A0A087WQT3_MOUSE Loading...

Influenza virus NS1A binding protein

AlphaFold DB , UniProt , Accession A0A087WQT3, Species MOUSE (Mus musculus, Mouse), Gene Ivns1abp, Length 77 aa.

						>A0A087WQT3_MOUSE|A0A087WQT3|Ivns1abp
WTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLDGEYPGLERAK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	W	87.3	Confident	95.9	Very high	314 Å²	314	108.5 Å²	108.5	100%	1.189	56%	0.556	S	S	*	*				0	134.5	0	-67.6	97	0	0	0	108.6
2	T	92.9	Very high	96	Very high	136 Å²	136	107 Å²	107	83%	0.834	54%	0.544	S	S	*	.			trans	-127.7	145	174.1	-70.4	0	0	0	0	108.1
3	S	95.2	Very high	96.1	Very high	111 Å²	111	107.4 Å²	107.4	78%	0.776	54%	0.543	S	S	*	.	P	Polyproline II helix	trans	-70.5	131.7	176.5	-57.9	0	0	0	0	111.4
4	C	96.1	Very high	96.3	Very high	79 Å²	79	101.8 Å²	101.8	53%	0.534	52%	0.518	S	S	.	.	P	Polyproline II helix	trans	-86.3	172.2	164.6	-62.7	0	0	0	0	110.2	Y41 N46	C4-Y41 HydrophobicContact CB-CE2 4.18Å; C4-Y41 PolarHBondContact SG-OH 2.84Å; C4-Y41 VanDerWaalsContact SG-OH 3.39Å; C4-N46 WeakPolarHBondContact CA-OD1 2.98Å
5	A	97.9	Very high	96.4	Very high	24 Å²	24	95.5 Å²	95.5	20%	0.198	49%	0.488	C	S	.	.	P	Polyproline II helix	trans	-55.6	142.4	173.1	0	0	0	0	0	111.6	N46 W48	A5-N46 WeakPolarHBondContact CB-O 3.49Å; A5-N46 PolarHBondContact N-ND2 2.97Å; A5-N46 PolarHBondContact N-OD1 3.46Å; A5-W48 VanDerWaalsContact O-CD1 3.24Å; A5-W48 PolarHBondContact O-NE1 3Å
6	P	98.1	Very high	96.5	Very high	112 Å²	112	94.7 Å²	94.7	73%	0.727	49%	0.489	S	S	*	.	P	Polyproline II helix	trans	-68.4	153.7	174.9	31	-35.3	0	0	0	110.6	W48	P6-W48 VanDerWaalsContact O-CD1 3.26Å
7	L	97.9	Very high	96.6	Very high	50 Å²	50	90.3 Å²	90.3	26%	0.262	47%	0.468	S	S	.	.	P	Polyproline II helix	trans	-61.2	149.5	169.7	-66.8	168.6	0	0	0	111	I9 R11 I25 W48	L7-I9 VanDerWaalsContact C-N 3.31Å; L7-I9 WeakPolarHBondContact CB-O 3.22Å; L7-R11 HydrophobicContact CD1-CG 3.7Å; L7-I25 HydrophobicContact CD1-CD1 3.8Å; L7-I25 HydrophobicContact CD2-CD1 4.37Å; L7-I25 HydrophobicContact CD2-CG2 3.69Å; L7-W48 HydrophobicContact CD2-CD2 3.42Å; L7-W48 VanDerWaalsContact CD2-CD2 3.42Å; L7-W48 HydrophobicContact CD2-CE3 3.54Å; L7-W48 HydrophobicContact CD2-CG 3.96Å; L7-W48 HydrophobicContact CD2-CH2 3.9Å; L7-W48 HydrophobicContact CD2-CZ2 3.79Å; L7-W48 HydrophobicContact CD2-CZ3 3.79Å
8	N	97.9	Very high	96.7	Very high	100 Å²	100	91.2 Å²	91.2	54%	0.535	47%	0.47	S	S	.	.	S	Bend	trans	-68.5	-35.3	172.5	-63.2	-83.6	0	0	0	111	E39 W48	N8-E39 VanDerWaalsContact CB-OE2 3.24Å; N8-E39 WeakPolarHBondContact CB-OE2 3.43Å; N8-E39 PolarHBondContact N-OE1 3.22Å; N8-E39 PolarHBondContact N-OE2 3.22Å; N8-E39 PolarHBondContact ND2-OE2 3.39Å; N8-W48 WeakPolarHBondContact ND2-CB 3.35Å; N8-W48 PolarHBondContact ND2-O 2.99Å
9	I	97.3	Very high	96.6	Very high	34 Å²	34	90.7 Å²	90.7	17%	0.174	47%	0.468	C	S	.	.	S	Bend	trans	-119.2	119.4	177.1	-56.3	172.5	0	0	0	108.8	L7 R11 L35 T37 E39 L50	L7-I9 VanDerWaalsContact C-N 3.31Å; L7-I9 WeakPolarHBondContact CB-O 3.22Å; I9-R11 PolarHBondContact O-N 2.89Å; I9-R11 PolarHBondContact O-NE 3.18Å; I9-R11 VanDerWaalsContact O-NE 3.14Å; I9-L35 HydrophobicContact CG2-CD1 3.8Å; I9-L35 HydrophobicContact CG2-CD2 4.39Å; I9-T37 HydrophobicContact CD1-CG2 3.92Å; I9-E39 PolarHBondContact N-OE1 3.48Å; I9-L50 HydrophobicContact CD1-CD2 3.89Å
10	R	96.7	Very high	96.5	Very high	200 Å²	200	89.4 Å²	89.4	76%	0.755	48%	0.477	S	S	*	.			trans	-63.6	132.6	173.6	-71.4	-173	-69.3	-169.2	-4.4	109.4	E30	R10-E30 WeakPolarHBondContact O-CB 3.4Å
11	R	97.4	Very high	96.5	Very high	34 Å²	34	87.3 Å²	87.3	13%	0.128	48%	0.477	C	S	.	.			trans	-150.3	156	-173.3	59.8	-172.6	73.5	-153.4	7	112.3	L7 I9 S14 I25 G27 A29 L35 T37 E39	L7-R11 HydrophobicContact CD1-CG 3.7Å; I9-R11 PolarHBondContact O-N 2.89Å; I9-R11 PolarHBondContact O-NE 3.18Å; I9-R11 VanDerWaalsContact O-NE 3.14Å; R11-S14 WeakPolarHBondContact CD-OG 3.46Å; R11-S14 WeakPolarHBondContact CG-OG 3.4Å; R11-I25 HydrophobicContact CG-CD1 4.08Å; R11-G27 PolarHBondContact NH1-O 3.46Å; R11-G27 VanDerWaalsContact NH1-O 3.12Å; R11-A29 CarbonylContact C-O 3.57Å; R11-A29 VanDerWaalsContact CA-O 3.24Å; R11-A29 WeakPolarHBondContact CA-O 3.42Å; R11-L35 HydrophobicContact CB-CD1 3.91Å; R11-T37 PolarHBondContact NH1-O 3.17Å; R11-T37 PolarHBondContact NH2-OG1 3.18Å; R11-E39 IonicContact CZ-OE1 3.44Å; R11-E39 IonicContact NE-OE1 3.6Å; R11-E39 IonicContact NH2-OE1 2.63Å; R11-E39 PolarHBondContact NH2-OE1 3Å
12	H	97.3	Very high	97	Very high	90 Å²	90	75.6 Å²	75.6	42%	0.417	43%	0.433	S	S	.	.	B	Isolated β-bridge	trans	-134.3	165.2	167.7	60.5	-70.8	0	0	0	109.4	S14 G28 A29 S31	H12-S14 PolarHBondContact O-N 2.95Å; H12-S14 VanDerWaalsContact O-N 3.17Å; H12-G28 CarbonylContact O-C 3.57Å; H12-G28 WeakPolarHBondContact O-CA 3.43Å; H12-A29 PolarHBondContact CE1-O 2.98Å; H12-A29 VanDerWaalsContact CE1-O 3.31Å; H12-A29 PolarHBondContact N-O 3.09Å; H12-A29 PolarHBondContact ND1-O 2.86Å; H12-A29 PolarHBondContact O-N 2.85Å; H12-S31 PolarHBondContact CE1-O 2.75Å
13	Q	98	Very high	97.3	Very high	112 Å²	112	72.6 Å²	72.6	52%	0.523	41%	0.411	S	S	.	.	S	Bend	trans	56.2	28.7	-179.2	-61	178.1	-34.9	0	0	114.7	R59 G60	Q13-R59 HydrophobicContact CB-CB 4.48Å; Q13-G60 PolarHBondContact O-N 2.9Å
14	S	98.2	Very high	97.5	Very high	29 Å²	29	69.3 Å²	69.3	20%	0.203	38%	0.382	C	S	.	.			trans	-79.6	153.4	175.1	-57.7	0	0	0	0	111.7	R11 H12 I25 G27 G28	R11-S14 WeakPolarHBondContact CD-OG 3.46Å; R11-S14 WeakPolarHBondContact CG-OG 3.4Å; H12-S14 PolarHBondContact O-N 2.95Å; H12-S14 VanDerWaalsContact O-N 3.17Å; S14-I25 VanDerWaalsContact CB-CG1 3.46Å; S14-G27 PolarHBondContact OG-O 2.88Å; S14-G28 WeakPolarHBondContact OG-CA 3.48Å
15	A	98.5	Very high	97.6	Very high	8 Å²	8	66.4 Å²	66.4	7%	0.066	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87	144.8	166.5	0	0	0	0	0	109.2	I25 I26 A61 V63	A15-I25 WeakPolarHBondContact O-CA 3.22Å; A15-I26 HydrophobicContact CB-CB 4.42Å; A15-I26 PolarHBondContact N-O 3.46Å; A15-I26 PolarHBondContact O-N 2.89Å; A15-A61 WeakPolarHBondContact CB-O 3.17Å; A15-V63 HydrophobicContact CB-CB 3.81Å; A15-V63 HydrophobicContact CB-CG1 3.58Å
16	V	98.1	Very high	97.6	Very high	82 Å²	82	66.9 Å²	66.9	50%	0.497	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.2	134.3	179.9	-176.3	0	0	0	0	110.3	Y24 I25 V63	V16-Y24 VanDerWaalsContact CA-O 3.25Å; V16-Y24 WeakPolarHBondContact CA-O 3.34Å; V16-I25 HydrophobicContact CG2-CB 4.47Å; V16-I25 HydrophobicContact CG2-CD1 4.15Å; V16-I25 HydrophobicContact CG2-CG1 4Å; V16-V63 VanDerWaalsContact O-CG1 3.23Å; V16-V63 WeakPolarHBondContact O-CG1 3.24Å
17	C	97.9	Very high	97.6	Very high	20 Å²	20	61.5 Å²	61.5	14%	0.135	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.8	162.2	168.8	56.6	0	0	0	0	111.7	L23 Y24 V63 V65	C17-L23 WeakPolarHBondContact O-CA 3.33Å; C17-Y24 PolarHBondContact N-O 3.37Å; C17-Y24 VanDerWaalsContact N-O 3.13Å; C17-Y24 PolarHBondContact O-N 3.35Å; C17-V63 HydrophobicContact CB-CG1 3.85Å; C17-V63 HydrophobicContact CB-CG2 4.28Å; C17-V65 HydrophobicContact CB-CG2 4.08Å
18	E	97.3	Very high	97.7	Very high	107 Å²	107	59.1 Å²	59.1	50%	0.5	31%	0.313	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	138	164.9	-174.7	-79	136	0	0	108.7	G20 G21 Y22 L23 V65	E18-G20 PolarHBondContact OE1-N 3.25Å; E18-G20 VanDerWaalsContact OE1-N 3.17Å; E18-G21 WeakPolarHBondContact OE1-CA 3.4Å; E18-G21 PolarHBondContact OE1-N 3.13Å; E18-Y22 WeakPolarHBondContact CA-O 3.23Å; E18-L23 HydrophobicContact CB-CD2 3.98Å; E18-L23 HydrophobicContact CG-CD2 4.35Å; E18-V65 WeakPolarHBondContact O-CG2 3.43Å
19	L	96	Very high	97.7	Very high	82 Å²	82	54.4 Å²	54.4	43%	0.429	29%	0.287	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150	119.8	172.9	176.3	58.1	0	0	0	109.8	G21 Y22 Y24 V65	L19-G21 VanDerWaalsContact C-N 3.32Å; L19-G21 PolarHBondContact O-N 2.82Å; L19-Y22 PolarHBondContact N-O 2.74Å; L19-Y22 PolarHBondContact O-N 3.17Å; L19-Y24 HydrophobicContact CB-CD2 4.1Å; L19-Y24 HydrophobicContact CB-CE2 3.78Å; L19-V65 HydrophobicContact CB-CG2 4.04Å; L19-V65 HydrophobicContact CD1-CG1 3.74Å; L19-V65 HydrophobicContact CD1-CG2 4.35Å
20	G	94.4	Very high	97.6	Very high	63 Å²	63	56.3 Å²	56.3	65%	0.649	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.5	35.3	173.1	0	0	0	0	0	113.9	E18 Y22	E18-G20 PolarHBondContact OE1-N 3.25Å; E18-G20 VanDerWaalsContact OE1-N 3.17Å; G20-Y22 VanDerWaalsContact C-N 3.33Å; G20-Y22 VanDerWaalsContact O-CD2 3.22Å; G20-Y22 WeakPolarHBondContact O-CD2 3.25Å; G20-Y22 WeakPolarHBondContact O-CE2 3.47Å
21	G	96.5	Very high	97.4	Very high	47 Å²	47	51.1 Å²	51.1	49%	0.485	29%	0.29	S	S	.	.	T	Hydrogen-bonded Turn	trans	84	2.5	-180	0	0	0	0	0	114.8	E18 L19	E18-G21 WeakPolarHBondContact OE1-CA 3.4Å; E18-G21 PolarHBondContact OE1-N 3.13Å; L19-G21 VanDerWaalsContact C-N 3.32Å; L19-G21 PolarHBondContact O-N 2.82Å
22	Y	98.2	Very high	97.2	Very high	68 Å²	68	60.3 Å²	60.3	27%	0.267	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	147.4	179.6	-58.5	-79.9	0	0	0	111.2	E18 L19 G20 R40 Y41 N42	E18-Y22 WeakPolarHBondContact CA-O 3.23Å; L19-Y22 PolarHBondContact N-O 2.74Å; L19-Y22 PolarHBondContact O-N 3.17Å; G20-Y22 VanDerWaalsContact C-N 3.33Å; G20-Y22 VanDerWaalsContact O-CD2 3.22Å; G20-Y22 WeakPolarHBondContact O-CD2 3.25Å; G20-Y22 WeakPolarHBondContact O-CE2 3.47Å; Y22-R40 HydrophobicContact CD1-CG 4.22Å; Y22-R40 HydrophobicContact CG-CG 4.04Å; Y22-Y41 WeakPolarHBondContact CD1-O 3.38Å; Y22-N42 HydrophobicContact CD1-CB 4.02Å; Y22-N42 HydrophobicContact CE1-CB 3.84Å
23	L	98.3	Very high	97.1	Very high	72 Å²	72	61.2 Å²	61.2	38%	0.377	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	138.8	168.5	-60.3	172.3	0	0	0	110	C17 E18 R40 Y41 W48	C17-L23 WeakPolarHBondContact O-CA 3.33Å; E18-L23 HydrophobicContact CB-CD2 3.98Å; E18-L23 HydrophobicContact CG-CD2 4.35Å; L23-R40 CarbonylContact O-C 3.57Å; L23-R40 VanDerWaalsContact O-CA 3.27Å; L23-R40 WeakPolarHBondContact O-CA 3.45Å; L23-Y41 HydrophobicContact CD1-CD1 4.13Å; L23-Y41 HydrophobicContact CG-CD1 4.49Å; L23-Y41 PolarHBondContact N-O 3.33Å; L23-Y41 PolarHBondContact O-N 3.49Å; L23-W48 HydrophobicContact CB-CH2 4.42Å
24	Y	98.6	Very high	97.1	Very high	42 Å²	42	58.4 Å²	58.4	17%	0.165	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	130.3	176.4	-69	-106.1	0	0	0	108.8	V16 C17 L19 V38 E39 R40 I51	V16-Y24 VanDerWaalsContact CA-O 3.25Å; V16-Y24 WeakPolarHBondContact CA-O 3.34Å; C17-Y24 PolarHBondContact N-O 3.37Å; C17-Y24 VanDerWaalsContact N-O 3.13Å; C17-Y24 PolarHBondContact O-N 3.35Å; L19-Y24 HydrophobicContact CB-CD2 4.1Å; L19-Y24 HydrophobicContact CB-CE2 3.78Å; Y24-V38 HydrophobicContact CD1-CG1 4.23Å; Y24-E39 WeakPolarHBondContact CA-O 3.5Å; Y24-R40 HydrophobicContact CD1-CB 4.19Å; Y24-R40 HydrophobicContact CD1-CG 4.23Å; Y24-R40 HydrophobicContact CD2-CG 4.36Å; Y24-R40 HydrophobicContact CE1-CB 4.06Å; Y24-R40 HydrophobicContact CE1-CG 3.86Å; Y24-R40 HydrophobicContact CE2-CG 3.96Å; Y24-R40 HydrophobicContact CG-CG 4.48Å; Y24-R40 WeakPolarHBondContact OH-CD 3.39Å; Y24-I51 HydrophobicContact CD1-CD1 3.61Å; Y24-I51 HydrophobicContact CE1-CD1 3.43Å; Y24-I51 VanDerWaalsContact CE1-CD1 3.43Å
25	I	98.4	Very high	97.2	Very high	18 Å²	18	57.9 Å²	57.9	9%	0.092	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	121.9	170	-166.2	159.3	0	0	0	109.2	L7 R11 S14 A15 V16 V38 E39 W48	L7-I25 HydrophobicContact CD1-CD1 3.8Å; L7-I25 HydrophobicContact CD2-CD1 4.37Å; L7-I25 HydrophobicContact CD2-CG2 3.69Å; R11-I25 HydrophobicContact CG-CD1 4.08Å; S14-I25 VanDerWaalsContact CB-CG1 3.46Å; A15-I25 WeakPolarHBondContact O-CA 3.22Å; V16-I25 HydrophobicContact CG2-CB 4.47Å; V16-I25 HydrophobicContact CG2-CD1 4.15Å; V16-I25 HydrophobicContact CG2-CG1 4Å; I25-V38 WeakPolarHBondContact O-CA 3.35Å; I25-E39 HydrophobicContact CG2-CB 3.69Å; I25-E39 PolarHBondContact N-O 3.25Å; I25-E39 PolarHBondContact O-N 3.46Å; I25-W48 HydrophobicContact CB-CH2 4.43Å; I25-W48 HydrophobicContact CB-CZ3 4.08Å; I25-W48 HydrophobicContact CG2-CE3 4.16Å; I25-W48 HydrophobicContact CG2-CH2 4.31Å; I25-W48 HydrophobicContact CG2-CZ3 3.64Å
26	I	98.7	Very high	97.2	Very high	34 Å²	34	60.3 Å²	60.3	17%	0.174	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	120.9	-163.2	-62.5	158.4	0	0	0	108.7	A15 V38 M54 V63	A15-I26 HydrophobicContact CB-CB 4.42Å; A15-I26 PolarHBondContact N-O 3.46Å; A15-I26 PolarHBondContact O-N 2.89Å; I26-V38 HydrophobicContact CB-CG2 4.41Å; I26-V38 HydrophobicContact CG1-CG1 3.7Å; I26-V38 HydrophobicContact CG1-CG2 4.18Å; I26-V38 HydrophobicContact CG2-CG2 4.11Å; I26-M54 HydrophobicContact CG2-CE 3.83Å; I26-M54 HydrophobicContact CG2-CG 4.08Å; I26-M54 HydrophobicContact CG2-SD 3.39Å; I26-M54 WeakPolarHBondContact CG2-SD 3.47Å; I26-V63 HydrophobicContact CD1-CB 4.42Å; I26-V63 HydrophobicContact CD1-CG1 4.47Å; I26-V63 HydrophobicContact CD1-CG2 3.81Å
27	G	98.6	Very high	97.2	Very high	0 Å²	0	57.8 Å²	57.8	0%	0	32%	0.316	C	S	.	.			trans	58.9	-140.5	179.7	0	0	0	0	0	113.2	R11 S14 L35 T37	R11-G27 PolarHBondContact NH1-O 3.46Å; R11-G27 VanDerWaalsContact NH1-O 3.12Å; S14-G27 PolarHBondContact OG-O 2.88Å; G27-L35 VanDerWaalsContact CA-O 3.29Å; G27-L35 WeakPolarHBondContact CA-O 3.32Å; G27-T37 PolarHBondContact N-O 2.65Å
28	G	98.5	Very high	97.2	Very high	0 Å²	0	57.3 Å²	57.3	0%	0	31%	0.313	C	S	.	.			trans	98.7	-153.5	-170.6	0	0	0	0	0	111.6	H12 S14 L35 R58	H12-G28 CarbonylContact O-C 3.57Å; H12-G28 WeakPolarHBondContact O-CA 3.43Å; S14-G28 WeakPolarHBondContact OG-CA 3.48Å; G28-L35 PolarHBondContact O-N 3.05Å; G28-R58 PolarHBondContact N-O 3.01Å
29	A	98.1	Very high	97.3	Very high	0 Å²	0	52.2 Å²	52.2	0%	0	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	142.4	177.7	0	0	0	0	0	112.7	R11 H12 N33 R59	R11-A29 CarbonylContact C-O 3.57Å; R11-A29 VanDerWaalsContact CA-O 3.24Å; R11-A29 WeakPolarHBondContact CA-O 3.42Å; H12-A29 PolarHBondContact CE1-O 2.98Å; H12-A29 VanDerWaalsContact CE1-O 3.31Å; H12-A29 PolarHBondContact N-O 3.09Å; H12-A29 PolarHBondContact ND1-O 2.86Å; H12-A29 PolarHBondContact O-N 2.85Å; A29-N33 CarbonylContact C-O 3.6Å; A29-N33 WeakPolarHBondContact CA-O 3.32Å; A29-N33 WeakPolarHBondContact CB-O 3.37Å; A29-R59 HydrophobicContact CB-CB 4.49Å
30	E	96.1	Very high	97.4	Very high	75 Å²	75	51.7 Å²	51.7	35%	0.35	28%	0.281	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	108.2	163.3	-174.6	178.7	-138.8	0	0	107.8	R10 W32 N33 L35	R10-E30 WeakPolarHBondContact O-CB 3.4Å; E30-W32 PolarHBondContact O-N 2.89Å; E30-W32 VanDerWaalsContact O-N 3.12Å; E30-N33 PolarHBondContact N-O 3.31Å; E30-N33 WeakPolarHBondContact O-CB 3.27Å; E30-N33 PolarHBondContact O-N 2.87Å; E30-L35 HydrophobicContact CB-CD1 4.31Å; E30-L35 HydrophobicContact CB-CD2 4.41Å
31	S	91.9	Very high	97.6	Very high	91 Å²	91	49.7 Å²	49.7	64%	0.636	26%	0.255	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.3	-115.9	-169.3	-58.6	0	0	0	0	111.2	H12	H12-S31 PolarHBondContact CE1-O 2.75Å
32	W	93.1	Very high	97.7	Very high	227 Å²	227	48.3 Å²	48.3	86%	0.86	24%	0.236	S	C	*	.	T	Hydrogen-bonded Turn	trans	-91.2	-7.1	179	-63.6	106.3	0	0	0	113.7	E30	E30-W32 PolarHBondContact O-N 2.89Å; E30-W32 VanDerWaalsContact O-N 3.12Å
33	N	96.4	Very high	97.7	Very high	108 Å²	108	48.5 Å²	48.5	58%	0.578	25%	0.246	S	C	*	.	E	Extended strand (participates in β ladder)	trans	-87.2	115.5	-174.9	-63.2	-32.2	0	0	0	110.5	A29 E30	A29-N33 CarbonylContact C-O 3.6Å; A29-N33 WeakPolarHBondContact CA-O 3.32Å; A29-N33 WeakPolarHBondContact CB-O 3.37Å; E30-N33 PolarHBondContact N-O 3.31Å; E30-N33 WeakPolarHBondContact O-CB 3.27Å; E30-N33 PolarHBondContact O-N 2.87Å
34	C	98.1	Very high	97.7	Very high	53 Å²	53	53.3 Å²	53.3	36%	0.358	27%	0.266	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.1	129.3	172.5	-163.3	0	0	0	0	109.7	A57 R58	C34-A57 HydrophobicContact CB-CB 3.97Å; C34-A57 WeakPolarHBondContact O-CB 3.47Å; C34-R58 PolarHBondContact SG-N 2.81Å
35	L	98.6	Very high	97.7	Very high	18 Å²	18	55.6 Å²	55.6	9%	0.094	28%	0.281	C	S	.	.			trans	-95.3	140.3	-176.5	-61.3	173.6	0	0	0	110.8	I9 R11 G27 G28 E30 A57 R58	I9-L35 HydrophobicContact CG2-CD1 3.8Å; I9-L35 HydrophobicContact CG2-CD2 4.39Å; R11-L35 HydrophobicContact CB-CD1 3.91Å; G27-L35 VanDerWaalsContact CA-O 3.29Å; G27-L35 WeakPolarHBondContact CA-O 3.32Å; G28-L35 PolarHBondContact O-N 3.05Å; E30-L35 HydrophobicContact CB-CD1 4.31Å; E30-L35 HydrophobicContact CB-CD2 4.41Å; L35-A57 WeakPolarHBondContact O-CA 3.48Å; L35-R58 PolarHBondContact O-N 2.92Å
36	N	98.6	Very high	97.6	Very high	59 Å²	59	57.9 Å²	57.9	32%	0.316	29%	0.293	S	S	.	.			trans	-103.1	-2.8	163	72.4	-25.7	0	0	0	112.2	P53 M54 A57	N36-P53 CarbonylContact O-C 3.46Å; N36-P53 WeakPolarHBondContact O-CA 3.47Å; N36-P53 WeakPolarHBondContact O-CB 3.15Å; N36-M54 HydrophobicContact CB-CB 4.3Å; N36-M54 WeakPolarHBondContact CB-O 3.37Å; N36-M54 PolarHBondContact ND2-O 3.14Å; N36-M54 PolarHBondContact O-N 3.32Å; N36-A57 HydrophobicContact CB-CB 4.03Å
37	T	98.8	Very high	97.6	Very high	29 Å²	29	58.7 Å²	58.7	18%	0.178	30%	0.3	C	S	.	.			trans	-70.1	147.6	-176.6	59.8	0	0	0	0	111.7	I9 R11 G27 L50	I9-T37 HydrophobicContact CD1-CG2 3.92Å; R11-T37 PolarHBondContact NH1-O 3.17Å; R11-T37 PolarHBondContact NH2-OG1 3.18Å; G27-T37 PolarHBondContact N-O 2.65Å; T37-L50 HydrophobicContact CG2-CD2 4.49Å
38	V	98.8	Very high	97.6	Very high	11 Å²	11	60.7 Å²	60.7	7%	0.067	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	132.9	174	-174.9	0	0	0	0	108.2	Y24 I25 I26 I51 M54	Y24-V38 HydrophobicContact CD1-CG1 4.23Å; I25-V38 WeakPolarHBondContact O-CA 3.35Å; I26-V38 HydrophobicContact CB-CG2 4.41Å; I26-V38 HydrophobicContact CG1-CG1 3.7Å; I26-V38 HydrophobicContact CG1-CG2 4.18Å; I26-V38 HydrophobicContact CG2-CG2 4.11Å; V38-I51 HydrophobicContact CB-CD1 4.22Å; V38-I51 HydrophobicContact CB-CG1 3.73Å; V38-I51 HydrophobicContact CG1-CD1 3.63Å; V38-I51 HydrophobicContact CG1-CG1 3.66Å; V38-I51 PolarHBondContact O-N 2.87Å; V38-M54 HydrophobicContact CG2-CG 4.25Å
39	E	98.8	Very high	97.6	Very high	0 Å²	0	63.9 Å²	63.9	0%	0	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	141.3	170.5	-64.7	-179.3	-117.6	0	0	110	N8 I9 R11 Y24 I25 W48 T49 L50	N8-E39 VanDerWaalsContact CB-OE2 3.24Å; N8-E39 WeakPolarHBondContact CB-OE2 3.43Å; N8-E39 PolarHBondContact N-OE1 3.22Å; N8-E39 PolarHBondContact N-OE2 3.22Å; N8-E39 PolarHBondContact ND2-OE2 3.39Å; I9-E39 PolarHBondContact N-OE1 3.48Å; R11-E39 IonicContact CZ-OE1 3.44Å; R11-E39 IonicContact NE-OE1 3.6Å; R11-E39 IonicContact NH2-OE1 2.63Å; R11-E39 PolarHBondContact NH2-OE1 3Å; Y24-E39 WeakPolarHBondContact CA-O 3.5Å; I25-E39 HydrophobicContact CG2-CB 3.69Å; I25-E39 PolarHBondContact N-O 3.25Å; I25-E39 PolarHBondContact O-N 3.46Å; E39-W48 HydrophobicContact CB-CE3 3.86Å; E39-W48 WeakPolarHBondContact OE2-CB 3.41Å; E39-T49 CarbonylContact C-O 3.47Å; E39-T49 VanDerWaalsContact CA-O 3.31Å; E39-T49 WeakPolarHBondContact CA-O 3.4Å; E39-L50 HydrophobicContact CG-CD2 3.65Å; E39-L50 HydrophobicContact CG-CG 4.15Å
40	R	98.8	Very high	97.7	Very high	70 Å²	70	68.2 Å²	68.2	26%	0.264	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	127.7	175.1	-174.3	-170.1	69.9	177.6	-1	109.9	Y22 L23 Y24 W48 T49 I51	Y22-R40 HydrophobicContact CD1-CG 4.22Å; Y22-R40 HydrophobicContact CG-CG 4.04Å; L23-R40 CarbonylContact O-C 3.57Å; L23-R40 VanDerWaalsContact O-CA 3.27Å; L23-R40 WeakPolarHBondContact O-CA 3.45Å; Y24-R40 HydrophobicContact CD1-CB 4.19Å; Y24-R40 HydrophobicContact CD1-CG 4.23Å; Y24-R40 HydrophobicContact CD2-CG 4.36Å; Y24-R40 HydrophobicContact CE1-CB 4.06Å; Y24-R40 HydrophobicContact CE1-CG 3.86Å; Y24-R40 HydrophobicContact CE2-CG 3.96Å; Y24-R40 HydrophobicContact CG-CG 4.48Å; Y24-R40 WeakPolarHBondContact OH-CD 3.39Å; R40-W48 CarbonylContact O-C 3.57Å; R40-W48 WeakPolarHBondContact O-CA 3.39Å; R40-T49 PolarHBondContact N-O 2.67Å; R40-T49 PolarHBondContact O-N 2.84Å; R40-I51 HydrophobicContact CB-CD1 4.41Å; R40-I51 HydrophobicContact CB-CG2 3.99Å
41	Y	98.8	Very high	97.8	Very high	22 Å²	22	67.5 Å²	67.5	9%	0.086	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89	128.4	172.6	-177	-116.9	0	0	0	110.9	C4 Y22 L23 P43 N46 T47 W48	C4-Y41 HydrophobicContact CB-CE2 4.18Å; C4-Y41 PolarHBondContact SG-OH 2.84Å; C4-Y41 VanDerWaalsContact SG-OH 3.39Å; Y22-Y41 WeakPolarHBondContact CD1-O 3.38Å; L23-Y41 HydrophobicContact CD1-CD1 4.13Å; L23-Y41 HydrophobicContact CG-CD1 4.49Å; L23-Y41 PolarHBondContact N-O 3.33Å; L23-Y41 PolarHBondContact O-N 3.49Å; Y41-P43 HydrophobicContact CD1-CB 4.47Å; Y41-P43 HydrophobicContact CE1-CB 3.93Å; Y41-N46 WeakPolarHBondContact CE2-OD1 3.29Å; Y41-N46 PolarHBondContact OH-OD1 2.82Å; Y41-T47 CarbonylContact C-O 3.56Å; Y41-T47 VanDerWaalsContact CA-O 3.32Å; Y41-T47 WeakPolarHBondContact CA-O 3.36Å; Y41-T47 WeakPolarHBondContact CD2-O 3.44Å; Y41-W48 AromaticContact CD2-CD1 3.86Å; Y41-W48 AromaticContact CD2-CD2 3.91Å; Y41-W48 HydrophobicContact CD2-CD2 3.91Å; Y41-W48 AromaticContact CD2-CE2 3.58Å; Y41-W48 HydrophobicContact CD2-CG 4.1Å; Y41-W48 HydrophobicContact CD2-CZ2 4.07Å; Y41-W48 AromaticContact CD2-NE1 3.53Å; Y41-W48 HydrophobicContact CG-CD2 4.25Å; Y41-W48 AromaticContact CG-CE2 3.94Å; Y41-W48 HydrophobicContact CG-CH2 4.38Å; Y41-W48 HydrophobicContact CG-CZ2 4.01Å
42	N	98.4	Very high	98.1	Very high	18 Å²	18	67 Å²	67	10%	0.096	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	115	166.2	-179.2	-3.6	0	0	0	109.9	Y22 E44 N45 N46 T47	Y22-N42 HydrophobicContact CD1-CB 4.02Å; Y22-N42 HydrophobicContact CE1-CB 3.84Å; N42-E44 VanDerWaalsContact C-N 3.32Å; N42-E44 PolarHBondContact O-N 3.46Å; N42-E44 WeakPolarHBondContact OD1-CB 3.19Å; N42-E44 PolarHBondContact OD1-N 2.8Å; N42-N45 VanDerWaalsContact CB-OD1 3.32Å; N42-N45 WeakPolarHBondContact CB-OD1 3.32Å; N42-N45 PolarHBondContact O-OD1 2.98Å; N42-N46 WeakPolarHBondContact O-CA 3.24Å; N42-N46 PolarHBondContact O-N 3.27Å; N42-T47 PolarHBondContact N-O 2.8Å; N42-T47 PolarHBondContact O-N 2.87Å
43	P	97.6	Very high	98.4	Very high	72 Å²	72	59.8 Å²	59.8	47%	0.468	33%	0.332	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.1	-25.4	178.5	28.2	-34.3	0	0	0	113.6	Y41 N45	Y41-P43 HydrophobicContact CD1-CB 4.47Å; Y41-P43 HydrophobicContact CE1-CB 3.93Å; P43-N45 PolarHBondContact O-N 3.17Å
44	E	97.9	Very high	98.5	Very high	172 Å²	172	56.5 Å²	56.5	80%	0.804	31%	0.314	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.7	-37	-177.2	-62.2	-178.2	153.3	0	0	112.6	N42	N42-E44 VanDerWaalsContact C-N 3.32Å; N42-E44 PolarHBondContact O-N 3.46Å; N42-E44 WeakPolarHBondContact OD1-CB 3.19Å; N42-E44 PolarHBondContact OD1-N 2.8Å
45	N	97.9	Very high	98.5	Very high	90 Å²	90	62 Å²	62	48%	0.481	34%	0.339	S	S	.	.	T	Hydrogen-bonded Turn	trans	-113.9	2.6	-178.9	68.4	9.4	0	0	0	112.9	N42 P43 T47	N42-N45 VanDerWaalsContact CB-OD1 3.32Å; N42-N45 WeakPolarHBondContact CB-OD1 3.32Å; N42-N45 PolarHBondContact O-OD1 2.98Å; P43-N45 PolarHBondContact O-N 3.17Å; N45-T47 VanDerWaalsContact CG-OG1 3.25Å; N45-T47 PolarHBondContact ND2-OG1 3Å; N45-T47 WeakPolarHBondContact O-CG2 3.49Å; N45-T47 PolarHBondContact O-N 2.83Å; N45-T47 WeakPolarHBondContact OD1-CB 3.31Å; N45-T47 PolarHBondContact OD1-N 3.12Å; N45-T47 PolarHBondContact OD1-OG1 2.63Å
46	N	98.1	Very high	98.4	Very high	66 Å²	66	65.6 Å²	65.6	35%	0.353	36%	0.362	S	S	.	.	T	Hydrogen-bonded Turn	trans	51.2	55.4	-178.3	-174	36.4	0	0	0	112.2	C4 A5 Y41 N42	C4-N46 WeakPolarHBondContact CA-OD1 2.98Å; A5-N46 WeakPolarHBondContact CB-O 3.49Å; A5-N46 PolarHBondContact N-ND2 2.97Å; A5-N46 PolarHBondContact N-OD1 3.46Å; Y41-N46 WeakPolarHBondContact CE2-OD1 3.29Å; Y41-N46 PolarHBondContact OH-OD1 2.82Å; N42-N46 WeakPolarHBondContact O-CA 3.24Å; N42-N46 PolarHBondContact O-N 3.27Å
47	T	98.5	Very high	98.4	Very high	52 Å²	52	64.8 Å²	64.8	32%	0.319	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	149.8	179.2	64	0	0	0	0	112.8	Y41 N42 N45	Y41-T47 CarbonylContact C-O 3.56Å; Y41-T47 VanDerWaalsContact CA-O 3.32Å; Y41-T47 WeakPolarHBondContact CA-O 3.36Å; Y41-T47 WeakPolarHBondContact CD2-O 3.44Å; N42-T47 PolarHBondContact N-O 2.8Å; N42-T47 PolarHBondContact O-N 2.87Å; N45-T47 VanDerWaalsContact CG-OG1 3.25Å; N45-T47 PolarHBondContact ND2-OG1 3Å; N45-T47 WeakPolarHBondContact O-CG2 3.49Å; N45-T47 PolarHBondContact O-N 2.83Å; N45-T47 WeakPolarHBondContact OD1-CB 3.31Å; N45-T47 PolarHBondContact OD1-N 3.12Å; N45-T47 PolarHBondContact OD1-OG1 2.63Å
48	W	98.8	Very high	98.4	Very high	41 Å²	41	70.5 Å²	70.5	16%	0.155	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	136.4	166.6	-67.8	93.5	0	0	0	109.9	A5 P6 L7 N8 L23 I25 E39 R40 Y41	A5-W48 VanDerWaalsContact O-CD1 3.24Å; A5-W48 PolarHBondContact O-NE1 3Å; P6-W48 VanDerWaalsContact O-CD1 3.26Å; L7-W48 HydrophobicContact CD2-CD2 3.42Å; L7-W48 VanDerWaalsContact CD2-CD2 3.42Å; L7-W48 HydrophobicContact CD2-CE3 3.54Å; L7-W48 HydrophobicContact CD2-CG 3.96Å; L7-W48 HydrophobicContact CD2-CH2 3.9Å; L7-W48 HydrophobicContact CD2-CZ2 3.79Å; L7-W48 HydrophobicContact CD2-CZ3 3.79Å; N8-W48 WeakPolarHBondContact ND2-CB 3.35Å; N8-W48 PolarHBondContact ND2-O 2.99Å; L23-W48 HydrophobicContact CB-CH2 4.42Å; I25-W48 HydrophobicContact CB-CH2 4.43Å; I25-W48 HydrophobicContact CB-CZ3 4.08Å; I25-W48 HydrophobicContact CG2-CE3 4.16Å; I25-W48 HydrophobicContact CG2-CH2 4.31Å; I25-W48 HydrophobicContact CG2-CZ3 3.64Å; E39-W48 HydrophobicContact CB-CE3 3.86Å; E39-W48 WeakPolarHBondContact OE2-CB 3.41Å; R40-W48 CarbonylContact O-C 3.57Å; R40-W48 WeakPolarHBondContact O-CA 3.39Å; Y41-W48 AromaticContact CD2-CD1 3.86Å; Y41-W48 AromaticContact CD2-CD2 3.91Å; Y41-W48 HydrophobicContact CD2-CD2 3.91Å; Y41-W48 AromaticContact CD2-CE2 3.58Å; Y41-W48 HydrophobicContact CD2-CG 4.1Å; Y41-W48 HydrophobicContact CD2-CZ2 4.07Å; Y41-W48 AromaticContact CD2-NE1 3.53Å; Y41-W48 HydrophobicContact CG-CD2 4.25Å; Y41-W48 AromaticContact CG-CE2 3.94Å; Y41-W48 HydrophobicContact CG-CH2 4.38Å; Y41-W48 HydrophobicContact CG-CZ2 4.01Å
49	T	98.6	Very high	98.4	Very high	68 Å²	68	76.2 Å²	76.2	42%	0.417	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	131.7	176.5	-50.3	0	0	0	0	109.8	E39 R40 I51	E39-T49 CarbonylContact C-O 3.47Å; E39-T49 VanDerWaalsContact CA-O 3.31Å; E39-T49 WeakPolarHBondContact CA-O 3.4Å; R40-T49 PolarHBondContact N-O 2.67Å; R40-T49 PolarHBondContact O-N 2.84Å; T49-I51 PolarHBondContact O-N 3.49Å
50	L	98.6	Very high	98.3	Very high	90 Å²	90	79.1 Å²	79.1	47%	0.471	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.6	129.7	168.4	-78	164.6	0	0	0	109.7	I9 T37 E39	I9-L50 HydrophobicContact CD1-CD2 3.89Å; T37-L50 HydrophobicContact CG2-CD2 4.49Å; E39-L50 HydrophobicContact CG-CD2 3.65Å; E39-L50 HydrophobicContact CG-CG 4.15Å
51	I	98.6	Very high	98.2	Very high	61 Å²	61	77.9 Å²	77.9	31%	0.313	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	-173.2	175.9	67.9	169.2	0	0	0	110.3	Y24 V38 R40 T49	Y24-I51 HydrophobicContact CD1-CD1 3.61Å; Y24-I51 HydrophobicContact CE1-CD1 3.43Å; Y24-I51 VanDerWaalsContact CE1-CD1 3.43Å; V38-I51 HydrophobicContact CB-CD1 4.22Å; V38-I51 HydrophobicContact CB-CG1 3.73Å; V38-I51 HydrophobicContact CG1-CD1 3.63Å; V38-I51 HydrophobicContact CG1-CG1 3.66Å; V38-I51 PolarHBondContact O-N 2.87Å; R40-I51 HydrophobicContact CB-CD1 4.41Å; R40-I51 HydrophobicContact CB-CG2 3.99Å; T49-I51 PolarHBondContact O-N 3.49Å
52	A	98.5	Very high	98.1	Very high	81 Å²	81	80.6 Å²	80.6	67%	0.669	47%	0.471	S	S	*	.	P	Polyproline II helix	trans	-49.7	125.6	177.3	0	0	0	0	0	111.4
53	P	98.6	Very high	98.1	Very high	75 Å²	75	82.3 Å²	82.3	49%	0.487	48%	0.482	S	S	.	.	P	Polyproline II helix	trans	-76.1	165.9	179.8	33.1	-36.1	0	0	0	111.3	N36	N36-P53 CarbonylContact O-C 3.46Å; N36-P53 WeakPolarHBondContact O-CA 3.47Å; N36-P53 WeakPolarHBondContact O-CB 3.15Å
54	M	98.4	Very high	98	Very high	38 Å²	38	83.3 Å²	83.3	19%	0.187	50%	0.496	C	S	.	.	P	Polyproline II helix	trans	-69.2	151.5	165.3	-62.7	-176.1	-67.4	0	0	111	I26 N36 V38 V56 R58	I26-M54 HydrophobicContact CG2-CE 3.83Å; I26-M54 HydrophobicContact CG2-CG 4.08Å; I26-M54 HydrophobicContact CG2-SD 3.39Å; I26-M54 WeakPolarHBondContact CG2-SD 3.47Å; N36-M54 HydrophobicContact CB-CB 4.3Å; N36-M54 WeakPolarHBondContact CB-O 3.37Å; N36-M54 PolarHBondContact ND2-O 3.14Å; N36-M54 PolarHBondContact O-N 3.32Å; V38-M54 HydrophobicContact CG2-CG 4.25Å; M54-V56 WeakPolarHBondContact CB-O 3.02Å; M54-V56 PolarHBondContact O-N 2.76Å; M54-R58 HydrophobicContact CE-CB 3.95Å; M54-R58 HydrophobicContact CE-CG 4.17Å; M54-R58 HydrophobicContact SD-CG 4.35Å
55	N	98.4	Very high	97.9	Very high	169 Å²	169	78.1 Å²	78.1	90%	0.904	48%	0.476	S	S	*	.	S	Bend	trans	-64.4	-28.5	173.6	-66.2	-28.8	0	0	0	113.1
56	V	97.9	Very high	97.6	Very high	94 Å²	94	80.8 Å²	80.8	57%	0.57	49%	0.49	S	S	*	.	S	Bend	trans	-133	134.3	-178.2	-176.8	0	0	0	0	108.7	M54	M54-V56 WeakPolarHBondContact CB-O 3.02Å; M54-V56 PolarHBondContact O-N 2.76Å
57	A	98.4	Very high	96.7	Very high	41 Å²	41	84.8 Å²	84.8	34%	0.339	51%	0.511	S	S	.	.			trans	-64.6	139.7	176.1	0	0	0	0	0	111.3	C34 L35 N36	C34-A57 HydrophobicContact CB-CB 3.97Å; C34-A57 WeakPolarHBondContact O-CB 3.47Å; L35-A57 WeakPolarHBondContact O-CA 3.48Å; N36-A57 HydrophobicContact CB-CB 4.03Å
58	R	98.1	Very high	94.8	Very high	149 Å²	149	84.6 Å²	84.6	56%	0.562	52%	0.519	S	S	*	.			trans	-139.7	138.7	-179.5	-60.1	177	-178.5	-110.9	0.3	109.9	G28 C34 L35 M54 A61	G28-R58 PolarHBondContact N-O 3.01Å; C34-R58 PolarHBondContact SG-N 2.81Å; L35-R58 PolarHBondContact O-N 2.92Å; M54-R58 HydrophobicContact CE-CB 3.95Å; M54-R58 HydrophobicContact CE-CG 4.17Å; M54-R58 HydrophobicContact SD-CG 4.35Å; R58-A61 HydrophobicContact CB-CB 4.36Å
59	R	97.6	Very high	92.8	Very high	132 Å²	132	91.6 Å²	91.6	50%	0.498	55%	0.554	S	S	.	*	S	Bend	trans	-131.5	145.5	170.1	66.7	178.9	-178.9	-170.6	-1.1	109.5	Q13 A29 A61	Q13-R59 HydrophobicContact CB-CB 4.48Å; A29-R59 HydrophobicContact CB-CB 4.49Å; R59-A61 VanDerWaalsContact C-N 3.28Å; R59-A61 PolarHBondContact O-N 2.98Å
60	G	96.8	Very high	90.6	Very high	61 Å²	61	96.6 Å²	96.6	63%	0.629	57%	0.567	S	S	*	*	S	Bend	trans	70	23.5	-178.8	0	0	0	0	0	114	Q13	Q13-G60 PolarHBondContact O-N 2.9Å
61	A	96.7	Very high	88.3	Confident	43 Å²	43	98.7 Å²	98.7	36%	0.355	59%	0.586	S	S	.	*			trans	-87.4	156.6	178.8	0	0	0	0	0	112	A15 R58 R59	A15-A61 WeakPolarHBondContact CB-O 3.17Å; R58-A61 HydrophobicContact CB-CB 4.36Å; R59-A61 VanDerWaalsContact C-N 3.28Å; R59-A61 PolarHBondContact O-N 2.98Å
62	G	97.3	Very high	86.2	Confident	79 Å²	79	99.3 Å²	99.3	81%	0.814	61%	0.607	S	S	*	*			trans	-95.9	155.3	163.9	0	0	0	0	0	111.5
63	V	97.7	Very high	83.9	Confident	55 Å²	55	102.7 Å²	102.7	33%	0.333	61%	0.613	S	S	.	*			trans	-137.3	143.5	173.8	64.2	0	0	0	0	109.7	A15 V16 C17 I26	A15-V63 HydrophobicContact CB-CB 3.81Å; A15-V63 HydrophobicContact CB-CG1 3.58Å; V16-V63 VanDerWaalsContact O-CG1 3.23Å; V16-V63 WeakPolarHBondContact O-CG1 3.24Å; C17-V63 HydrophobicContact CB-CG1 3.85Å; C17-V63 HydrophobicContact CB-CG2 4.28Å; I26-V63 HydrophobicContact CD1-CB 4.42Å; I26-V63 HydrophobicContact CD1-CG1 4.47Å; I26-V63 HydrophobicContact CD1-CG2 3.81Å
64	A	96.6	Very high	81.6	Confident	92 Å²	92	108 Å²	108	76%	0.76	63%	0.631	S	S	*	*			trans	-139.3	149	171.4	0	0	0	0	0	108.8
65	V	94.9	Very high	79.5	Confident	64 Å²	64	117.6 Å²	117.6	39%	0.388	67%	0.665	S	S	.	*			trans	-92	130	167.7	174.3	0	0	0	0	107.5	C17 E18 L19	C17-V65 HydrophobicContact CB-CG2 4.08Å; E18-V65 WeakPolarHBondContact O-CG2 3.43Å; L19-V65 HydrophobicContact CB-CG2 4.04Å; L19-V65 HydrophobicContact CD1-CG1 3.74Å; L19-V65 HydrophobicContact CD1-CG2 4.35Å
66	L	92.1	Very high	76.9	Confident	145 Å²	145	114.4 Å²	114.4	76%	0.759	66%	0.663	S	S	*	*			trans	-107.3	108.5	167.5	179.8	64.8	0	0	0	106.9
67	D	79.6	Confident	74.3	Confident	150 Å²	150	123 Å²	123	80%	0.802	69%	0.692	S	S	*	*			trans	-78.4	123.5	174.3	-151.2	-0.5	0	0	0	108.9	E69	D67-E69 PolarHBondContact O-N 3.42Å; D67-E69 VanDerWaalsContact O-N 3.09Å
68	G	59.1	Low	73.1	Confident	48 Å²	48	127.1 Å²	127.1	50%	0.495	71%	0.71	S	S	.	*			trans	-87.1	69.1	-167.6	0	0	0	0	0	112.1	Y70	G68-Y70 VanDerWaalsContact C-N 3.26Å; G68-Y70 PolarHBondContact O-N 3.31Å
69	E	55.5	Low	71.7	Confident	188 Å²	188	125.9 Å²	125.9	88%	0.879	72%	0.717	S	S	*	*			trans	-77.4	92.3	148.7	-78.3	-161.6	168.9	0	0	107.2	D67 P71	D67-E69 PolarHBondContact O-N 3.42Å; D67-E69 VanDerWaalsContact O-N 3.09Å; E69-P71 VanDerWaalsContact C-CD 3.45Å; E69-P71 WeakPolarHBondContact O-CD 3.43Å
70	Y	53.4	Low	70.3	Confident	174 Å²	174	125.6 Å²	125.6	68%	0.682	73%	0.73	S	S	*	*			trans	-86.4	96.3	159.2	-68.7	-83	0	0	0	107	G68 G72	G68-Y70 VanDerWaalsContact C-N 3.26Å; G68-Y70 PolarHBondContact O-N 3.31Å; Y70-G72 VanDerWaalsContact C-N 3.3Å; Y70-G72 PolarHBondContact O-N 2.84Å
71	P	49.5	Very low	68.7	Low	134 Å²	134	129.4 Å²	129.4	87%	0.87	74%	0.735	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.1	96.9	167	26.6	-32.1	0	0	0	107.6	E69	E69-P71 VanDerWaalsContact C-CD 3.45Å; E69-P71 WeakPolarHBondContact O-CD 3.43Å
72	G	54.3	Low	67	Low	74 Å²	74	134.8 Å²	134.8	76%	0.763	76%	0.759	S	S	*	*	T	Hydrogen-bonded Turn	trans	143.6	-2.5	173.6	0	0	0	0	0	118	Y70	Y70-G72 VanDerWaalsContact C-N 3.3Å; Y70-G72 PolarHBondContact O-N 2.84Å
73	L	50.3	Low	65	Low	151 Å²	151	138.5 Å²	138.5	79%	0.791	76%	0.755	S	S	*	*			trans	-110.4	88.2	168.9	-124.6	83	0	0	0	109.7	R75	L73-R75 PolarHBondContact O-N 3.43Å
74	E	50.9	Low	62.6	Low	188 Å²	188	144.4 Å²	144.4	88%	0.879	79%	0.786	S	S	*	*			trans	-53.5	124.3	158.4	-69	-163.5	166.4	0	0	107.2	A76	E74-A76 PolarHBondContact O-N 2.96Å
75	R	53.4	Low	60	Low	239 Å²	239	148.5 Å²	148.5	90%	0.902	79%	0.788	S	S	*	*			trans	-54.1	108.8	172.1	-74	-179.6	175.1	-178.7	-0.9	107.1	L73 K77	L73-R75 PolarHBondContact O-N 3.43Å; R75-K77 PolarHBondContact O-N 3.12Å
76	A	45.3	Very low	57.1	Low	102 Å²	102	155.5 Å²	155.5	84%	0.843	82%	0.821	S	S	*	*			trans	-54.3	114	163.5	0	0	0	0	0	106.5	E74	E74-A76 PolarHBondContact O-N 2.96Å
77	K	42	Very low	53.9	Low	273 Å²	273	156.5 Å²	156.5	100%	1.187	83%	0.827	S	S	*	*			trans	-67.1	0	172.5	-73.6	-176.6	177.9	178.5	0	110.2	R75	R75-K77 PolarHBondContact O-N 3.12Å

Retrieved 77 of 77 residues in 73.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).