A0A087WQV6_MOUSE Loading...

MISP family member 3

AlphaFold DB , UniProt , Accession A0A087WQV6, Species MOUSE (Mus musculus, Mouse), Gene Misp3, Length 77 aa.

						>A0A087WQV6_MOUSE|A0A087WQV6|Misp3
METPIQREIRRSCEREESLRRSRGLSPGRAGEELIELRVRPVLSRPGSGTPLPRALERARAGAKMQRDIEREAHRQA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	88.4	Confident	96.5	Very high	237 Å²	237	107.5 Å²	107.5	100%	1.167	52%	0.517	S	S	*	.				0	119.5	0	-67.3	-63.1	-170.7	0	0	107.8
2	E	93.4	Very high	96.4	Very high	69 Å²	69	102.5 Å²	102.5	32%	0.322	50%	0.501	S	S	.	.			trans	-74.3	131.1	173.9	-175	-173	-130.8	0	0	109.2	Q6 R7 R10	E2-Q6 HydrophobicContact CG-CB 3.64Å; E2-R7 VanDerWaalsContact CD-CA 3.49Å; E2-R7 HydrophobicContact CG-CB 4.32Å; E2-R7 WeakPolarHBondContact OE1-CA 3.3Å; E2-R7 VanDerWaalsContact OE2-CB 3.32Å; E2-R7 WeakPolarHBondContact OE2-CB 3.26Å; E2-R7 WeakPolarHBondContact OE2-CG 3.46Å; E2-R7 IonicContact OE2-NE 3.65Å; E2-R7 PolarHBondContact OE2-NE 3.38Å; E2-R10 IonicContact OE1-CZ 3.81Å; E2-R10 IonicContact OE1-NE 2.65Å; E2-R10 PolarHBondContact OE1-NE 3.28Å; E2-R10 IonicContact OE1-NH2 3.44Å; E2-R10 PolarHBondContact OE1-NH2 3.09Å; E2-R10 IonicContact OE2-NH2 3.37Å; E2-R10 PolarHBondContact OE2-NH2 3.09Å
3	T	98.3	Very high	96.2	Very high	58 Å²	58	100.6 Å²	100.6	36%	0.356	50%	0.503	S	S	.	.			trans	-73.7	157.4	175.2	68.1	0	0	0	0	110.9	I5 Q6 R7	T3-I5 PolarHBondContact O-N 3.08Å; T3-I5 WeakPolarHBondContact OG1-CG2 3.34Å; T3-Q6 PolarHBondContact O-N 3.12Å; T3-Q6 VanDerWaalsContact O-N 3.13Å; T3-Q6 WeakPolarHBondContact OG1-CB 3.49Å; T3-Q6 WeakPolarHBondContact OG1-CG 3.13Å; T3-Q6 PolarHBondContact OG1-N 3.32Å; T3-Q6 PolarHBondContact OG1-OE1 2.89Å; T3-R7 PolarHBondContact O-N 3.12Å; T3-R7 VanDerWaalsContact O-N 3.11Å
4	P	98.2	Very high	96.1	Very high	114 Å²	114	100.2 Å²	100.2	74%	0.74	50%	0.499	S	S	*	.	H	α-helix	trans	-54.1	-38.4	175.5	-27.9	35.9	0	0	0	113.3	R7 E8	P4-R7 PolarHBondContact O-N 3.11Å; P4-E8 PolarHBondContact O-N 2.9Å
5	I	97.6	Very high	96.1	Very high	113 Å²	113	102.6 Å²	102.6	58%	0.579	50%	0.5	S	S	*	.	H	α-helix	trans	-69.3	-40.1	178.5	-173.5	61	0	0	0	112.2	T3 R7 E8 I9	T3-I5 PolarHBondContact O-N 3.08Å; T3-I5 WeakPolarHBondContact OG1-CG2 3.34Å; I5-R7 VanDerWaalsContact C-N 3.28Å; I5-R7 PolarHBondContact O-N 3.39Å; I5-E8 PolarHBondContact O-N 3.43Å; I5-I9 HydrophobicContact CG1-CD1 4.06Å; I5-I9 WeakPolarHBondContact O-CG1 3.49Å; I5-I9 PolarHBondContact O-N 3.24Å
6	Q	98.4	Very high	95.9	Very high	98 Å²	98	101 Å²	101	46%	0.458	49%	0.491	S	S	.	.	H	α-helix	trans	-61.7	-38.6	176.5	-76.3	168.8	-19.5	0	0	111.7	E2 T3 E8 I9 R10	E2-Q6 HydrophobicContact CG-CB 3.64Å; T3-Q6 PolarHBondContact O-N 3.12Å; T3-Q6 VanDerWaalsContact O-N 3.13Å; T3-Q6 WeakPolarHBondContact OG1-CB 3.49Å; T3-Q6 WeakPolarHBondContact OG1-CG 3.13Å; T3-Q6 PolarHBondContact OG1-N 3.32Å; T3-Q6 PolarHBondContact OG1-OE1 2.89Å; Q6-E8 PolarHBondContact O-N 2.91Å; Q6-I9 PolarHBondContact O-N 3.46Å; Q6-R10 WeakPolarHBondContact O-CB 3.43Å; Q6-R10 PolarHBondContact O-N 3.48Å
7	R	97.8	Very high	95.6	Very high	116 Å²	116	99.9 Å²	99.9	44%	0.438	49%	0.485	S	S	.	.	H	α-helix	trans	-60.6	-43.4	177.2	-168.2	176.1	-56.5	-175.7	13.3	112.7	E2 T3 P4 I5 R11	E2-R7 VanDerWaalsContact CD-CA 3.49Å; E2-R7 HydrophobicContact CG-CB 4.32Å; E2-R7 WeakPolarHBondContact OE1-CA 3.3Å; E2-R7 VanDerWaalsContact OE2-CB 3.32Å; E2-R7 WeakPolarHBondContact OE2-CB 3.26Å; E2-R7 WeakPolarHBondContact OE2-CG 3.46Å; E2-R7 IonicContact OE2-NE 3.65Å; E2-R7 PolarHBondContact OE2-NE 3.38Å; T3-R7 PolarHBondContact O-N 3.12Å; T3-R7 VanDerWaalsContact O-N 3.11Å; P4-R7 PolarHBondContact O-N 3.11Å; I5-R7 VanDerWaalsContact C-N 3.28Å; I5-R7 PolarHBondContact O-N 3.39Å; R7-R11 WeakPolarHBondContact O-CG 3.34Å; R7-R11 PolarHBondContact O-N 3.42Å
8	E	97.9	Very high	95.4	Very high	73 Å²	73	98 Å²	98	34%	0.341	48%	0.483	S	S	.	.	H	α-helix	trans	-71.7	-38.1	179.8	-166.8	56.3	-141.5	0	0	112.2	P4 I5 Q6 R11 S12 R15	P4-E8 PolarHBondContact O-N 2.9Å; I5-E8 PolarHBondContact O-N 3.43Å; Q6-E8 PolarHBondContact O-N 2.91Å; E8-R11 PolarHBondContact O-N 2.86Å; E8-R11 IonicContact OE2-CZ 3.41Å; E8-R11 IonicContact OE2-NE 3.88Å; E8-R11 PolarHBondContact OE2-NE 3.28Å; E8-R11 VanDerWaalsContact OE2-NE 3.15Å; E8-R11 IonicContact OE2-NH2 3.7Å; E8-R11 PolarHBondContact OE2-NH2 3.14Å; E8-S12 WeakPolarHBondContact O-CB 3.45Å; E8-S12 PolarHBondContact O-N 3.09Å; E8-S12 PolarHBondContact O-OG 3.1Å; E8-R15 IonicContact OE1-NH2 3.65Å; E8-R15 PolarHBondContact OE1-NH2 3.21Å
9	I	97.2	Very high	95.2	Very high	95 Å²	95	96.9 Å²	96.9	49%	0.487	48%	0.479	S	S	.	.	H	α-helix	trans	-57.8	-51.8	172.8	-68.8	167.7	0	0	0	109.4	I5 Q6 R11 S12 C13	I5-I9 HydrophobicContact CG1-CD1 4.06Å; I5-I9 WeakPolarHBondContact O-CG1 3.49Å; I5-I9 PolarHBondContact O-N 3.24Å; Q6-I9 PolarHBondContact O-N 3.46Å; I9-R11 PolarHBondContact O-N 2.96Å; I9-S12 PolarHBondContact O-N 3.5Å; I9-S12 VanDerWaalsContact O-N 3.11Å; I9-C13 PolarHBondContact O-N 3.36Å; I9-C13 PolarHBondContact O-SG 3Å
10	R	96.9	Very high	94.9	Very high	104 Å²	104	94 Å²	94	39%	0.392	46%	0.462	S	S	.	.	H	α-helix	trans	-58.6	-49.2	-179.8	-178.3	176.8	54.9	75.8	-1.1	112.1	E2 Q6 S12 C13 E14	E2-R10 IonicContact OE1-CZ 3.81Å; E2-R10 IonicContact OE1-NE 2.65Å; E2-R10 PolarHBondContact OE1-NE 3.28Å; E2-R10 IonicContact OE1-NH2 3.44Å; E2-R10 PolarHBondContact OE1-NH2 3.09Å; E2-R10 IonicContact OE2-NH2 3.37Å; E2-R10 PolarHBondContact OE2-NH2 3.09Å; Q6-R10 WeakPolarHBondContact O-CB 3.43Å; Q6-R10 PolarHBondContact O-N 3.48Å; R10-S12 PolarHBondContact O-N 3.34Å; R10-C13 PolarHBondContact O-N 2.9Å; R10-E14 HydrophobicContact CG-CG 4.45Å; R10-E14 VanDerWaalsContact CG-OE1 3.26Å; R10-E14 WeakPolarHBondContact CG-OE1 3.26Å; R10-E14 IonicContact CZ-OE1 3.85Å; R10-E14 IonicContact NH1-OE1 2.68Å; R10-E14 PolarHBondContact NH1-OE1 3.42Å; R10-E14 IonicContact NH1-OE2 3.34Å; R10-E14 WeakPolarHBondContact O-CG 3.49Å; R10-E14 PolarHBondContact O-N 3.08Å
11	R	97.3	Very high	94.6	Very high	106 Å²	106	96.9 Å²	96.9	40%	0.4	47%	0.468	S	S	.	.	H	α-helix	trans	-56.9	-39	175.9	-76.5	-168.3	-71.1	-135.4	2.1	112.4	R7 E8 I9 R15	R7-R11 WeakPolarHBondContact O-CG 3.34Å; R7-R11 PolarHBondContact O-N 3.42Å; E8-R11 PolarHBondContact O-N 2.86Å; E8-R11 IonicContact OE2-CZ 3.41Å; E8-R11 IonicContact OE2-NE 3.88Å; E8-R11 PolarHBondContact OE2-NE 3.28Å; E8-R11 VanDerWaalsContact OE2-NE 3.15Å; E8-R11 IonicContact OE2-NH2 3.7Å; E8-R11 PolarHBondContact OE2-NH2 3.14Å; I9-R11 PolarHBondContact O-N 2.96Å; R11-R15 WeakPolarHBondContact O-CG 3.39Å; R11-R15 PolarHBondContact O-N 3.03Å; R11-R15 VanDerWaalsContact O-N 3.08Å
12	S	96.1	Very high	94.7	Very high	47 Å²	47	90 Å²	90	33%	0.329	44%	0.444	S	S	.	.	H	α-helix	trans	-70	-41.6	178.9	-61.3	0	0	0	0	112.1	E8 I9 R10 R15 E16	E8-S12 WeakPolarHBondContact O-CB 3.45Å; E8-S12 PolarHBondContact O-N 3.09Å; E8-S12 PolarHBondContact O-OG 3.1Å; I9-S12 PolarHBondContact O-N 3.5Å; I9-S12 VanDerWaalsContact O-N 3.11Å; R10-S12 PolarHBondContact O-N 3.34Å; S12-R15 PolarHBondContact O-N 3.37Å; S12-R15 PolarHBondContact OG-NH2 3.18Å; S12-E16 PolarHBondContact O-N 2.83Å
13	C	93.4	Very high	94.5	Very high	78 Å²	78	94.3 Å²	94.3	53%	0.527	46%	0.457	S	S	.	.	H	α-helix	trans	-61.4	-45.8	173.9	-66.9	0	0	0	0	112	I9 R10 R15 E16 E17	I9-C13 PolarHBondContact O-N 3.36Å; I9-C13 PolarHBondContact O-SG 3Å; R10-C13 PolarHBondContact O-N 2.9Å; C13-R15 PolarHBondContact O-N 3.02Å; C13-E16 PolarHBondContact O-N 2.7Å; C13-E17 WeakPolarHBondContact O-CB 3.37Å; C13-E17 PolarHBondContact O-N 3.41Å
14	E	95.1	Very high	93.9	Very high	95 Å²	95	94.9 Å²	94.9	44%	0.444	47%	0.474	S	S	.	.	H	α-helix	trans	-60.3	-43.8	177.6	-71.5	165.9	-175.2	0	0	111.9	R10 S18	R10-E14 HydrophobicContact CG-CG 4.45Å; R10-E14 VanDerWaalsContact CG-OE1 3.26Å; R10-E14 WeakPolarHBondContact CG-OE1 3.26Å; R10-E14 IonicContact CZ-OE1 3.85Å; R10-E14 IonicContact NH1-OE1 2.68Å; R10-E14 PolarHBondContact NH1-OE1 3.42Å; R10-E14 IonicContact NH1-OE2 3.34Å; R10-E14 WeakPolarHBondContact O-CG 3.49Å; R10-E14 PolarHBondContact O-N 3.08Å; E14-S18 PolarHBondContact O-N 2.81Å; E14-S18 VanDerWaalsContact O-N 3.1Å
15	R	96.1	Very high	93.1	Very high	136 Å²	136	92.6 Å²	92.6	51%	0.513	46%	0.456	S	S	.	.	H	α-helix	trans	-61.6	-47.7	176	-77.9	-173.7	-62.7	-131.7	-2.6	111.8	E8 R11 S12 C13 S18 L19	E8-R15 IonicContact OE1-NH2 3.65Å; E8-R15 PolarHBondContact OE1-NH2 3.21Å; R11-R15 WeakPolarHBondContact O-CG 3.39Å; R11-R15 PolarHBondContact O-N 3.03Å; R11-R15 VanDerWaalsContact O-N 3.08Å; S12-R15 PolarHBondContact O-N 3.37Å; S12-R15 PolarHBondContact OG-NH2 3.18Å; C13-R15 PolarHBondContact O-N 3.02Å; R15-S18 PolarHBondContact O-N 2.95Å; R15-L19 WeakPolarHBondContact O-CG 3.26Å; R15-L19 PolarHBondContact O-N 3.32Å; R15-L19 VanDerWaalsContact O-N 3.09Å
16	E	91.9	Very high	92	Very high	77 Å²	77	89.8 Å²	89.8	36%	0.36	45%	0.446	S	S	.	.	H	α-helix	trans	-66.4	-40.4	-179.4	172.3	50.4	-174.8	0	0	111.6	S12 C13 S18 L19 R20	S12-E16 PolarHBondContact O-N 2.83Å; C13-E16 PolarHBondContact O-N 2.7Å; E16-S18 VanDerWaalsContact C-N 3.3Å; E16-S18 PolarHBondContact O-N 2.65Å; E16-L19 WeakPolarHBondContact O-CB 3.34Å; E16-L19 PolarHBondContact O-N 2.93Å; E16-L19 VanDerWaalsContact O-N 3.14Å; E16-R20 HydrophobicContact CG-CG 4.3Å; E16-R20 VanDerWaalsContact O-CG 3.3Å; E16-R20 WeakPolarHBondContact O-CG 3.4Å; E16-R20 PolarHBondContact O-N 2.9Å; E16-R20 VanDerWaalsContact OE1-CD 3.26Å; E16-R20 WeakPolarHBondContact OE1-CD 3.42Å; E16-R20 WeakPolarHBondContact OE1-CG 3.41Å; E16-R20 IonicContact OE1-NH1 2.7Å
17	E	90.9	Very high	90.6	Very high	82 Å²	82	90.2 Å²	90.2	38%	0.383	46%	0.457	S	S	.	.	H	α-helix	trans	-60.6	-41	176.8	-159.7	-168.4	160.5	0	0	111.8	C13 L19 R20 R21	C13-E17 WeakPolarHBondContact O-CB 3.37Å; C13-E17 PolarHBondContact O-N 3.41Å; E17-L19 PolarHBondContact O-N 3.2Å; E17-R20 PolarHBondContact O-N 3.28Å; E17-R21 WeakPolarHBondContact O-CG 3.39Å; E17-R21 PolarHBondContact O-N 2.96Å; E17-R21 IonicContact OE1-CZ 3.36Å; E17-R21 IonicContact OE1-NE 3.28Å; E17-R21 PolarHBondContact OE1-NE 3.07Å; E17-R21 IonicContact OE1-NH2 3.02Å; E17-R21 PolarHBondContact OE1-NH2 2.99Å; E17-R21 IonicContact OE2-CZ 3.99Å; E17-R21 IonicContact OE2-NH2 3.09Å; E17-R21 PolarHBondContact OE2-NH2 3.47Å
18	S	92.4	Very high	89.1	Confident	66 Å²	66	88.1 Å²	88.1	46%	0.462	47%	0.472	S	S	.	.	H	α-helix	trans	-60.9	-43.6	174	-173	0	0	0	0	112.6	E14 R15 E16 R20 R21 S22	E14-S18 PolarHBondContact O-N 2.81Å; E14-S18 VanDerWaalsContact O-N 3.1Å; R15-S18 PolarHBondContact O-N 2.95Å; E16-S18 VanDerWaalsContact C-N 3.3Å; E16-S18 PolarHBondContact O-N 2.65Å; S18-R20 VanDerWaalsContact C-N 3.35Å; S18-R20 PolarHBondContact O-N 3.46Å; S18-R21 PolarHBondContact O-N 2.84Å; S18-S22 PolarHBondContact O-N 3.03Å; S18-S22 PolarHBondContact O-OG 3.4Å
19	L	91.9	Very high	87.2	Confident	77 Å²	77	91.2 Å²	91.2	40%	0.403	48%	0.48	S	S	.	.	H	α-helix	trans	-62.7	-41.5	175.4	-73.3	170.6	0	0	0	111.6	R15 E16 E17 S22 R23	R15-L19 WeakPolarHBondContact O-CG 3.26Å; R15-L19 PolarHBondContact O-N 3.32Å; R15-L19 VanDerWaalsContact O-N 3.09Å; E16-L19 WeakPolarHBondContact O-CB 3.34Å; E16-L19 PolarHBondContact O-N 2.93Å; E16-L19 VanDerWaalsContact O-N 3.14Å; E17-L19 PolarHBondContact O-N 3.2Å; L19-S22 PolarHBondContact O-N 3.4Å; L19-S22 PolarHBondContact O-OG 2.82Å; L19-R23 WeakPolarHBondContact O-CB 3.32Å; L19-R23 WeakPolarHBondContact O-CD 3.35Å; L19-R23 VanDerWaalsContact O-CG 3.26Å; L19-R23 WeakPolarHBondContact O-CG 3.42Å; L19-R23 PolarHBondContact O-N 2.71Å; L19-R23 VanDerWaalsContact O-N 3.11Å
20	R	88.2	Confident	85.3	Confident	39 Å²	39	90.1 Å²	90.1	15%	0.147	49%	0.485	C	S	.	.	H	α-helix	trans	-63.4	-47.4	176.4	-68.3	177.8	75.9	79.2	3.7	111.5	E16 E17 S18 S22 R23 G24 L25 S26 E33	E16-R20 HydrophobicContact CG-CG 4.3Å; E16-R20 VanDerWaalsContact O-CG 3.3Å; E16-R20 WeakPolarHBondContact O-CG 3.4Å; E16-R20 PolarHBondContact O-N 2.9Å; E16-R20 VanDerWaalsContact OE1-CD 3.26Å; E16-R20 WeakPolarHBondContact OE1-CD 3.42Å; E16-R20 WeakPolarHBondContact OE1-CG 3.41Å; E16-R20 IonicContact OE1-NH1 2.7Å; E17-R20 PolarHBondContact O-N 3.28Å; S18-R20 VanDerWaalsContact C-N 3.35Å; S18-R20 PolarHBondContact O-N 3.46Å; R20-S22 PolarHBondContact O-N 3.11Å; R20-R23 CarbonylContact O-C 3.54Å; R20-R23 PolarHBondContact O-N 3.15Å; R20-R23 VanDerWaalsContact O-N 3.12Å; R20-G24 PolarHBondContact O-N 3.31Å; R20-G24 VanDerWaalsContact O-N 3.12Å; R20-L25 HydrophobicContact CB-CB 4.09Å; R20-L25 HydrophobicContact CG-CB 4.47Å; R20-L25 PolarHBondContact O-N 3.45Å; R20-S26 PolarHBondContact NH2-O 2.89Å; R20-S26 VanDerWaalsContact NH2-O 3.09Å; R20-E33 IonicContact CZ-OE2 3.24Å; R20-E33 IonicContact NH1-OE2 3.36Å; R20-E33 PolarHBondContact NH1-OE2 3.45Å; R20-E33 IonicContact NH2-OE1 2.82Å; R20-E33 PolarHBondContact NH2-OE1 3.38Å; R20-E33 VanDerWaalsContact NH2-OE1 3.09Å; R20-E33 IonicContact NH2-OE2 2.74Å; R20-E33 PolarHBondContact NH2-OE2 3.24Å
21	R	88.9	Confident	83.4	Confident	154 Å²	154	88.1 Å²	88.1	58%	0.581	50%	0.497	S	S	*	.	H	α-helix	trans	-58.4	-45.5	176.6	-70	-172.9	-141.4	125.1	-9	112	E17 S18 R23 G24	E17-R21 WeakPolarHBondContact O-CG 3.39Å; E17-R21 PolarHBondContact O-N 2.96Å; E17-R21 IonicContact OE1-CZ 3.36Å; E17-R21 IonicContact OE1-NE 3.28Å; E17-R21 PolarHBondContact OE1-NE 3.07Å; E17-R21 IonicContact OE1-NH2 3.02Å; E17-R21 PolarHBondContact OE1-NH2 2.99Å; E17-R21 IonicContact OE2-CZ 3.99Å; E17-R21 IonicContact OE2-NH2 3.09Å; E17-R21 PolarHBondContact OE2-NH2 3.47Å; S18-R21 PolarHBondContact O-N 2.84Å; R21-R23 PolarHBondContact O-N 2.75Å; R21-G24 PolarHBondContact O-N 2.91Å; R21-G24 VanDerWaalsContact O-N 3.08Å
22	S	90.9	Very high	81.6	Confident	94 Å²	94	89.2 Å²	89.2	66%	0.657	51%	0.507	S	S	*	.	H	α-helix	trans	-66.4	-25	178.6	62.5	0	0	0	0	113.6	S18 L19 R20	S18-S22 PolarHBondContact O-N 3.03Å; S18-S22 PolarHBondContact O-OG 3.4Å; L19-S22 PolarHBondContact O-N 3.4Å; L19-S22 PolarHBondContact O-OG 2.82Å; R20-S22 PolarHBondContact O-N 3.11Å
23	R	89.1	Confident	79.9	Confident	158 Å²	158	90 Å²	90	60%	0.596	51%	0.505	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.8	0.4	174.2	-67.6	170.6	-179.2	154.5	0.7	113.8	L19 R20 R21 L25	L19-R23 WeakPolarHBondContact O-CB 3.32Å; L19-R23 WeakPolarHBondContact O-CD 3.35Å; L19-R23 VanDerWaalsContact O-CG 3.26Å; L19-R23 WeakPolarHBondContact O-CG 3.42Å; L19-R23 PolarHBondContact O-N 2.71Å; L19-R23 VanDerWaalsContact O-N 3.11Å; R20-R23 CarbonylContact O-C 3.54Å; R20-R23 PolarHBondContact O-N 3.15Å; R20-R23 VanDerWaalsContact O-N 3.12Å; R21-R23 PolarHBondContact O-N 2.75Å; R23-L25 HydrophobicContact CB-CD1 4.01Å; R23-L25 HydrophobicContact CB-CG 3.91Å; R23-L25 PolarHBondContact O-N 2.99Å
24	G	86.9	Confident	78.6	Confident	70 Å²	70	93.6 Å²	93.6	72%	0.722	52%	0.519	S	S	*	.	T	Hydrogen-bonded Turn	trans	68	20	-175.2	0	0	0	0	0	114.2	R20 R21	R20-G24 PolarHBondContact O-N 3.31Å; R20-G24 VanDerWaalsContact O-N 3.12Å; R21-G24 PolarHBondContact O-N 2.91Å; R21-G24 VanDerWaalsContact O-N 3.08Å
25	L	81.3	Confident	77.3	Confident	66 Å²	66	95.6 Å²	95.6	35%	0.346	53%	0.531	S	S	.	.			trans	-86.1	129.6	179.7	-61.7	174.8	0	0	0	110.2	R20 R23	R20-L25 HydrophobicContact CB-CB 4.09Å; R20-L25 HydrophobicContact CG-CB 4.47Å; R20-L25 PolarHBondContact O-N 3.45Å; R23-L25 HydrophobicContact CB-CD1 4.01Å; R23-L25 HydrophobicContact CB-CG 3.91Å; R23-L25 PolarHBondContact O-N 2.99Å
26	S	73.6	Confident	76	Confident	54 Å²	54	97.7 Å²	97.7	38%	0.378	55%	0.547	S	S	.	.			trans	-76.7	142.9	-178.5	76.1	0	0	0	0	111.5	R20 G28	R20-S26 PolarHBondContact NH2-O 2.89Å; R20-S26 VanDerWaalsContact NH2-O 3.09Å; S26-G28 VanDerWaalsContact C-N 3.3Å; S26-G28 PolarHBondContact O-N 3.07Å
27	P	68.4	Low	75	Confident	107 Å²	107	100.1 Å²	100.1	70%	0.695	56%	0.561	S	S	*	*	G	3₁₀ helix	trans	-71.1	-21.7	179	24.2	-30.7	0	0	0	113.7
28	G	66	Low	74	Confident	72 Å²	72	107.8 Å²	107.8	74%	0.742	59%	0.587	S	S	*	*	G	3₁₀ helix	trans	-82.4	-10.5	-176	0	0	0	0	0	115.8	S26	S26-G28 VanDerWaalsContact C-N 3.3Å; S26-G28 PolarHBondContact O-N 3.07Å
29	R	58.6	Low	72.9	Confident	138 Å²	138	108.9 Å²	108.9	52%	0.521	59%	0.59	S	S	.	*	G	3₁₀ helix	trans	-108.3	13.8	-173.2	-74.2	-155.2	168.9	-155.9	-1.9	115.3	G31 E32 E33	R29-G31 PolarHBondContact O-N 3.36Å; R29-E32 HydrophobicContact CB-CB 4.25Å; R29-E32 HydrophobicContact CG-CB 4.36Å; R29-E32 WeakPolarHBondContact CG-OE2 3.48Å; R29-E32 IonicContact CZ-OE2 2.71Å; R29-E32 IonicContact NE-OE2 3.15Å; R29-E32 PolarHBondContact NE-OE2 3.45Å; R29-E32 CarbonylContact O-C 3.52Å; R29-E32 PolarHBondContact O-N 3.27Å; R29-E33 HydrophobicContact CB-CG 3.89Å; R29-E33 WeakPolarHBondContact O-CB 3.34Å; R29-E33 WeakPolarHBondContact O-CG 3.17Å; R29-E33 PolarHBondContact O-N 3.11Å
30	A	58.3	Low	71.9	Confident	72 Å²	72	114.4 Å²	114.4	60%	0.595	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55	-26.2	-177.2	0	0	0	0	0	114.1
31	G	57	Low	70.7	Confident	62 Å²	62	117.2 Å²	117.2	64%	0.639	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.8	-18.4	172.1	0	0	0	0	0	115.8	R29	R29-G31 PolarHBondContact O-N 3.36Å
32	E	57.7	Low	69.4	Low	130 Å²	130	115.9 Å²	115.9	61%	0.607	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.8	-14.1	179.1	-60.9	-172.9	117.2	0	0	112.7	R29 L34	R29-E32 HydrophobicContact CB-CB 4.25Å; R29-E32 HydrophobicContact CG-CB 4.36Å; R29-E32 WeakPolarHBondContact CG-OE2 3.48Å; R29-E32 IonicContact CZ-OE2 2.71Å; R29-E32 IonicContact NE-OE2 3.15Å; R29-E32 PolarHBondContact NE-OE2 3.45Å; R29-E32 CarbonylContact O-C 3.52Å; R29-E32 PolarHBondContact O-N 3.27Å; E32-L34 PolarHBondContact O-N 3.37Å
33	E	62	Low	67.9	Low	63 Å²	63	118.2 Å²	118.2	29%	0.294	64%	0.642	S	S	.	*			trans	-79.5	39.5	174.2	-73.1	172	-170.3	0	0	112.1	R20 R29 I35	R20-E33 IonicContact CZ-OE2 3.24Å; R20-E33 IonicContact NH1-OE2 3.36Å; R20-E33 PolarHBondContact NH1-OE2 3.45Å; R20-E33 IonicContact NH2-OE1 2.82Å; R20-E33 PolarHBondContact NH2-OE1 3.38Å; R20-E33 VanDerWaalsContact NH2-OE1 3.09Å; R20-E33 IonicContact NH2-OE2 2.74Å; R20-E33 PolarHBondContact NH2-OE2 3.24Å; R29-E33 HydrophobicContact CB-CG 3.89Å; R29-E33 WeakPolarHBondContact O-CB 3.34Å; R29-E33 WeakPolarHBondContact O-CG 3.17Å; R29-E33 PolarHBondContact O-N 3.11Å; E33-I35 PolarHBondContact O-N 3.39Å
34	L	65.8	Low	66.4	Low	154 Å²	154	113.8 Å²	113.8	81%	0.806	64%	0.635	S	S	*	*			trans	-71.4	109.1	168.4	-68.9	161.2	0	0	0	107.4	E32	E32-L34 PolarHBondContact O-N 3.37Å
35	I	66.9	Low	65.2	Low	137 Å²	137	118 Å²	118	70%	0.703	63%	0.629	S	S	*	*			trans	-83.2	141.3	168.5	62.9	167.3	0	0	0	109.4	E33 L37	E33-I35 PolarHBondContact O-N 3.39Å; I35-L37 HydrophobicContact CD1-CD2 4.34Å; I35-L37 PolarHBondContact O-N 2.88Å
36	E	68.6	Low	64.2	Low	180 Å²	180	120.5 Å²	120.5	84%	0.841	65%	0.65	S	S	*	*			trans	-69.5	101.3	170.7	-168.1	-175.3	164	0	0	108.9	R38	E36-R38 PolarHBondContact O-N 2.9Å
37	L	71.7	Confident	63.5	Low	128 Å²	128	121.1 Å²	121.1	67%	0.67	66%	0.664	S	S	*	*			trans	-69.9	113.9	170.4	-75.1	165.7	0	0	0	108	I35 V39	I35-L37 HydrophobicContact CD1-CD2 4.34Å; I35-L37 PolarHBondContact O-N 2.88Å; L37-V39 PolarHBondContact O-N 3.2Å
38	R	69.7	Low	62.8	Low	242 Å²	242	119.8 Å²	119.8	91%	0.913	66%	0.658	S	S	*	*			trans	-66.4	79.2	166.4	-74.5	-175.8	175.5	175.9	-0.1	109.6	E36	E36-R38 PolarHBondContact O-N 2.9Å
39	V	70.1	Confident	62.4	Low	89 Å²	89	119 Å²	119	54%	0.539	65%	0.65	S	S	.	*			trans	-71.2	131.3	170.1	-88.2	0	0	0	0	108.9	L37	L37-V39 PolarHBondContact O-N 3.2Å
40	R	69.8	Low	62.4	Low	194 Å²	194	118.3 Å²	118.3	73%	0.732	66%	0.661	S	S	*	*			trans	-59.2	128.7	173.3	-63.9	178.2	85.1	176.7	5.4	107.3	V42 L43 S44	R40-V42 PolarHBondContact O-N 3.13Å; R40-L43 PolarHBondContact O-N 3.37Å; R40-S44 PolarHBondContact O-OG 3.42Å
41	P	62.6	Low	62.6	Low	97 Å²	97	120.1 Å²	120.1	63%	0.63	67%	0.666	S	S	*	*	H	α-helix	trans	-53.5	-24	-176.5	-27.5	32.9	0	0	0	114.5	L43 S44 R45	P41-L43 PolarHBondContact O-N 3.2Å; P41-S44 WeakPolarHBondContact CA-OG 3.21Å; P41-R45 WeakPolarHBondContact O-CB 3.46Å; P41-R45 PolarHBondContact O-N 3.2Å
42	V	62.3	Low	62.8	Low	126 Å²	126	119.9 Å²	119.9	76%	0.764	65%	0.651	S	S	*	*	H	α-helix	trans	-63	-31.1	177.1	-177.6	0	0	0	0	112.2	R40	R40-V42 PolarHBondContact O-N 3.13Å
43	L	58.7	Low	63.7	Low	144 Å²	144	118 Å²	118	75%	0.754	65%	0.65	S	S	*	*	H	α-helix	trans	-96.9	-20.5	-176.9	-59.4	178.8	0	0	0	113.3	R40 P41	R40-L43 PolarHBondContact O-N 3.37Å; P41-L43 PolarHBondContact O-N 3.2Å
44	S	59.2	Low	64.3	Low	64 Å²	64	124.5 Å²	124.5	45%	0.448	67%	0.671	S	S	.	*	H	α-helix	trans	-100.5	-6.1	-177.7	43.4	0	0	0	0	114	R40 P41 P46	R40-S44 PolarHBondContact O-OG 3.42Å; P41-S44 WeakPolarHBondContact CA-OG 3.21Å; S44-P46 WeakPolarHBondContact O-CD 3.35Å
45	R	60.4	Low	64.8	Low	158 Å²	158	119.9 Å²	119.9	60%	0.596	66%	0.656	S	S	*	*	S	Bend	trans	-82.9	117.9	171.4	-163.5	107.6	84.3	179.7	3.7	109	P41 G47 S48	P41-R45 WeakPolarHBondContact O-CB 3.46Å; P41-R45 PolarHBondContact O-N 3.2Å; R45-G47 PolarHBondContact O-N 3.14Å; R45-S48 VanDerWaalsContact NE-CB 3.33Å; R45-S48 PolarHBondContact NE-OG 3.32Å; R45-S48 VanDerWaalsContact NE-OG 3.14Å
46	P	61.5	Low	65.5	Low	120 Å²	120	116.9 Å²	116.9	78%	0.779	64%	0.64	S	S	*	*	S	Bend	trans	-54.3	115.5	153.9	23.5	-29.6	0	0	0	105.1	S44 S48	S44-P46 WeakPolarHBondContact O-CD 3.35Å; P46-S48 PolarHBondContact O-N 2.96Å
47	G	57.3	Low	66.2	Low	66 Å²	66	113.3 Å²	113.3	68%	0.68	62%	0.624	S	S	*	*			trans	-36.2	115.9	-157.5	0	0	0	0	0	112.2	R45 G49	R45-G47 PolarHBondContact O-N 3.14Å; G47-G49 PolarHBondContact O-N 2.79Å
48	S	55.2	Low	66.9	Low	80 Å²	80	115 Å²	115	56%	0.559	62%	0.621	S	S	*	*			trans	-72.6	33.6	177.5	56.2	0	0	0	0	111.7	R45 P46 T50	R45-S48 VanDerWaalsContact NE-CB 3.33Å; R45-S48 PolarHBondContact NE-OG 3.32Å; R45-S48 VanDerWaalsContact NE-OG 3.14Å; P46-S48 PolarHBondContact O-N 2.96Å; S48-T50 PolarHBondContact O-N 3.05Å
49	G	56.2	Low	67.8	Low	56 Å²	56	106.4 Å²	106.4	58%	0.577	60%	0.602	S	S	*	*			trans	-73.4	106.8	151.6	0	0	0	0	0	104.6	G47 P51	G47-G49 PolarHBondContact O-N 2.79Å; G49-P51 VanDerWaalsContact O-CD 3.25Å; G49-P51 WeakPolarHBondContact O-CD 3.25Å
50	T	58.9	Low	68.8	Low	122 Å²	122	109.3 Å²	109.3	75%	0.748	60%	0.603	S	S	*	*			trans	-43.3	117	149.8	-52.5	0	0	0	0	104.8	S48 L52	S48-T50 PolarHBondContact O-N 3.05Å; T50-L52 VanDerWaalsContact C-N 3.32Å; T50-L52 PolarHBondContact O-N 2.77Å
51	P	62.6	Low	69.8	Low	110 Å²	110	103 Å²	103	71%	0.714	59%	0.593	S	S	*	*			trans	-56	110.6	175.6	19.9	-27.8	0	0	0	104.3	G49	G49-P51 VanDerWaalsContact O-CD 3.25Å; G49-P51 WeakPolarHBondContact O-CD 3.25Å
52	L	61.7	Low	71.3	Confident	58 Å²	58	100 Å²	100	30%	0.304	58%	0.58	S	S	.	*			trans	-52.2	133.1	175.9	-75.8	150.6	0	0	0	104.3	T50 R54 L56 E57	T50-L52 VanDerWaalsContact C-N 3.32Å; T50-L52 PolarHBondContact O-N 2.77Å; L52-R54 PolarHBondContact O-N 2.7Å; L52-R54 VanDerWaalsContact O-N 3.08Å; L52-L56 HydrophobicContact CB-CB 4.47Å; L52-L56 HydrophobicContact CB-CD2 4.48Å; L52-L56 HydrophobicContact CD2-CD2 3.34Å; L52-L56 HydrophobicContact CD2-CG 4.01Å; L52-L56 HydrophobicContact CG-CD2 4.48Å; L52-E57 HydrophobicContact CB-CG 3.76Å; L52-E57 HydrophobicContact CD1-CG 4.49Å
53	P	77	Confident	72.9	Confident	91 Å²	91	96.4 Å²	96.4	59%	0.591	56%	0.563	S	S	*	*			trans	-47.5	129.7	178.5	-27.8	34.1	0	0	0	107.8	A55 L56 E57	P53-A55 CarbonylContact O-C 3.51Å; P53-A55 PolarHBondContact O-N 2.74Å; P53-L56 WeakPolarHBondContact O-CA 3.41Å; P53-L56 WeakPolarHBondContact O-CB 3.48Å; P53-L56 PolarHBondContact O-N 3.08Å; P53-E57 PolarHBondContact O-N 2.68Å
54	R	74.3	Confident	74.6	Confident	198 Å²	198	95.8 Å²	95.8	75%	0.747	56%	0.555	S	S	*	*	H	α-helix	trans	-48	-27.5	-171.4	-72.3	-176.9	171.6	177.3	-2.8	113.4	L52 R58	L52-R54 PolarHBondContact O-N 2.7Å; L52-R54 VanDerWaalsContact O-N 3.08Å; R54-R58 WeakPolarHBondContact O-CG 3.34Å; R54-R58 PolarHBondContact O-N 3.48Å
55	A	75.5	Confident	76.4	Confident	58 Å²	58	98.2 Å²	98.2	48%	0.479	56%	0.56	S	S	.	*	H	α-helix	trans	-59.4	-43.9	172	0	0	0	0	0	113.8	P53 R58 A59	P53-A55 CarbonylContact O-C 3.51Å; P53-A55 PolarHBondContact O-N 2.74Å; A55-R58 PolarHBondContact O-N 2.97Å; A55-A59 WeakPolarHBondContact O-CB 3.45Å; A55-A59 PolarHBondContact O-N 3.3Å
56	L	81.9	Confident	78	Confident	73 Å²	73	95.2 Å²	95.2	38%	0.382	55%	0.553	S	S	.	*	H	α-helix	trans	-70.9	-35.6	178.5	-176.8	53.2	0	0	0	112.1	L52 P53 R60	L52-L56 HydrophobicContact CB-CB 4.47Å; L52-L56 HydrophobicContact CB-CD2 4.48Å; L52-L56 HydrophobicContact CD2-CD2 3.34Å; L52-L56 HydrophobicContact CD2-CG 4.01Å; L52-L56 HydrophobicContact CG-CD2 4.48Å; P53-L56 WeakPolarHBondContact O-CA 3.41Å; P53-L56 WeakPolarHBondContact O-CB 3.48Å; P53-L56 PolarHBondContact O-N 3.08Å; L56-R60 WeakPolarHBondContact O-CG 3.48Å; L56-R60 PolarHBondContact O-N 3.43Å
57	E	84.3	Confident	79.7	Confident	105 Å²	105	97.9 Å²	97.9	49%	0.491	55%	0.547	S	S	.	.	H	α-helix	trans	-63.9	-46.2	171.2	-67.1	-170.6	117.6	0	0	111.5	L52 P53 A59 R60 A61	L52-E57 HydrophobicContact CB-CG 3.76Å; L52-E57 HydrophobicContact CD1-CG 4.49Å; P53-E57 PolarHBondContact O-N 2.68Å; E57-A59 PolarHBondContact O-N 2.79Å; E57-R60 PolarHBondContact O-N 3.03Å; E57-A61 WeakPolarHBondContact O-CB 3.43Å; E57-A61 PolarHBondContact O-N 3.44Å
58	R	86.7	Confident	81.5	Confident	164 Å²	164	98.3 Å²	98.3	62%	0.619	53%	0.534	S	S	*	.	H	α-helix	trans	-61.7	-42	176	-74.2	-169.2	-59.1	-97.3	4.2	112.5	R54 A55 R60 A61 G62	R54-R58 WeakPolarHBondContact O-CG 3.34Å; R54-R58 PolarHBondContact O-N 3.48Å; A55-R58 PolarHBondContact O-N 2.97Å; R58-R60 VanDerWaalsContact C-N 3.34Å; R58-R60 PolarHBondContact O-N 3.47Å; R58-A61 PolarHBondContact O-N 2.91Å; R58-G62 PolarHBondContact O-N 3.32Å
59	A	88.1	Confident	83.4	Confident	62 Å²	62	98.7 Å²	98.7	51%	0.512	53%	0.529	S	S	.	.	H	α-helix	trans	-61.7	-42.7	177.2	0	0	0	0	0	111.8	A55 E57 G62 A63	A55-A59 WeakPolarHBondContact O-CB 3.45Å; A55-A59 PolarHBondContact O-N 3.3Å; E57-A59 PolarHBondContact O-N 2.79Å; A59-G62 PolarHBondContact O-N 3.06Å; A59-A63 WeakPolarHBondContact O-CB 3.39Å; A59-A63 PolarHBondContact O-N 3.48Å
60	R	90.3	Very high	85.3	Confident	149 Å²	149	100.6 Å²	100.6	56%	0.562	52%	0.523	S	S	*	.	H	α-helix	trans	-66	-43.1	175.8	-73.7	177	179.5	-171	0.6	112.4	L56 E57 R58 A63 K64	L56-R60 WeakPolarHBondContact O-CG 3.48Å; L56-R60 PolarHBondContact O-N 3.43Å; E57-R60 PolarHBondContact O-N 3.03Å; R58-R60 VanDerWaalsContact C-N 3.34Å; R58-R60 PolarHBondContact O-N 3.47Å; R60-A63 PolarHBondContact O-N 3.38Å; R60-K64 PolarHBondContact O-N 3.35Å
61	A	91.9	Very high	86.9	Confident	62 Å²	62	102.9 Å²	102.9	51%	0.512	52%	0.518	S	S	.	.	H	α-helix	trans	-61.4	-44.3	176.5	0	0	0	0	0	111.5	E57 R58 K64 M65	E57-A61 WeakPolarHBondContact O-CB 3.43Å; E57-A61 PolarHBondContact O-N 3.44Å; R58-A61 PolarHBondContact O-N 2.91Å; A61-K64 PolarHBondContact O-N 3.11Å; A61-M65 WeakPolarHBondContact O-CB 3.26Å; A61-M65 PolarHBondContact O-N 3.29Å
62	G	93.7	Very high	88.3	Confident	35 Å²	35	101 Å²	101	36%	0.361	50%	0.499	S	S	.	.	H	α-helix	trans	-61.5	-45.7	175.3	0	0	0	0	0	112.7	R58 A59 K64 M65 Q66	R58-G62 PolarHBondContact O-N 3.32Å; A59-G62 PolarHBondContact O-N 3.06Å; G62-K64 VanDerWaalsContact C-N 3.32Å; G62-K64 PolarHBondContact O-N 3.45Å; G62-M65 PolarHBondContact O-N 2.96Å; G62-Q66 PolarHBondContact O-N 3.4Å
63	A	94.8	Very high	89.8	Confident	50 Å²	50	101 Å²	101	41%	0.413	51%	0.508	S	S	.	.	H	α-helix	trans	-62.1	-38.1	176.6	0	0	0	0	0	112.7	A59 R60 R67	A59-A63 WeakPolarHBondContact O-CB 3.39Å; A59-A63 PolarHBondContact O-N 3.48Å; R60-A63 PolarHBondContact O-N 3.38Å; A63-R67 WeakPolarHBondContact O-CG 3.42Å; A63-R67 PolarHBondContact O-N 2.94Å
64	K	95.9	Very high	90.4	Very high	131 Å²	131	104 Å²	104	57%	0.57	51%	0.514	S	S	*	.	H	α-helix	trans	-65.1	-47.2	174.2	-175.7	-176.3	176.3	-64.5	0	111.1	R60 A61 G62 Q66 R67 D68	R60-K64 PolarHBondContact O-N 3.35Å; A61-K64 PolarHBondContact O-N 3.11Å; G62-K64 VanDerWaalsContact C-N 3.32Å; G62-K64 PolarHBondContact O-N 3.45Å; K64-Q66 VanDerWaalsContact C-N 3.33Å; K64-Q66 PolarHBondContact O-N 2.94Å; K64-R67 PolarHBondContact O-N 2.89Å; K64-D68 IonicContact NZ-OD2 2.84Å; K64-D68 PolarHBondContact NZ-OD2 3.3Å; K64-D68 PolarHBondContact O-N 2.99Å
65	M	96.1	Very high	91	Very high	115 Å²	115	101.9 Å²	101.9	57%	0.567	51%	0.506	S	S	*	.	H	α-helix	trans	-59.7	-43	179.4	-171.7	-179.5	82.3	0	0	111.8	A61 G62 R67 D68 I69	A61-M65 WeakPolarHBondContact O-CB 3.26Å; A61-M65 PolarHBondContact O-N 3.29Å; G62-M65 PolarHBondContact O-N 2.96Å; M65-R67 PolarHBondContact O-N 3.49Å; M65-D68 PolarHBondContact O-N 2.93Å; M65-I69 HydrophobicContact CE-CD1 4.32Å; M65-I69 HydrophobicContact CG-CD1 4.12Å; M65-I69 VanDerWaalsContact O-CG1 3.31Å; M65-I69 WeakPolarHBondContact O-CG1 3.4Å; M65-I69 PolarHBondContact O-N 3.27Å
66	Q	95.1	Very high	90.8	Very high	94 Å²	94	106.2 Å²	106.2	44%	0.439	52%	0.516	S	S	.	.	H	α-helix	trans	-61	-43	178.3	-173.2	59.6	34.7	0	0	112.2	G62 K64 D68 I69 E70	G62-Q66 PolarHBondContact O-N 3.4Å; K64-Q66 VanDerWaalsContact C-N 3.33Å; K64-Q66 PolarHBondContact O-N 2.94Å; Q66-D68 VanDerWaalsContact C-N 3.34Å; Q66-D68 PolarHBondContact O-N 3.44Å; Q66-I69 WeakPolarHBondContact O-CB 3.43Å; Q66-I69 PolarHBondContact O-N 3.42Å; Q66-E70 PolarHBondContact NE2-OE1 3.18Å; Q66-E70 WeakPolarHBondContact O-CG 3.35Å; Q66-E70 PolarHBondContact O-N 2.97Å
67	R	96.3	Very high	89.8	Confident	177 Å²	177	109.3 Å²	109.3	67%	0.668	55%	0.552	S	S	*	*	H	α-helix	trans	-64.1	-39.4	174.6	-69.4	173.7	-177.5	-176.4	0.2	112.4	A63 K64 M65 I69 E70 R71	A63-R67 WeakPolarHBondContact O-CG 3.42Å; A63-R67 PolarHBondContact O-N 2.94Å; K64-R67 PolarHBondContact O-N 2.89Å; M65-R67 PolarHBondContact O-N 3.49Å; R67-I69 VanDerWaalsContact C-N 3.33Å; R67-E70 PolarHBondContact O-N 3.39Å; R67-R71 VanDerWaalsContact O-CB 3.26Å; R67-R71 WeakPolarHBondContact O-CB 3.36Å; R67-R71 PolarHBondContact O-N 3.17Å
68	D	94.8	Very high	90.1	Very high	75 Å²	75	109.5 Å²	109.5	40%	0.401	56%	0.555	S	S	.	*	H	α-helix	trans	-64.9	-40.2	177.3	-69.3	-24.3	0	0	0	110.4	K64 M65 Q66 R71 E72	K64-D68 IonicContact NZ-OD2 2.84Å; K64-D68 PolarHBondContact NZ-OD2 3.3Å; K64-D68 PolarHBondContact O-N 2.99Å; M65-D68 PolarHBondContact O-N 2.93Å; Q66-D68 VanDerWaalsContact C-N 3.34Å; Q66-D68 PolarHBondContact O-N 3.44Å; D68-R71 PolarHBondContact O-N 2.95Å; D68-E72 WeakPolarHBondContact O-CB 3.38Å; D68-E72 PolarHBondContact O-N 3.49Å
69	I	95.4	Very high	90.2	Very high	88 Å²	88	106.6 Å²	106.6	45%	0.451	55%	0.552	S	S	.	*	H	α-helix	trans	-61.8	-50.5	173.5	-68.6	164.4	0	0	0	111.1	M65 Q66 R67 R71 E72 A73	M65-I69 HydrophobicContact CE-CD1 4.32Å; M65-I69 HydrophobicContact CG-CD1 4.12Å; M65-I69 VanDerWaalsContact O-CG1 3.31Å; M65-I69 WeakPolarHBondContact O-CG1 3.4Å; M65-I69 PolarHBondContact O-N 3.27Å; Q66-I69 WeakPolarHBondContact O-CB 3.43Å; Q66-I69 PolarHBondContact O-N 3.42Å; R67-I69 VanDerWaalsContact C-N 3.33Å; I69-R71 VanDerWaalsContact C-N 3.31Å; I69-R71 PolarHBondContact O-N 3.2Å; I69-E72 PolarHBondContact O-N 3.35Å; I69-A73 WeakPolarHBondContact O-CB 3.49Å; I69-A73 PolarHBondContact O-N 2.9Å
70	E	95.3	Very high	90.3	Very high	96 Å²	96	109.1 Å²	109.1	45%	0.449	55%	0.554	S	S	.	*	H	α-helix	trans	-59.8	-43.4	179.5	-74.2	164.4	-170.5	0	0	111.4	Q66 R67 E72 A73 H74	Q66-E70 PolarHBondContact NE2-OE1 3.18Å; Q66-E70 WeakPolarHBondContact O-CG 3.35Å; Q66-E70 PolarHBondContact O-N 2.97Å; R67-E70 PolarHBondContact O-N 3.39Å; E70-E72 VanDerWaalsContact C-N 3.33Å; E70-E72 PolarHBondContact O-N 3.1Å; E70-A73 PolarHBondContact O-N 3.46Å; E70-H74 PolarHBondContact O-CD2 3.4Å; E70-H74 PolarHBondContact O-N 2.94Å
71	R	94.3	Very high	90.3	Very high	170 Å²	170	106.8 Å²	106.8	64%	0.642	55%	0.553	S	S	*	*	H	α-helix	trans	-64.1	-38.4	177	-172.7	178.9	-178.2	-168.4	0.4	112.3	R67 D68 I69 R75	R67-R71 VanDerWaalsContact O-CB 3.26Å; R67-R71 WeakPolarHBondContact O-CB 3.36Å; R67-R71 PolarHBondContact O-N 3.17Å; D68-R71 PolarHBondContact O-N 2.95Å; I69-R71 VanDerWaalsContact C-N 3.31Å; I69-R71 PolarHBondContact O-N 3.2Å; R71-R75 PolarHBondContact O-N 3.41Å
72	E	91.3	Very high	90.2	Very high	69 Å²	69	109.6 Å²	109.6	32%	0.322	56%	0.556	S	S	.	*	H	α-helix	trans	-69.8	-41.7	176.4	-168.8	60.2	-145.3	0	0	111.3	D68 I69 E70 H74 R75 Q76	D68-E72 WeakPolarHBondContact O-CB 3.38Å; D68-E72 PolarHBondContact O-N 3.49Å; I69-E72 PolarHBondContact O-N 3.35Å; E70-E72 VanDerWaalsContact C-N 3.33Å; E70-E72 PolarHBondContact O-N 3.1Å; E72-H74 VanDerWaalsContact C-N 3.31Å; E72-H74 PolarHBondContact O-N 2.9Å; E72-R75 WeakPolarHBondContact O-CB 3.43Å; E72-R75 PolarHBondContact O-N 3.38Å; E72-R75 IonicContact OE1-NH1 3.4Å; E72-R75 IonicContact OE2-CZ 3.07Å; E72-R75 IonicContact OE2-NH1 3.4Å; E72-R75 PolarHBondContact OE2-NH1 3.43Å; E72-R75 IonicContact OE2-NH2 3.58Å; E72-Q76 WeakPolarHBondContact O-CG 3.31Å; E72-Q76 PolarHBondContact O-N 2.84Å; E72-Q76 VanDerWaalsContact O-N 3.1Å; E72-Q76 PolarHBondContact OE1-NE2 3.03Å
73	A	92.1	Very high	90	Very high	59 Å²	59	114.5 Å²	114.5	49%	0.488	57%	0.569	S	S	.	*	H	α-helix	trans	-59.4	-41.5	174.8	0	0	0	0	0	112	I69 E70 R75 Q76 A77	I69-A73 WeakPolarHBondContact O-CB 3.49Å; I69-A73 PolarHBondContact O-N 2.9Å; E70-A73 PolarHBondContact O-N 3.46Å; A73-R75 VanDerWaalsContact C-N 3.29Å; A73-R75 PolarHBondContact O-N 2.91Å; A73-Q76 PolarHBondContact O-N 3.24Å; A73-A77 PolarHBondContact O-N 3.24Å
74	H	89.7	Confident	89.7	Confident	154 Å²	154	119.1 Å²	119.1	71%	0.713	58%	0.58	S	S	*	*	H	α-helix	trans	-69.2	-22.7	174.4	-78.2	-61	0	0	0	114.3	E70 E72	E70-H74 PolarHBondContact O-CD2 3.4Å; E70-H74 PolarHBondContact O-N 2.94Å; E72-H74 VanDerWaalsContact C-N 3.31Å; E72-H74 PolarHBondContact O-N 2.9Å
75	R	87.1	Confident	89.2	Confident	153 Å²	153	118.2 Å²	118.2	58%	0.577	58%	0.581	S	S	*	*	H	α-helix	trans	-78.6	-32.2	175.4	-174.7	-172.1	-64.4	147.1	9.6	112	R71 E72 A73 A77	R71-R75 PolarHBondContact O-N 3.41Å; E72-R75 WeakPolarHBondContact O-CB 3.43Å; E72-R75 PolarHBondContact O-N 3.38Å; E72-R75 IonicContact OE1-NH1 3.4Å; E72-R75 IonicContact OE2-CZ 3.07Å; E72-R75 IonicContact OE2-NH1 3.4Å; E72-R75 PolarHBondContact OE2-NH1 3.43Å; E72-R75 IonicContact OE2-NH2 3.58Å; A73-R75 VanDerWaalsContact C-N 3.29Å; A73-R75 PolarHBondContact O-N 2.91Å; R75-A77 VanDerWaalsContact C-N 3.33Å
76	Q	72.8	Confident	88.6	Confident	149 Å²	149	118.5 Å²	118.5	70%	0.696	58%	0.582	S	S	*	*			trans	-88.3	-0.9	-176.5	-64.3	179.4	11.4	0	0	113.3	E72 A73	E72-Q76 WeakPolarHBondContact O-CG 3.31Å; E72-Q76 PolarHBondContact O-N 2.84Å; E72-Q76 VanDerWaalsContact O-N 3.1Å; E72-Q76 PolarHBondContact OE1-NE2 3.03Å; A73-Q76 PolarHBondContact O-N 3.24Å
77	A	59.6	Low	88	Confident	138 Å²	138	120.7 Å²	120.7	100%	1.141	60%	0.595	S	S	*	*			trans	-90.8	0	171.9	0	0	0	0	0	111.1	A73 R75	A73-A77 PolarHBondContact O-N 3.24Å; R75-A77 VanDerWaalsContact C-N 3.33Å

Retrieved 77 of 77 residues in 116.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).