A0A087WQR7_MOUSE Loading...

Solute carrier family 16 (monocarboxylic acid transporters), member 14

AlphaFold DB , UniProt , Accession A0A087WQR7, Species MOUSE (Mus musculus, Mouse), Gene Slc16a14, Length 72 aa.

						>A0A087WQR7_MOUSE|A0A087WQR7|Slc16a14
MYTSHEDIGYDLEDDRKAKNKKTLKPHPDIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.9	Low	60.9	Low	237 Å²	237	135.1 Å²	135.1	100%	1.167	67%	0.67	S	S	*	*				0	94.4	0	-89.1	166.9	157.1	0	0	107.4	T3	M1-T3 PolarHBondContact O-N 2.89Å
2	Y	50.6	Low	61.7	Low	236 Å²	236	133.3 Å²	133.3	93%	0.925	66%	0.664	S	S	*	*			trans	-79.3	104.3	171.8	-113.6	-96.6	0	0	0	106.2	S4	Y2-S4 PolarHBondContact O-N 3.08Å
3	T	61	Low	62.1	Low	111 Å²	111	132.5 Å²	132.5	68%	0.681	66%	0.657	S	S	*	*			trans	-76.8	99.8	170.2	56.7	0	0	0	0	106	M1 H5	M1-T3 PolarHBondContact O-N 2.89Å; T3-H5 PolarHBondContact O-N 3.38Å
4	S	59.6	Low	62.6	Low	50 Å²	50	131 Å²	131	35%	0.35	65%	0.653	S	S	.	*			trans	-53.6	131.5	-178.8	-73.4	0	0	0	0	109.7	Y2 E6 D7	Y2-S4 PolarHBondContact O-N 3.08Å; S4-E6 PolarHBondContact O-N 3.15Å; S4-D7 PolarHBondContact O-N 3.27Å
5	H	59.5	Low	62.9	Low	174 Å²	174	127.5 Å²	127.5	81%	0.806	64%	0.637	S	S	*	*	H	α-helix	trans	-52.5	-14	172.9	-175.3	-86.6	0	0	0	113	T3	T3-H5 PolarHBondContact O-N 3.38Å
6	E	61	Low	63.2	Low	135 Å²	135	131.9 Å²	131.9	63%	0.631	64%	0.644	S	S	*	*	H	α-helix	trans	-73	-41.6	175.7	-60.8	171.6	144.9	0	0	112	S4 I8 G9 Y10	S4-E6 PolarHBondContact O-N 3.15Å; E6-I8 VanDerWaalsContact C-N 3.34Å; E6-I8 PolarHBondContact O-N 3.45Å; E6-G9 PolarHBondContact O-N 2.98Å; E6-G9 VanDerWaalsContact O-N 3.1Å; E6-Y10 HydrophobicContact CB-CE2 4.49Å; E6-Y10 WeakPolarHBondContact O-CD2 3.36Å; E6-Y10 PolarHBondContact O-N 2.87Å; E6-Y10 VanDerWaalsContact O-N 3.12Å
7	D	61.1	Low	63.2	Low	108 Å²	108	132.9 Å²	132.9	58%	0.578	64%	0.644	S	S	*	*	H	α-helix	trans	-65.9	-35.1	-176.6	-71.6	-45.2	0	0	0	112.5	S4 G9 Y10 D11	S4-D7 PolarHBondContact O-N 3.27Å; D7-G9 VanDerWaalsContact C-N 3.29Å; D7-G9 PolarHBondContact O-N 2.91Å; D7-Y10 PolarHBondContact O-N 3.3Å; D7-D11 PolarHBondContact O-N 2.96Å
8	I	66.2	Low	63.1	Low	105 Å²	105	127.3 Å²	127.3	54%	0.538	62%	0.623	S	S	.	*	H	α-helix	trans	-68.2	-33.2	176.8	-57.9	173.3	0	0	0	110.8	E6 L12	E6-I8 VanDerWaalsContact C-N 3.34Å; E6-I8 PolarHBondContact O-N 3.45Å; I8-L12 HydrophobicContact CG2-CD1 4.04Å; I8-L12 WeakPolarHBondContact O-CB 3.41Å; I8-L12 PolarHBondContact O-N 2.91Å
9	G	62.8	Low	63	Low	35 Å²	35	127.5 Å²	127.5	36%	0.361	62%	0.621	S	S	.	*	H	α-helix	trans	-69.4	-44.2	176.6	0	0	0	0	0	112.2	E6 D7 D11 L12 E13	E6-G9 PolarHBondContact O-N 2.98Å; E6-G9 VanDerWaalsContact O-N 3.1Å; D7-G9 VanDerWaalsContact C-N 3.29Å; D7-G9 PolarHBondContact O-N 2.91Å; G9-D11 PolarHBondContact O-N 3.49Å; G9-L12 PolarHBondContact O-N 3.37Å; G9-E13 WeakPolarHBondContact O-CB 3.23Å; G9-E13 WeakPolarHBondContact O-CG 3.5Å; G9-E13 PolarHBondContact O-N 2.98Å
10	Y	66.8	Low	62.8	Low	171 Å²	171	127.3 Å²	127.3	67%	0.671	62%	0.622	S	S	*	*	H	α-helix	trans	-62.7	-43.2	180	-81.4	-75.2	0	0	0	112.7	E6 D7 E13 D14	E6-Y10 HydrophobicContact CB-CE2 4.49Å; E6-Y10 WeakPolarHBondContact O-CD2 3.36Å; E6-Y10 PolarHBondContact O-N 2.87Å; E6-Y10 VanDerWaalsContact O-N 3.12Å; D7-Y10 PolarHBondContact O-N 3.3Å; Y10-E13 PolarHBondContact O-N 2.97Å; Y10-D14 WeakPolarHBondContact O-CB 3.44Å; Y10-D14 PolarHBondContact O-N 3.23Å
11	D	67.8	Low	62.5	Low	124 Å²	124	130 Å²	130	66%	0.663	63%	0.631	S	S	*	*	H	α-helix	trans	-70.3	-36.9	-178.1	-144.4	-2.2	0	0	0	111.8	D7 G9 D15	D7-D11 PolarHBondContact O-N 2.96Å; G9-D11 PolarHBondContact O-N 3.49Å; D11-D15 WeakPolarHBondContact O-CB 3.12Å; D11-D15 PolarHBondContact O-N 3.09Å
12	L	70.5	Confident	62.5	Low	113 Å²	113	125.4 Å²	125.4	59%	0.592	60%	0.604	S	S	*	*	H	α-helix	trans	-71.7	-36.8	174.8	-83.3	165.6	0	0	0	113.1	I8 G9 R16	I8-L12 HydrophobicContact CG2-CD1 4.04Å; I8-L12 WeakPolarHBondContact O-CB 3.41Å; I8-L12 PolarHBondContact O-N 2.91Å; G9-L12 PolarHBondContact O-N 3.37Å; L12-R16 WeakPolarHBondContact O-CB 3.35Å; L12-R16 PolarHBondContact O-N 3.17Å
13	E	67.1	Low	63	Low	123 Å²	123	118.3 Å²	118.3	58%	0.575	59%	0.586	S	S	*	*	H	α-helix	trans	-68.6	-38	175.2	-76.1	-148.6	129.6	0	0	111.7	G9 Y10 K17	G9-E13 WeakPolarHBondContact O-CB 3.23Å; G9-E13 WeakPolarHBondContact O-CG 3.5Å; G9-E13 PolarHBondContact O-N 2.98Å; Y10-E13 PolarHBondContact O-N 2.97Å; E13-K17 WeakPolarHBondContact O-CB 2.87Å; E13-K17 WeakPolarHBondContact O-CG 3.35Å; E13-K17 PolarHBondContact O-N 3.32Å
14	D	69	Low	62.9	Low	112 Å²	112	120.2 Å²	120.2	60%	0.599	59%	0.591	S	S	*	*	H	α-helix	trans	-67.5	-45.1	175.7	-161.5	77.7	0	0	0	111.3	Y10 R16 K17 A18	Y10-D14 WeakPolarHBondContact O-CB 3.44Å; Y10-D14 PolarHBondContact O-N 3.23Å; D14-R16 VanDerWaalsContact C-N 3.33Å; D14-R16 PolarHBondContact O-N 2.78Å; D14-K17 PolarHBondContact O-N 3.1Å; D14-A18 WeakPolarHBondContact O-CB 3.4Å; D14-A18 PolarHBondContact O-N 3.3Å
15	D	66.8	Low	62.7	Low	79 Å²	79	127.1 Å²	127.1	42%	0.422	62%	0.615	S	S	.	*	H	α-helix	trans	-66.9	-34.7	177	-156.4	-89.3	0	0	0	112	D11 K19	D11-D15 WeakPolarHBondContact O-CB 3.12Å; D11-D15 PolarHBondContact O-N 3.09Å; D15-K19 VanDerWaalsContact O-CB 3.32Å; D15-K19 WeakPolarHBondContact O-CB 3.39Å; D15-K19 PolarHBondContact O-N 3.28Å
16	R	68.1	Low	62.7	Low	197 Å²	197	124.1 Å²	124.1	74%	0.743	61%	0.611	S	S	*	*	H	α-helix	trans	-70.6	-41.7	175.7	-167.1	-173.4	-82	-163.7	-2.7	111.6	L12 D14 K19 N20	L12-R16 WeakPolarHBondContact O-CB 3.35Å; L12-R16 PolarHBondContact O-N 3.17Å; D14-R16 VanDerWaalsContact C-N 3.33Å; D14-R16 PolarHBondContact O-N 2.78Å; R16-K19 PolarHBondContact O-N 2.71Å; R16-N20 WeakPolarHBondContact O-CB 3.17Å; R16-N20 PolarHBondContact O-N 3.48Å
17	K	62.2	Low	62.5	Low	149 Å²	149	123.1 Å²	123.1	65%	0.648	61%	0.606	S	S	*	*	H	α-helix	trans	-66.5	-40.1	172.5	-79	-169.9	-175.8	-175	0	111.4	E13 D14 N20 K21	E13-K17 WeakPolarHBondContact O-CB 2.87Å; E13-K17 WeakPolarHBondContact O-CG 3.35Å; E13-K17 PolarHBondContact O-N 3.32Å; D14-K17 PolarHBondContact O-N 3.1Å; K17-N20 PolarHBondContact O-N 3.33Å; K17-K21 WeakPolarHBondContact O-CB 3.28Å; K17-K21 PolarHBondContact O-N 3.18Å
18	A	62.5	Low	62.3	Low	33 Å²	33	122 Å²	122	27%	0.273	60%	0.604	S	S	.	*	H	α-helix	trans	-59.9	-48.8	173.9	0	0	0	0	0	109.7	D14 K21 K22	D14-A18 WeakPolarHBondContact O-CB 3.4Å; D14-A18 PolarHBondContact O-N 3.3Å; A18-K21 WeakPolarHBondContact O-CB 3.17Å; A18-K21 PolarHBondContact O-N 2.76Å; A18-K22 WeakPolarHBondContact O-CE 3.18Å; A18-K22 WeakPolarHBondContact O-CG 3.32Å; A18-K22 PolarHBondContact O-N 2.79Å
19	K	61.2	Low	61.8	Low	131 Å²	131	121.8 Å²	121.8	57%	0.57	60%	0.604	S	S	*	*	H	α-helix	trans	-60.3	-42.8	176.2	-92.2	-179.1	-179.8	166.9	0	113.2	D15 R16 K21 K22 T23	D15-K19 VanDerWaalsContact O-CB 3.32Å; D15-K19 WeakPolarHBondContact O-CB 3.39Å; D15-K19 PolarHBondContact O-N 3.28Å; R16-K19 PolarHBondContact O-N 2.71Å; K19-K21 PolarHBondContact O-N 3.45Å; K19-K22 PolarHBondContact O-N 2.92Å; K19-K22 VanDerWaalsContact O-N 3.08Å; K19-T23 PolarHBondContact O-N 2.98Å
20	N	58.7	Low	61.6	Low	123 Å²	123	126 Å²	126	66%	0.658	62%	0.617	S	S	*	*	H	α-helix	trans	-67.5	-27.4	178	-150.8	-93.1	0	0	0	112	R16 K17 T23	R16-N20 WeakPolarHBondContact O-CB 3.17Å; R16-N20 PolarHBondContact O-N 3.48Å; K17-N20 PolarHBondContact O-N 3.33Å; N20-T23 PolarHBondContact O-OG1 3.48Å
21	K	55.9	Low	61.5	Low	183 Å²	183	123.3 Å²	123.3	80%	0.796	61%	0.614	S	S	*	*	H	α-helix	trans	-78.5	-17	172.2	-161	174.6	-179	-173.9	0	113.6	K17 A18 K19	K17-K21 WeakPolarHBondContact O-CB 3.28Å; K17-K21 PolarHBondContact O-N 3.18Å; A18-K21 WeakPolarHBondContact O-CB 3.17Å; A18-K21 PolarHBondContact O-N 2.76Å; K19-K21 PolarHBondContact O-N 3.45Å
22	K	55.2	Low	61.6	Low	141 Å²	141	120.9 Å²	120.9	61%	0.613	62%	0.619	S	S	*	*	H	α-helix	trans	-84.3	-13.6	175.9	-29.2	-176.6	-170.8	173.9	0	112.2	A18 K19	A18-K22 WeakPolarHBondContact O-CE 3.18Å; A18-K22 WeakPolarHBondContact O-CG 3.32Å; A18-K22 PolarHBondContact O-N 2.79Å; K19-K22 PolarHBondContact O-N 2.92Å; K19-K22 VanDerWaalsContact O-N 3.08Å
23	T	59.2	Low	61.9	Low	87 Å²	87	117.4 Å²	117.4	53%	0.534	61%	0.611	S	S	.	*	S	Bend	trans	-89.5	118.1	171.8	49.6	0	0	0	0	109.5	K19 N20	K19-T23 PolarHBondContact O-N 2.98Å; N20-T23 PolarHBondContact O-OG1 3.48Å
24	L	59	Low	62.7	Low	151 Å²	151	119 Å²	119	79%	0.791	61%	0.611	S	S	*	*			trans	69.7	76.3	-177.6	-72.5	83.4	0	0	0	114.2	P26	L24-P26 VanDerWaalsContact O-CD 3.25Å; L24-P26 WeakPolarHBondContact O-CD 3.34Å
25	K	56	Low	63.4	Low	196 Å²	196	116.7 Å²	116.7	85%	0.852	61%	0.608	S	S	*	*			trans	-62.7	115.4	130.6	-77.5	-169.5	174.9	-172.1	0	105	H27	K25-H27 PolarHBondContact O-N 3.26Å
26	P	58.8	Low	64.4	Low	111 Å²	111	121.7 Å²	121.7	72%	0.721	62%	0.621	S	S	*	*			trans	-53.8	117.3	165.1	-15	28.6	0	0	0	104.7	L24 P28	L24-P26 VanDerWaalsContact O-CD 3.25Å; L24-P26 WeakPolarHBondContact O-CD 3.34Å; P26-P28 VanDerWaalsContact O-CD 3.22Å; P26-P28 WeakPolarHBondContact O-CD 3.44Å
27	H	57.4	Low	65.3	Low	114 Å²	114	118.3 Å²	118.3	53%	0.528	62%	0.615	S	S	.	*			trans	-58.4	114.8	173.2	-173.7	42.9	0	0	0	105.3	K25 D29 I30	K25-H27 PolarHBondContact O-N 3.26Å; H27-D29 VanDerWaalsContact CE1-CG 3.41Å; H27-D29 IonicContact CE1-OD2 2.9Å; H27-D29 PolarHBondContact CE1-OD2 2.85Å; H27-D29 IonicContact ND1-OD2 3.82Å; H27-D29 IonicContact NE2-OD2 3.08Å; H27-D29 PolarHBondContact NE2-OD2 3.42Å; H27-D29 VanDerWaalsContact NE2-OD2 3.08Å; H27-D29 PolarHBondContact O-N 3.29Å; H27-I30 PolarHBondContact O-N 3.32Å
28	P	57.2	Low	66.6	Low	83 Å²	83	116.5 Å²	116.5	54%	0.539	61%	0.61	S	S	.	*	T	Hydrogen-bonded Turn	trans	-59.7	-22.6	-173.8	23.8	-32.5	0	0	0	110.9	P26 I30 D31	P26-P28 VanDerWaalsContact O-CD 3.22Å; P26-P28 WeakPolarHBondContact O-CD 3.44Å; P28-I30 CarbonylContact O-C 3.58Å; P28-I30 PolarHBondContact O-N 2.99Å; P28-D31 PolarHBondContact O-N 3.3Å
29	D	56.2	Low	67.9	Low	101 Å²	101	119.5 Å²	119.5	54%	0.54	63%	0.625	S	S	.	*	T	Hydrogen-bonded Turn	trans	-70.2	-15.5	-178.7	-49.1	-6.2	0	0	0	112.9	H27 D31	H27-D29 VanDerWaalsContact CE1-CG 3.41Å; H27-D29 IonicContact CE1-OD2 2.9Å; H27-D29 PolarHBondContact CE1-OD2 2.85Å; H27-D29 IonicContact ND1-OD2 3.82Å; H27-D29 IonicContact NE2-OD2 3.08Å; H27-D29 PolarHBondContact NE2-OD2 3.42Å; H27-D29 VanDerWaalsContact NE2-OD2 3.08Å; H27-D29 PolarHBondContact O-N 3.29Å; D29-D31 PolarHBondContact O-N 2.8Å
30	I	57.8	Low	69.4	Low	124 Å²	124	117 Å²	117	64%	0.636	62%	0.618	S	S	*	*	S	Bend	trans	-91.3	55.6	162.4	-52.1	175.1	0	0	0	107.4	H27 P28 G32	H27-I30 PolarHBondContact O-N 3.32Å; P28-I30 CarbonylContact O-C 3.58Å; P28-I30 PolarHBondContact O-N 2.99Å; I30-G32 PolarHBondContact O-N 2.75Å
31	D	63.9	Low	70.9	Confident	114 Å²	114	114.3 Å²	114.3	61%	0.61	61%	0.608	S	S	*	*			trans	-54.7	134	169	-82	-45.5	0	0	0	107.6	P28 D29 G33 W34	P28-D31 PolarHBondContact O-N 3.3Å; D29-D31 PolarHBondContact O-N 2.8Å; D31-G33 PolarHBondContact O-N 2.94Å; D31-W34 PolarHBondContact O-N 3.39Å
32	G	70.5	Confident	72.7	Confident	73 Å²	73	109.5 Å²	109.5	75%	0.753	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.3	3.3	-162.3	0	0	0	0	0	117.9	I30	I30-G32 PolarHBondContact O-N 2.75Å
33	G	77.8	Confident	74.4	Confident	41 Å²	41	108.7 Å²	108.7	42%	0.423	59%	0.594	S	S	.	*	T	Hydrogen-bonded Turn	trans	-94.4	-15.7	171.5	0	0	0	0	0	115.6	D31 A35 W36 M37	D31-G33 PolarHBondContact O-N 2.94Å; G33-A35 VanDerWaalsContact C-N 3.32Å; G33-A35 PolarHBondContact O-N 3.43Å; G33-W36 PolarHBondContact O-N 3.29Å; G33-W36 VanDerWaalsContact O-N 3.16Å; G33-M37 WeakPolarHBondContact O-CG 3.24Å; G33-M37 PolarHBondContact O-N 3.43Å
34	W	84.1	Confident	76	Confident	156 Å²	156	110.4 Å²	110.4	59%	0.591	60%	0.595	S	S	*	*	H	α-helix	trans	-63.9	-37.7	-178.4	-111	94.5	0	0	0	112.9	D31 W36 M37 M38	D31-W34 PolarHBondContact O-N 3.39Å; W34-W36 VanDerWaalsContact C-N 3.34Å; W34-M37 PolarHBondContact O-N 3.01Å; W34-M38 HydrophobicContact CE3-CE 3.83Å; W34-M38 HydrophobicContact CH2-CE 4.42Å; W34-M38 HydrophobicContact CZ3-CE 3.33Å; W34-M38 PolarHBondContact O-N 2.92Å; W34-M38 VanDerWaalsContact O-N 3.16Å
35	A	82.7	Confident	77.5	Confident	64 Å²	64	106.7 Å²	106.7	53%	0.529	58%	0.578	S	S	.	*	H	α-helix	trans	-64	-39.9	175	0	0	0	0	0	111.7	G33 M38 V39	G33-A35 VanDerWaalsContact C-N 3.32Å; G33-A35 PolarHBondContact O-N 3.43Å; A35-M38 PolarHBondContact O-N 2.94Å; A35-V39 WeakPolarHBondContact O-CG2 3.46Å; A35-V39 PolarHBondContact O-N 3.05Å
36	W	87.3	Confident	79	Confident	183 Å²	183	102.6 Å²	102.6	69%	0.693	56%	0.562	S	S	*	*	H	α-helix	trans	-66	-38.3	176.7	-89.5	87.5	0	0	0	112.6	G33 W34 M38 V39 L40	G33-W36 PolarHBondContact O-N 3.29Å; G33-W36 VanDerWaalsContact O-N 3.16Å; W34-W36 VanDerWaalsContact C-N 3.34Å; W36-M38 VanDerWaalsContact C-N 3.29Å; W36-M38 PolarHBondContact O-N 3.44Å; W36-V39 PolarHBondContact O-N 2.91Å; W36-L40 WeakPolarHBondContact O-CG 3.24Å; W36-L40 PolarHBondContact O-N 3.2Å
37	M	88.1	Confident	80.4	Confident	126 Å²	126	101.3 Å²	101.3	62%	0.621	55%	0.548	S	S	*	.	H	α-helix	trans	-62	-38.1	174.1	-68.4	-60.7	-69.1	0	0	111.9	G33 W34 S41	G33-M37 WeakPolarHBondContact O-CG 3.24Å; G33-M37 PolarHBondContact O-N 3.43Å; W34-M37 PolarHBondContact O-N 3.01Å; M37-S41 VanDerWaalsContact O-CB 3.25Å; M37-S41 WeakPolarHBondContact O-CB 3.5Å; M37-S41 PolarHBondContact O-N 3.37Å
38	M	89	Confident	81.7	Confident	111 Å²	111	101.6 Å²	101.6	55%	0.547	55%	0.553	S	S	.	*	H	α-helix	trans	-67.7	-41	175.6	-73.4	-65.6	169.8	0	0	112.7	W34 A35 W36 S41 S42	W34-M38 HydrophobicContact CE3-CE 3.83Å; W34-M38 HydrophobicContact CH2-CE 4.42Å; W34-M38 HydrophobicContact CZ3-CE 3.33Å; W34-M38 PolarHBondContact O-N 2.92Å; W34-M38 VanDerWaalsContact O-N 3.16Å; A35-M38 PolarHBondContact O-N 2.94Å; W36-M38 VanDerWaalsContact C-N 3.29Å; W36-M38 PolarHBondContact O-N 3.44Å; M38-S41 PolarHBondContact O-N 3.04Å; M38-S42 WeakPolarHBondContact O-CB 3.36Å; M38-S42 PolarHBondContact O-N 3.39Å
39	V	90.3	Very high	83	Confident	96 Å²	96	101.9 Å²	101.9	58%	0.582	55%	0.549	S	S	*	.	H	α-helix	trans	-64	-45.7	176.2	174.1	0	0	0	0	111	A35 W36 S42 F43	A35-V39 WeakPolarHBondContact O-CG2 3.46Å; A35-V39 PolarHBondContact O-N 3.05Å; W36-V39 PolarHBondContact O-N 2.91Å; V39-S42 PolarHBondContact O-N 2.95Å; V39-F43 WeakPolarHBondContact O-CB 2.97Å; V39-F43 PolarHBondContact O-N 2.96Å
40	L	92.3	Very high	84.2	Confident	80 Å²	80	101.6 Å²	101.6	42%	0.419	55%	0.545	S	S	.	.	H	α-helix	trans	-62.3	-46	176.1	-75.2	173.9	0	0	0	111.7	W36 S42 F43 F44	W36-L40 WeakPolarHBondContact O-CG 3.24Å; W36-L40 PolarHBondContact O-N 3.2Å; L40-S42 VanDerWaalsContact C-N 3.34Å; L40-S42 PolarHBondContact O-N 3.41Å; L40-F43 WeakPolarHBondContact O-CB 3.41Å; L40-F43 PolarHBondContact O-N 3.42Å; L40-F44 WeakPolarHBondContact O-CD2 3.47Å; L40-F44 PolarHBondContact O-N 3.38Å
41	S	90.8	Very high	85.3	Confident	66 Å²	66	96.9 Å²	96.9	46%	0.462	53%	0.527	S	S	.	.	H	α-helix	trans	-57.4	-46.5	176.9	-177.1	0	0	0	0	111.7	M37 M38 F43 F44 V45	M37-S41 VanDerWaalsContact O-CB 3.25Å; M37-S41 WeakPolarHBondContact O-CB 3.5Å; M37-S41 PolarHBondContact O-N 3.37Å; M38-S41 PolarHBondContact O-N 3.04Å; S41-F43 VanDerWaalsContact C-N 3.34Å; S41-F43 PolarHBondContact O-N 3.16Å; S41-F44 PolarHBondContact O-N 3.16Å; S41-V45 VanDerWaalsContact O-CG2 3.32Å; S41-V45 WeakPolarHBondContact O-CG2 3.47Å; S41-V45 PolarHBondContact O-N 3.39Å
42	S	92.6	Very high	85.5	Confident	82 Å²	82	93.8 Å²	93.8	57%	0.573	52%	0.515	S	S	*	.	H	α-helix	trans	-61.2	-41.4	176.9	179.6	0	0	0	0	112.5	M38 V39 L40 V45 H46	M38-S42 WeakPolarHBondContact O-CB 3.36Å; M38-S42 PolarHBondContact O-N 3.39Å; V39-S42 PolarHBondContact O-N 2.95Å; L40-S42 VanDerWaalsContact C-N 3.34Å; L40-S42 PolarHBondContact O-N 3.41Å; S42-V45 PolarHBondContact O-N 2.99Å; S42-H46 WeakPolarHBondContact O-CB 3.32Å; S42-H46 PolarHBondContact O-N 2.98Å
43	F	92.2	Very high	85.3	Confident	123 Å²	123	96.9 Å²	96.9	54%	0.539	51%	0.51	S	S	.	.	H	α-helix	trans	-62	-46.3	176.7	179.3	-106.8	0	0	0	112.1	V39 L40 S41 H46 I47	V39-F43 WeakPolarHBondContact O-CB 2.97Å; V39-F43 PolarHBondContact O-N 2.96Å; L40-F43 WeakPolarHBondContact O-CB 3.41Å; L40-F43 PolarHBondContact O-N 3.42Å; S41-F43 VanDerWaalsContact C-N 3.34Å; S41-F43 PolarHBondContact O-N 3.16Å; F43-H46 PolarHBondContact O-N 3.26Å; F43-I47 HydrophobicContact CD1-CD1 3.76Å; F43-I47 HydrophobicContact CD2-CD1 4.35Å; F43-I47 HydrophobicContact CE1-CD1 3.28Å; F43-I47 HydrophobicContact CE2-CD1 3.94Å; F43-I47 HydrophobicContact CG-CD1 4.29Å; F43-I47 HydrophobicContact CZ-CD1 3.41Å; F43-I47 VanDerWaalsContact CZ-CD1 3.41Å; F43-I47 HydrophobicContact CZ-CG1 4.44Å; F43-I47 WeakPolarHBondContact O-CG1 3.48Å; F43-I47 PolarHBondContact O-N 3.27Å
44	F	91.9	Very high	84.7	Confident	123 Å²	123	101.6 Å²	101.6	54%	0.539	52%	0.522	S	S	.	.	H	α-helix	trans	-62.6	-45	176	-79.3	-67.9	0	0	0	112.1	L40 S41 H46 I47 L48	L40-F44 WeakPolarHBondContact O-CD2 3.47Å; L40-F44 PolarHBondContact O-N 3.38Å; S41-F44 PolarHBondContact O-N 3.16Å; F44-H46 VanDerWaalsContact C-N 3.29Å; F44-H46 PolarHBondContact O-N 2.66Å; F44-I47 PolarHBondContact O-N 3.05Å; F44-L48 WeakPolarHBondContact O-CB 3.37Å; F44-L48 VanDerWaalsContact O-CG 3.24Å; F44-L48 WeakPolarHBondContact O-CG 3.25Å; F44-L48 PolarHBondContact O-N 3.21Å
45	V	90.3	Very high	83.6	Confident	73 Å²	73	96.3 Å²	96.3	44%	0.442	51%	0.512	S	S	.	.	H	α-helix	trans	-60.4	-41.1	177	171.7	0	0	0	0	110.8	S41 S42 L48 I49	S41-V45 VanDerWaalsContact O-CG2 3.32Å; S41-V45 WeakPolarHBondContact O-CG2 3.47Å; S41-V45 PolarHBondContact O-N 3.39Å; S42-V45 PolarHBondContact O-N 2.99Å; V45-L48 PolarHBondContact O-N 3.06Å; V45-I49 HydrophobicContact CG1-CD1 3.59Å; V45-I49 HydrophobicContact CG1-CG1 4.28Å; V45-I49 WeakPolarHBondContact O-CB 3.14Å; V45-I49 VanDerWaalsContact O-CG1 3.24Å; V45-I49 WeakPolarHBondContact O-CG1 3.43Å; V45-I49 PolarHBondContact O-N 3.08Å
46	H	88.9	Confident	82.4	Confident	111 Å²	111	98.5 Å²	98.5	51%	0.514	51%	0.514	S	S	.	.	H	α-helix	trans	-64.1	-43.6	177.2	-161.9	81.2	0	0	0	112.3	S42 F43 F44 L48 I49 M50	S42-H46 WeakPolarHBondContact O-CB 3.32Å; S42-H46 PolarHBondContact O-N 2.98Å; F43-H46 PolarHBondContact O-N 3.26Å; F44-H46 VanDerWaalsContact C-N 3.29Å; F44-H46 PolarHBondContact O-N 2.66Å; H46-L48 VanDerWaalsContact C-N 3.35Å; H46-I49 PolarHBondContact O-N 2.9Å; H46-M50 WeakPolarHBondContact O-CB 3.25Å; H46-M50 WeakPolarHBondContact O-CG 3.22Å; H46-M50 PolarHBondContact O-N 2.98Å
47	I	86.7	Confident	81	Confident	84 Å²	84	91.8 Å²	91.8	43%	0.431	50%	0.502	S	S	.	.	H	α-helix	trans	-64.5	-40.1	174.6	-67.4	173.1	0	0	0	111	F43 F44 G51	F43-I47 HydrophobicContact CD1-CD1 3.76Å; F43-I47 HydrophobicContact CD2-CD1 4.35Å; F43-I47 HydrophobicContact CE1-CD1 3.28Å; F43-I47 HydrophobicContact CE2-CD1 3.94Å; F43-I47 HydrophobicContact CG-CD1 4.29Å; F43-I47 HydrophobicContact CZ-CD1 3.41Å; F43-I47 VanDerWaalsContact CZ-CD1 3.41Å; F43-I47 HydrophobicContact CZ-CG1 4.44Å; F43-I47 WeakPolarHBondContact O-CG1 3.48Å; F43-I47 PolarHBondContact O-N 3.27Å; F44-I47 PolarHBondContact O-N 3.05Å; I47-G51 WeakPolarHBondContact O-CA 3.35Å; I47-G51 PolarHBondContact O-N 3.21Å
48	L	86	Confident	79.6	Confident	119 Å²	119	90.2 Å²	90.2	62%	0.623	50%	0.499	S	S	*	.	H	α-helix	trans	-67.8	-39	178.2	-73.3	170.5	0	0	0	111.5	F44 V45 H46 S52	F44-L48 WeakPolarHBondContact O-CB 3.37Å; F44-L48 VanDerWaalsContact O-CG 3.24Å; F44-L48 WeakPolarHBondContact O-CG 3.25Å; F44-L48 PolarHBondContact O-N 3.21Å; V45-L48 PolarHBondContact O-N 3.06Å; H46-L48 VanDerWaalsContact C-N 3.35Å; L48-S52 WeakPolarHBondContact O-CA 3.37Å; L48-S52 WeakPolarHBondContact O-CB 3.17Å; L48-S52 PolarHBondContact O-N 2.97Å; L48-S52 PolarHBondContact O-OG 3.49Å
49	I	84.5	Confident	78.1	Confident	90 Å²	90	90.1 Å²	90.1	46%	0.462	50%	0.5	S	S	.	.	H	α-helix	trans	-70.3	-52.5	177.6	-67.5	167.2	0	0	0	110.4	V45 H46 G51 S52 Q53	V45-I49 HydrophobicContact CG1-CD1 3.59Å; V45-I49 HydrophobicContact CG1-CG1 4.28Å; V45-I49 WeakPolarHBondContact O-CB 3.14Å; V45-I49 VanDerWaalsContact O-CG1 3.24Å; V45-I49 WeakPolarHBondContact O-CG1 3.43Å; V45-I49 PolarHBondContact O-N 3.08Å; H46-I49 PolarHBondContact O-N 2.9Å; I49-G51 VanDerWaalsContact C-N 3.35Å; I49-G51 PolarHBondContact O-N 3.39Å; I49-S52 PolarHBondContact O-N 2.86Å; I49-S52 PolarHBondContact O-OG 3.38Å; I49-Q53 WeakPolarHBondContact O-CG 3.4Å; I49-Q53 PolarHBondContact O-N 3.19Å
50	M	81.2	Confident	76.4	Confident	94 Å²	94	89.7 Å²	89.7	46%	0.463	50%	0.495	S	S	.	.	H	α-helix	trans	-64.9	-39.7	178.5	-66.8	-62.4	-156.9	0	0	111.9	H46	H46-M50 WeakPolarHBondContact O-CB 3.25Å; H46-M50 WeakPolarHBondContact O-CG 3.22Å; H46-M50 PolarHBondContact O-N 2.98Å
51	G	80.2	Confident	74.8	Confident	25 Å²	25	90.4 Å²	90.4	26%	0.258	50%	0.503	S	S	.	.	H	α-helix	trans	-72	-37.4	177.5	0	0	0	0	0	113.1	I47 I49 Q53 M54 A55	I47-G51 WeakPolarHBondContact O-CA 3.35Å; I47-G51 PolarHBondContact O-N 3.21Å; I49-G51 VanDerWaalsContact C-N 3.35Å; I49-G51 PolarHBondContact O-N 3.39Å; G51-Q53 VanDerWaalsContact C-N 3.33Å; G51-Q53 PolarHBondContact O-N 3.08Å; G51-M54 CarbonylContact O-C 3.55Å; G51-M54 PolarHBondContact O-N 3Å; G51-M54 VanDerWaalsContact O-N 3.1Å; G51-A55 WeakPolarHBondContact O-CB 2.92Å; G51-A55 PolarHBondContact O-N 3.33Å
52	S	69.1	Low	73.2	Confident	50 Å²	50	92.8 Å²	92.8	35%	0.35	51%	0.506	S	S	.	.	H	α-helix	trans	-66.2	-34.5	175.6	61.9	0	0	0	0	112	L48 I49 M54 A55 L56	L48-S52 WeakPolarHBondContact O-CA 3.37Å; L48-S52 WeakPolarHBondContact O-CB 3.17Å; L48-S52 PolarHBondContact O-N 2.97Å; L48-S52 PolarHBondContact O-OG 3.49Å; I49-S52 PolarHBondContact O-N 2.86Å; I49-S52 PolarHBondContact O-OG 3.38Å; S52-M54 PolarHBondContact O-N 2.75Å; S52-A55 PolarHBondContact O-N 2.85Å; S52-L56 WeakPolarHBondContact O-CB 3.49Å; S52-L56 WeakPolarHBondContact O-CG 3.33Å; S52-L56 PolarHBondContact O-N 2.89Å
53	Q	66.3	Low	71.3	Confident	137 Å²	137	96.7 Å²	96.7	64%	0.64	51%	0.509	S	S	*	.	H	α-helix	trans	-59.3	-36.4	171.3	-71.7	-179	-10.8	0	0	111.9	I49 G51	I49-Q53 WeakPolarHBondContact O-CG 3.4Å; I49-Q53 PolarHBondContact O-N 3.19Å; G51-Q53 VanDerWaalsContact C-N 3.33Å; G51-Q53 PolarHBondContact O-N 3.08Å
54	M	63.6	Low	69.5	Low	140 Å²	140	95.1 Å²	95.1	69%	0.69	51%	0.506	S	S	*	.	H	α-helix	trans	-80	-36.9	176	-65.2	-174	-78.6	0	0	113	G51 S52 G57	G51-M54 CarbonylContact O-C 3.55Å; G51-M54 PolarHBondContact O-N 3Å; G51-M54 VanDerWaalsContact O-N 3.1Å; S52-M54 PolarHBondContact O-N 2.75Å; M54-G57 PolarHBondContact O-N 3.4Å
55	A	61.6	Low	67.8	Low	46 Å²	46	96.4 Å²	96.4	38%	0.38	51%	0.513	S	S	.	.	H	α-helix	trans	-79.5	-32.9	-177.4	0	0	0	0	0	113.5	G51 S52 G57 V58 L59	G51-A55 WeakPolarHBondContact O-CB 2.92Å; G51-A55 PolarHBondContact O-N 3.33Å; S52-A55 PolarHBondContact O-N 2.85Å; A55-G57 PolarHBondContact O-N 3.4Å; A55-V58 PolarHBondContact O-N 2.95Å; A55-V58 VanDerWaalsContact O-N 3.08Å; A55-L59 PolarHBondContact O-N 2.93Å
56	L	57	Low	66.1	Low	109 Å²	109	100.3 Å²	100.3	57%	0.571	53%	0.526	S	S	*	.	H	α-helix	trans	-65.6	-23.9	167.7	-68.8	169.4	0	0	0	111	S52 V58 N60	S52-L56 WeakPolarHBondContact O-CB 3.49Å; S52-L56 WeakPolarHBondContact O-CG 3.33Å; S52-L56 PolarHBondContact O-N 2.89Å; L56-V58 VanDerWaalsContact C-N 3.32Å; L56-N60 WeakPolarHBondContact O-CB 3.22Å; L56-N60 PolarHBondContact O-N 3.5Å
57	G	58.2	Low	64.6	Low	43 Å²	43	100.6 Å²	100.6	44%	0.443	53%	0.527	S	S	.	.	H	α-helix	trans	-66.2	-31.9	169.1	0	0	0	0	0	113.4	M54 A55 V61	M54-G57 PolarHBondContact O-N 3.4Å; A55-G57 PolarHBondContact O-N 3.4Å; G57-V61 VanDerWaalsContact O-CG2 3.23Å; G57-V61 WeakPolarHBondContact O-CG2 3.43Å
58	V	59.1	Low	62.9	Low	92 Å²	92	102.7 Å²	102.7	56%	0.558	53%	0.534	S	S	*	.	H	α-helix	trans	-85.1	-47.8	178.4	172.2	0	0	0	0	111.2	A55 L56 N60 V61 E62	A55-V58 PolarHBondContact O-N 2.95Å; A55-V58 VanDerWaalsContact O-N 3.08Å; L56-V58 VanDerWaalsContact C-N 3.32Å; V58-N60 PolarHBondContact O-N 3.45Å; V58-V61 PolarHBondContact O-N 2.81Å; V58-E62 PolarHBondContact O-N 3.02Å; V58-E62 VanDerWaalsContact O-N 3.15Å
59	L	56.8	Low	61.4	Low	109 Å²	109	105.5 Å²	105.5	57%	0.571	54%	0.544	S	S	*	.	H	α-helix	trans	-69.2	-29.5	179.1	-74.4	163.5	0	0	0	113	A55 W63	A55-L59 PolarHBondContact O-N 2.93Å; L59-W63 WeakPolarHBondContact O-CB 3.32Å; L59-W63 PolarHBondContact O-N 3.46Å
60	N	55.9	Low	59.7	Low	88 Å²	88	104.9 Å²	104.9	47%	0.471	55%	0.548	S	S	.	.	H	α-helix	trans	-74.9	-29.4	175	-166.5	6.3	0	0	0	111.8	L56 V58 L64	L56-N60 WeakPolarHBondContact O-CB 3.22Å; L56-N60 PolarHBondContact O-N 3.5Å; V58-N60 PolarHBondContact O-N 3.45Å; N60-L64 VanDerWaalsContact O-CB 3.28Å; N60-L64 WeakPolarHBondContact O-CB 3.38Å; N60-L64 PolarHBondContact O-N 3.27Å
61	V	57.4	Low	58.4	Low	95 Å²	95	111.9 Å²	111.9	58%	0.576	57%	0.569	S	S	*	*	H	α-helix	trans	-69	-46.1	172.4	167.5	0	0	0	0	110.7	G57 V58 L64 E65	G57-V61 VanDerWaalsContact O-CG2 3.23Å; G57-V61 WeakPolarHBondContact O-CG2 3.43Å; V58-V61 PolarHBondContact O-N 2.81Å; V61-L64 PolarHBondContact O-N 3.45Å; V61-E65 WeakPolarHBondContact O-CB 3.47Å; V61-E65 PolarHBondContact O-N 3.1Å
62	E	56.9	Low	57	Low	116 Å²	116	117.1 Å²	117.1	54%	0.542	62%	0.623	S	S	.	*	H	α-helix	trans	-67.3	-36.8	174.9	-84.5	171.1	159	0	0	112.3	V58 L64 E65 E66	V58-E62 PolarHBondContact O-N 3.02Å; V58-E62 VanDerWaalsContact O-N 3.15Å; E62-L64 PolarHBondContact O-N 2.98Å; E62-E65 PolarHBondContact O-N 3.12Å; E62-E66 WeakPolarHBondContact O-CB 3.5Å; E62-E66 PolarHBondContact O-N 3.34Å
63	W	53.2	Low	56.4	Low	163 Å²	163	120.5 Å²	120.5	62%	0.617	64%	0.637	S	S	*	*	H	α-helix	trans	-65.9	-37.3	175.2	-175.8	46.8	0	0	0	112.3	L59 F67	L59-W63 WeakPolarHBondContact O-CB 3.32Å; L59-W63 PolarHBondContact O-N 3.46Å; W63-F67 AromaticContact CD1-CD2 3.35Å; W63-F67 AromaticContact CD1-CE2 3.78Å; W63-F67 HydrophobicContact CG-CD2 4.46Å; W63-F67 AromaticContact NE1-CD2 3.22Å; W63-F67 AromaticContact NE1-CE2 3.48Å; W63-F67 AromaticContact NE1-CG 3.96Å; W63-F67 WeakPolarHBondContact O-CB 3.1Å; W63-F67 PolarHBondContact O-N 3.47Å
64	L	53.9	Low	55.9	Low	91 Å²	91	119.6 Å²	119.6	48%	0.476	64%	0.636	S	S	.	*	H	α-helix	trans	-70.8	-34.3	174.5	-152.2	85.6	0	0	0	111.9	N60 V61 E62 H68	N60-L64 VanDerWaalsContact O-CB 3.28Å; N60-L64 WeakPolarHBondContact O-CB 3.38Å; N60-L64 PolarHBondContact O-N 3.27Å; V61-L64 PolarHBondContact O-N 3.45Å; E62-L64 PolarHBondContact O-N 2.98Å; L64-H68 WeakPolarHBondContact CG-NE2 3.46Å; L64-H68 WeakPolarHBondContact O-CB 3.14Å; L64-H68 PolarHBondContact O-CD2 3.36Å; L64-H68 PolarHBondContact O-N 3.18Å
65	E	56.6	Low	55.4	Low	150 Å²	150	118.4 Å²	118.4	70%	0.701	63%	0.633	S	S	*	*	H	α-helix	trans	-68.6	-39.8	175.9	-160.5	166.5	-157.7	0	0	111.5	V61 E62	V61-E65 WeakPolarHBondContact O-CB 3.47Å; V61-E65 PolarHBondContact O-N 3.1Å; E62-E65 PolarHBondContact O-N 3.12Å
66	E	55.8	Low	55.1	Low	154 Å²	154	122.7 Å²	122.7	72%	0.72	65%	0.648	S	S	*	*	H	α-helix	trans	-74.4	-37.1	175.9	-157.5	74.8	-151.4	0	0	112.3	E62	E62-E66 WeakPolarHBondContact O-CB 3.5Å; E62-E66 PolarHBondContact O-N 3.34Å
67	F	56.3	Low	54.9	Low	118 Å²	118	123.6 Å²	123.6	52%	0.518	65%	0.653	S	S	.	*	H	α-helix	trans	-94.4	5.6	-178.4	-85.4	-90.5	0	0	0	115.8	W63 Q69 S70	W63-F67 AromaticContact CD1-CD2 3.35Å; W63-F67 AromaticContact CD1-CE2 3.78Å; W63-F67 HydrophobicContact CG-CD2 4.46Å; W63-F67 AromaticContact NE1-CD2 3.22Å; W63-F67 AromaticContact NE1-CE2 3.48Å; W63-F67 AromaticContact NE1-CG 3.96Å; W63-F67 WeakPolarHBondContact O-CB 3.1Å; W63-F67 PolarHBondContact O-N 3.47Å; F67-Q69 PolarHBondContact O-N 2.89Å; F67-Q69 VanDerWaalsContact O-N 3.09Å; F67-S70 PolarHBondContact O-N 3.37Å
68	H	52	Low	54.7	Low	128 Å²	128	128.9 Å²	128.9	59%	0.593	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.4	8.9	160.3	-85	-171.6	0	0	0	113.8	L64	L64-H68 WeakPolarHBondContact CG-NE2 3.46Å; L64-H68 WeakPolarHBondContact O-CB 3.14Å; L64-H68 PolarHBondContact O-CD2 3.36Å; L64-H68 PolarHBondContact O-N 3.18Å
69	Q	53.8	Low	54.4	Low	177 Å²	177	131.6 Å²	131.6	83%	0.827	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.1	0.1	168	-80.4	-68.6	-68.3	0	0	115.5	F67	F67-Q69 PolarHBondContact O-N 2.89Å; F67-Q69 VanDerWaalsContact O-N 3.09Å
70	S	48.2	Very low	54.2	Low	77 Å²	77	133.3 Å²	133.3	54%	0.538	68%	0.683	S	S	.	*			trans	-115.6	48.2	170.8	-152.7	0	0	0	0	112.1	F67 G72	F67-S70 PolarHBondContact O-N 3.37Å; S70-G72 PolarHBondContact O-N 3.35Å
71	R	54.2	Low	54.1	Low	241 Å²	241	137.1 Å²	137.1	91%	0.909	70%	0.701	S	S	*	*			trans	-81.2	76.7	146.7	-66.4	-179.1	69	91.9	1	107.3
72	G	51	Low	53.8	Low	135 Å²	135	140.9 Å²	140.9	100%	1.392	71%	0.712	S	S	*	*			trans	-144.2	0	171.4	0	0	0	0	0	108.3	S70	S70-G72 PolarHBondContact O-N 3.35Å

Retrieved 72 of 72 residues in 62.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).