 VanDerWaalsContact SG-CD 3.53Å; N35-R39 PolarHBondContact O-N 3.01Å
40	G	75.5	Confident	89.9	Confident	20 Å²	20	86 Å²	86	21%	0.206	45%	0.447	C	S	.	.	H	α-helix	trans	-117.2	-4.7	-174.4	0	0	0	0	0	114.9	C27 V36 L42	C27-G40 WeakPolarHBondContact SG-CA 3.45Å; V36-G40 PolarHBondContact O-N 2.83Å; G40-L42 PolarHBondContact O-N 3.09Å
41	A	79.2	Confident	90.1	Very high	63 Å²	63	85.6 Å²	85.6	52%	0.521	44%	0.443	S	S	.	.			trans	52.8	19.5	-167.1	0	0	0	0	0	113.6	C37 R43	C37-A41 WeakPolarHBondContact O-CA 3.47Å; C37-A41 PolarHBondContact O-N 3.13Å; C37-A41 VanDerWaalsContact O-N 3.14Å; A41-R43 PolarHBondContact O-N 3.14Å
42	L	90.8	Very high	90.2	Very high	1 Å²	1	87.4 Å²	87.4	1%	0.005	45%	0.45	C	S	.	.			trans	-83.2	104.6	178.4	-61.6	179.8	0	0	0	108.4	L16 D18 R25 C27 C37 G40 R44 V45	L16-L42 HydrophobicContact CB-CD1 3.65Å; D18-L42 HydrophobicContact CB-CD2 3.93Å; R25-L42 HydrophobicContact CB-CD2 3.97Å; C27-L42 HydrophobicContact CB-CD1 3.5Å; C27-L42 HydrophobicContact CB-CG 4.12Å; C37-L42 PolarHBondContact SG-O 3.1Å; G40-L42 PolarHBondContact O-N 3.09Å; L42-R44 VanDerWaalsContact C-N 3.28Å; L42-V45 HydrophobicContact CD1-CG2 4.42Å
43	R	92.4	Very high	90.1	Very high	238 Å²	238	84.1 Å²	84.1	90%	0.898	44%	0.443	S	S	*	.	S	Bend	trans	-73.6	-23.1	174.7	-67.9	-170.3	175.8	-160.5	-0.9	113	A41	A41-R43 PolarHBondContact O-N 3.14Å
44	R	94.9	Very high	89.3	Confident	169 Å²	169	90.9 Å²	90.9	64%	0.638	50%	0.501	S	S	*	.			trans	-147.9	143	178.8	-167.4	169	-175.7	164.4	0.8	108.2	D18 L42	D18-R44 VanDerWaalsContact CA-O 3.31Å; D18-R44 WeakPolarHBondContact CA-O 3.28Å; D18-R44 VanDerWaalsContact CB-O 3.32Å; D18-R44 WeakPolarHBondContact CB-O 3.5Å; L42-R44 VanDerWaalsContact C-N 3.28Å
45	V	96.1	Very high	89.3	Confident	53 Å²	53	89.6 Å²	89.6	32%	0.321	48%	0.478	S	S	.	.			trans	-109.9	132.2	172	179.4	0	0	0	0	107.8	L16 W17 L42 V48	L16-V45 HydrophobicContact CB-CG1 4.14Å; L16-V45 HydrophobicContact CB-CG2 4.16Å; L16-V45 HydrophobicContact CD1-CG2 4.24Å; L16-V45 HydrophobicContact CD2-CG1 4.2Å; W17-V45 CarbonylContact O-C 3.49Å; W17-V45 VanDerWaalsContact O-CA 3.3Å; W17-V45 WeakPolarHBondContact O-CA 3.46Å; L42-V45 HydrophobicContact CD1-CG2 4.42Å; V45-V48 HydrophobicContact CG1-CG2 3.66Å
46	R	97.8	Very high	89.2	Confident	126 Å²	126	91.1 Å²	91.1	48%	0.475	49%	0.486	S	S	.	.			trans	-121.4	-21.4	-179.7	-71.8	-166.1	-169.3	-124.1	6.4	113.8	W17 D18 E19 E20	W17-R46 PolarHBondContact O-N 3.01Å; D18-R46 VanDerWaalsContact O-CD 3.24Å; D18-R46 WeakPolarHBondContact O-CD 3.44Å; D18-R46 VanDerWaalsContact O-CG 3.24Å; D18-R46 WeakPolarHBondContact O-CG 3.3Å; E19-R46 VanDerWaalsContact C-CB 3.41Å; E19-R46 WeakPolarHBondContact O-CB 3.44Å; E20-R46 HydrophobicContact CG-CB 4.04Å; E20-R46 IonicContact OE1-NH1 3.32Å; E20-R46 PolarHBondContact OE1-NH1 3.37Å
47	S	98	Very high	89.2	Confident	14 Å²	14	93.8 Å²	93.8	10%	0.098	50%	0.498	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.3	152.1	170.1	59.5	0	0	0	0	111.3	W17 E19 F22	W17-S47 WeakPolarHBondContact CB-OG 3.26Å; W17-S47 PolarHBondContact N-O 3.32Å; W17-S47 PolarHBondContact O-N 2.96Å; E19-S47 WeakPolarHBondContact O-CB 3.49Å; E19-S47 PolarHBondContact O-N 3.03Å; E19-S47 PolarHBondContact O-OG 3.35Å; F22-S47 WeakPolarHBondContact CA-OG 3.4Å; F22-S47 PolarHBondContact N-OG 3.48Å; F22-S47 VanDerWaalsContact N-OG 3.1Å
48	V	96.7	Very high	89.2	Confident	73 Å²	73	95.6 Å²	95.6	44%	0.442	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.5	136.1	-175.4	-179.8	0	0	0	0	109.5	T15 L16 F22 V45 V50	T15-V48 WeakPolarHBondContact O-CA 3.24Å; L16-V48 HydrophobicContact CD2-CB 4.33Å; L16-V48 HydrophobicContact CD2-CG1 3.89Å; L16-V48 HydrophobicContact CD2-CG2 3.66Å; F22-V48 WeakPolarHBondContact CE1-O 3.41Å; V45-V48 HydrophobicContact CG1-CG2 3.66Å; V48-V50 HydrophobicContact CG1-CG2 4.49Å
49	K	96.4	Very high	89.4	Confident	108 Å²	108	91.5 Å²	91.5	47%	0.47	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	117.9	172.9	-172.4	179.2	-179.4	179.1	0	109	L14 T15 W17 F22	L14-K49 CarbonylContact C-O 3.53Å; L14-K49 VanDerWaalsContact CA-O 3.28Å; L14-K49 WeakPolarHBondContact CA-O 3.31Å; T15-K49 PolarHBondContact N-O 3.25Å; T15-K49 PolarHBondContact O-N 2.92Å; W17-K49 HydrophobicContact CH2-CB 3.6Å; W17-K49 HydrophobicContact CH2-CD 4.19Å; W17-K49 HydrophobicContact CZ3-CB 3.38Å; F22-K49 HydrophobicContact CD1-CB 4.29Å; F22-K49 HydrophobicContact CE1-CB 4.16Å
50	V	95.3	Very high	90	Very high	87 Å²	87	88.8 Å²	88.8	53%	0.527	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.8	122.4	171.1	-175.6	0	0	0	0	107.9	L14 V48	L14-V50 HydrophobicContact CB-CG2 4.43Å; V48-V50 HydrophobicContact CG1-CG2 4.49Å
51	E	93.9	Very high	91.1	Very high	93 Å²	93	93.7 Å²	93.7	44%	0.435	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	-35.2	176.4	-59	-177	113	0	0	111.1	C13 R28	C13-E51 HydrophobicContact CB-CB 4.1Å; C13-E51 WeakPolarHBondContact O-CA 3.18Å; C13-E51 WeakPolarHBondContact O-CB 3.25Å; C13-E51 PolarHBondContact O-N 3.43Å; C13-E51 PolarHBondContact SG-OE2 2.85Å; R28-E51 IonicContact CZ-OE2 3.39Å; R28-E51 IonicContact NE-OE2 3.17Å; R28-E51 PolarHBondContact NE-OE2 2.61Å; R28-E51 IonicContact NH2-OE1 3.75Å; R28-E51 IonicContact NH2-OE2 2.8Å; R28-E51 PolarHBondContact NH2-OE2 2.8Å
52	N	89.5	Confident	92	Very high	69 Å²	69	96.1 Å²	96.1	37%	0.369	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.8	142.7	177.9	-165.7	-50.5	0	0	0	110	A10 P11 C13	A10-N52 WeakPolarHBondContact CB-OD1 3.42Å; P11-N52 WeakPolarHBondContact O-CB 3.43Å; P11-N52 VanDerWaalsContact O-CG 3.31Å; P11-N52 PolarHBondContact O-OD1 2.98Å; C13-N52 HydrophobicContact CB-CB 3.99Å; C13-N52 PolarHBondContact N-O 2.85Å; C13-N52 PolarHBondContact O-N 3.32Å
53	G	83.6	Confident	92.1	Very high	42 Å²	42	104 Å²	104	43%	0.433	55%	0.547	S	S	.	.			trans	110.9	174.5	-175.2	0	0	0	0	0	112.4
54	A	70.4	Confident	92.1	Very high	176 Å²	176	91.8 Å²	91.8	100%	1.455	52%	0.515	S	S	*	.			trans	-129.6	0	178.7	0	0	0	0	0	109.7

Retrieved 54 of 54 residues in 257.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).