A0A087WQX6_MOUSE Loading...

General transcription factor II E, polypeptide 2 (beta subunit)

AlphaFold DB , UniProt , Accession A0A087WQX6, Species MOUSE (Mus musculus, Mouse), Gene Gtf2e2, Length 30 aa.

						>A0A087WQX6_MOUSE|A0A087WQX6|Gtf2e2
MDPSLLRDRELFKKRALSTPVVEKRAVPSE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.4	Confident	88.9	Confident	160 Å²	160	104.2 Å²	104.2	79%	0.788	52%	0.52	S	S	*	.				0	137.3	0	-82.9	-158.8	82	0	0	108.1	L5 L6	M1-L5 HydrophobicContact CE-CG 4.23Å; M1-L5 HydrophobicContact CE-CD2 3.81Å; M1-L6 HydrophobicContact CB-CG 4.43Å; M1-L6 HydrophobicContact CB-CD1 4.48Å; M1-L6 HydrophobicContact SD-CG 4.45Å; M1-L6 HydrophobicContact SD-CD2 3.6Å; M1-L6 HydrophobicContact CE-CD2 3.68Å; M1-L6 HydrophobicContact CE-CG 4.39Å
2	D	93.1	Very high	88.7	Confident	90 Å²	90	106.3 Å²	106.3	48%	0.481	52%	0.524	S	S	.	.			trans	-69.5	132.3	176	-168	-78.3	0	0	0	110.7	S4 L5 L6	D2-S4 PolarHBondContact O-N 2.98Å; D2-S4 WeakPolarHBondContact OD1-CA 3.3Å; D2-S4 WeakPolarHBondContact OD1-CB 3.15Å; D2-S4 PolarHBondContact OD1-N 2.9Å; D2-S4 PolarHBondContact OD1-OG 2.82Å; D2-L5 PolarHBondContact O-N 2.73Å; D2-L5 WeakPolarHBondContact O-CB 3.34Å; D2-L5 HydrophobicContact CB-CB 4.12Å; D2-L6 PolarHBondContact O-N 3.05Å
3	P	90.7	Very high	88.5	Confident	91 Å²	91	107.2 Å²	107.2	59%	0.591	52%	0.523	S	S	*	.	H	α-helix	trans	-58.7	-31.3	177.7	-24.8	34.2	0	0	0	113.9	L6 R7	P3-L6 PolarHBondContact O-N 2.74Å; P3-R7 WeakPolarHBondContact O-CG 3.35Å; P3-R7 PolarHBondContact O-N 2.85Å
4	S	90.8	Very high	88.3	Confident	70 Å²	70	109.4 Å²	109.4	49%	0.49	53%	0.528	S	S	.	.	H	α-helix	trans	-68	-42.9	177.8	-35.7	0	0	0	0	110.4	D2 L6 R7 D8	D2-S4 PolarHBondContact O-N 2.98Å; D2-S4 WeakPolarHBondContact OD1-CA 3.3Å; D2-S4 WeakPolarHBondContact OD1-CB 3.15Å; D2-S4 PolarHBondContact OD1-N 2.9Å; D2-S4 PolarHBondContact OD1-OG 2.82Å; S4-L6 VanDerWaalsContact C-N 3.29Å; S4-L6 PolarHBondContact O-N 2.88Å; S4-R7 PolarHBondContact O-N 2.72Å; S4-R7 VanDerWaalsContact O-N 3.17Å; S4-D8 PolarHBondContact O-N 3.21Å
5	L	89	Confident	88	Confident	100 Å²	100	112.9 Å²	112.9	52%	0.524	53%	0.534	S	S	.	.	H	α-helix	trans	-62.9	-34.9	176.2	-175.7	64.5	0	0	0	112.5	M1 D2 R9	M1-L5 HydrophobicContact CE-CG 4.23Å; M1-L5 HydrophobicContact CE-CD2 3.81Å; D2-L5 PolarHBondContact O-N 2.73Å; D2-L5 WeakPolarHBondContact O-CB 3.34Å; D2-L5 HydrophobicContact CB-CB 4.12Å; L5-R9 PolarHBondContact O-N 2.9Å; L5-R9 VanDerWaalsContact O-N 3.13Å; L5-R9 WeakPolarHBondContact O-CB 3.38Å
6	L	92	Very high	87.7	Confident	56 Å²	56	107.9 Å²	107.9	29%	0.293	52%	0.518	S	S	.	.	H	α-helix	trans	-66.5	-43.1	174.9	-69.3	176.2	0	0	0	111.7	M1 D2 P3 S4 R9 E10	M1-L6 HydrophobicContact CB-CG 4.43Å; M1-L6 HydrophobicContact CB-CD1 4.48Å; M1-L6 HydrophobicContact SD-CG 4.45Å; M1-L6 HydrophobicContact SD-CD2 3.6Å; M1-L6 HydrophobicContact CE-CD2 3.68Å; M1-L6 HydrophobicContact CE-CG 4.39Å; D2-L6 PolarHBondContact O-N 3.05Å; P3-L6 PolarHBondContact O-N 2.74Å; S4-L6 VanDerWaalsContact C-N 3.29Å; S4-L6 PolarHBondContact O-N 2.88Å; L6-R9 PolarHBondContact O-N 2.88Å; L6-E10 WeakPolarHBondContact O-CG 3.3Å; L6-E10 PolarHBondContact O-N 3.45Å; L6-E10 VanDerWaalsContact O-N 3.11Å
7	R	90.3	Very high	87.1	Confident	180 Å²	180	110.6 Å²	110.6	68%	0.679	54%	0.535	S	S	*	.	H	α-helix	trans	-63.5	-44.3	176.8	-72.2	-177.9	174.8	-170.3	-0.3	111.9	P3 S4 R9 E10 L11	P3-R7 WeakPolarHBondContact O-CG 3.35Å; P3-R7 PolarHBondContact O-N 2.85Å; S4-R7 PolarHBondContact O-N 2.72Å; S4-R7 VanDerWaalsContact O-N 3.17Å; R7-R9 VanDerWaalsContact C-N 3.3Å; R7-R9 PolarHBondContact O-N 2.8Å; R7-E10 PolarHBondContact O-N 3.28Å; R7-L11 PolarHBondContact O-N 3.46Å; R7-L11 WeakPolarHBondContact O-CG 3.49Å
8	D	88.8	Confident	86.6	Confident	100 Å²	100	110.1 Å²	110.1	54%	0.535	55%	0.545	S	S	.	.	H	α-helix	trans	-61.3	-40.3	177.8	-69.1	-20.9	0	0	0	111.5	S4 E10 L11 F12	S4-D8 PolarHBondContact O-N 3.21Å; D8-E10 PolarHBondContact O-N 3.32Å; D8-L11 PolarHBondContact O-N 3.39Å; D8-F12 WeakPolarHBondContact O-CB 3.02Å; D8-F12 PolarHBondContact O-N 3.49Å
9	R	90.4	Very high	85.7	Confident	118 Å²	118	108.8 Å²	108.8	45%	0.445	54%	0.543	S	S	.	.	H	α-helix	trans	-62.7	-42.1	175.5	-169.4	-172.9	75.3	-167.1	3.6	112.4	L5 L6 R7 K13	L5-R9 PolarHBondContact O-N 2.9Å; L5-R9 VanDerWaalsContact O-N 3.13Å; L5-R9 WeakPolarHBondContact O-CB 3.38Å; L6-R9 PolarHBondContact O-N 2.88Å; R7-R9 VanDerWaalsContact C-N 3.3Å; R7-R9 PolarHBondContact O-N 2.8Å; R9-K13 WeakPolarHBondContact O-CG 3.38Å; R9-K13 PolarHBondContact O-N 3.26Å
10	E	92	Very high	84.7	Confident	100 Å²	100	107.8 Å²	107.8	47%	0.467	55%	0.545	S	S	.	.	H	α-helix	trans	-66.7	-42	178.2	-72.2	174.6	-173.7	0	0	111.9	L6 R7 D8 K13 K14	L6-E10 WeakPolarHBondContact O-CG 3.3Å; L6-E10 PolarHBondContact O-N 3.45Å; L6-E10 VanDerWaalsContact O-N 3.11Å; R7-E10 PolarHBondContact O-N 3.28Å; D8-E10 PolarHBondContact O-N 3.32Å; E10-K13 PolarHBondContact O-N 2.97Å; E10-K14 WeakPolarHBondContact O-CG 3.37Å; E10-K14 PolarHBondContact O-N 3.08Å
11	L	89.2	Confident	83.6	Confident	81 Å²	81	106.8 Å²	106.8	42%	0.424	54%	0.544	S	S	.	.	H	α-helix	trans	-64.5	-42.5	175.7	-70.2	173.4	0	0	0	111.7	R7 D8 K14 R15	R7-L11 PolarHBondContact O-N 3.46Å; R7-L11 WeakPolarHBondContact O-CG 3.49Å; D8-L11 PolarHBondContact O-N 3.39Å; L11-K14 PolarHBondContact O-N 3.43Å; L11-R15 PolarHBondContact O-N 2.75Å; L11-R15 WeakPolarHBondContact O-CG 3.38Å
12	F	86.9	Confident	82.9	Confident	130 Å²	130	104 Å²	104	57%	0.57	54%	0.535	S	S	*	.	H	α-helix	trans	-59.3	-47.6	175.1	178.3	-95.8	0	0	0	111.5	D8 K14 R15 A16	D8-F12 WeakPolarHBondContact O-CB 3.02Å; D8-F12 PolarHBondContact O-N 3.49Å; F12-K14 PolarHBondContact O-N 2.94Å; F12-R15 PolarHBondContact O-N 3.34Å; F12-A16 HydrophobicContact CE1-CB 4.5Å; F12-A16 WeakPolarHBondContact O-CB 3.37Å; F12-A16 PolarHBondContact O-N 3.02Å
13	K	85.5	Confident	81.4	Confident	117 Å²	117	106.7 Å²	106.7	51%	0.509	55%	0.545	S	S	.	.	H	α-helix	trans	-60.1	-44.7	176.9	-74.5	-179.2	-179.7	-170.5	0	112.2	R9 E10 R15 A16 L17	R9-K13 WeakPolarHBondContact O-CG 3.38Å; R9-K13 PolarHBondContact O-N 3.26Å; E10-K13 PolarHBondContact O-N 2.97Å; K13-R15 VanDerWaalsContact C-N 3.34Å; K13-R15 PolarHBondContact O-N 2.78Å; K13-A16 PolarHBondContact O-N 3.23Å; K13-L17 PolarHBondContact O-N 3.4Å; K13-L17 WeakPolarHBondContact O-CG 3.47Å; K13-L17 VanDerWaalsContact O-CG 3.3Å
14	K	86.1	Confident	79.8	Confident	138 Å²	138	111.2 Å²	111.2	60%	0.6	56%	0.556	S	S	*	*	H	α-helix	trans	-60	-44.1	176.8	-74.3	174.8	-178.7	175.9	0	111.6	E10 L11 F12 L17 S18	E10-K14 WeakPolarHBondContact O-CG 3.37Å; E10-K14 PolarHBondContact O-N 3.08Å; L11-K14 PolarHBondContact O-N 3.43Å; F12-K14 PolarHBondContact O-N 2.94Å; K14-L17 PolarHBondContact O-N 3.13Å; K14-S18 WeakPolarHBondContact O-CB 3.48Å; K14-S18 PolarHBondContact O-N 3.2Å; K14-S18 VanDerWaalsContact O-N 3.08Å
15	R	83.9	Confident	78.2	Confident	162 Å²	162	117.5 Å²	117.5	61%	0.611	57%	0.569	S	S	*	*	H	α-helix	trans	-64.6	-44.3	175.1	-70.2	175.6	-171.8	175.2	2.8	111.6	L11 F12 K13 L17 S18 T19	L11-R15 PolarHBondContact O-N 2.75Å; L11-R15 WeakPolarHBondContact O-CG 3.38Å; F12-R15 PolarHBondContact O-N 3.34Å; K13-R15 VanDerWaalsContact C-N 3.34Å; K13-R15 PolarHBondContact O-N 2.78Å; R15-L17 VanDerWaalsContact C-N 3.27Å; R15-L17 PolarHBondContact O-N 3.35Å; R15-S18 PolarHBondContact O-N 3.42Å; R15-T19 PolarHBondContact O-OG1 3.39Å; R15-T19 PolarHBondContact O-N 3.05Å; R15-T19 WeakPolarHBondContact O-CA 3.45Å; R15-T19 CarbonylContact O-C 3.59Å; R15-T19 VanDerWaalsContact O-C 3.27Å
16	A	83	Confident	76.7	Confident	34 Å²	34	117 Å²	117	28%	0.281	58%	0.579	S	S	.	*	H	α-helix	trans	-63.4	-31.3	178.5	0	0	0	0	0	113.2	F12 K13 T19 P20	F12-A16 HydrophobicContact CE1-CB 4.5Å; F12-A16 WeakPolarHBondContact O-CB 3.37Å; F12-A16 PolarHBondContact O-N 3.02Å; K13-A16 PolarHBondContact O-N 3.23Å; A16-T19 CarbonylContact O-C 3.27Å; A16-P20 WeakPolarHBondContact O-CA 3.42Å
17	L	78	Confident	75.1	Confident	154 Å²	154	119.2 Å²	119.2	81%	0.806	59%	0.594	S	S	*	*	H	α-helix	trans	-75.2	-37.9	174.4	-68.9	170.5	0	0	0	112.4	K13 K14 R15	K13-L17 PolarHBondContact O-N 3.4Å; K13-L17 WeakPolarHBondContact O-CG 3.47Å; K13-L17 VanDerWaalsContact O-CG 3.3Å; K14-L17 PolarHBondContact O-N 3.13Å; R15-L17 VanDerWaalsContact C-N 3.27Å; R15-L17 PolarHBondContact O-N 3.35Å
18	S	77.2	Confident	73.6	Confident	101 Å²	101	116.3 Å²	116.3	71%	0.706	60%	0.599	S	S	*	*	H	α-helix	trans	-82.6	-33.2	-178.8	-173.9	0	0	0	0	113.6	K14 R15	K14-S18 WeakPolarHBondContact O-CB 3.48Å; K14-S18 PolarHBondContact O-N 3.2Å; K14-S18 VanDerWaalsContact O-N 3.08Å; R15-S18 PolarHBondContact O-N 3.42Å
19	T	70.6	Confident	72.2	Confident	85 Å²	85	117.3 Å²	117.3	52%	0.521	61%	0.614	S	S	.	*	S	Bend	trans	-141	88.2	179.6	49.7	0	0	0	0	105.2	R15 A16 V21	R15-T19 PolarHBondContact O-OG1 3.39Å; R15-T19 PolarHBondContact O-N 3.05Å; R15-T19 WeakPolarHBondContact O-CA 3.45Å; R15-T19 CarbonylContact O-C 3.59Å; R15-T19 VanDerWaalsContact O-C 3.27Å; A16-T19 CarbonylContact O-C 3.27Å; T19-V21 PolarHBondContact O-N 3.37Å
20	P	65.7	Low	70	Confident	88 Å²	88	124 Å²	124	57%	0.571	65%	0.65	S	S	*	*			trans	-53.6	115.4	174.1	22.5	-31.2	0	0	0	106.6	A16 V22	A16-P20 WeakPolarHBondContact O-CA 3.42Å; P20-V22 HydrophobicContact CB-CG2 4.29Å; P20-V22 PolarHBondContact O-N 2.95Å
21	V	61.2	Low	68.9	Low	87 Å²	87	125.2 Å²	125.2	53%	0.527	66%	0.659	S	S	.	*			trans	-72.2	47.9	171	-171.6	0	0	0	0	107.8	T19 E23	T19-V21 PolarHBondContact O-N 3.37Å; V21-E23 VanDerWaalsContact C-N 3.29Å; V21-E23 HydrophobicContact CG1-CG 4.27Å
22	V	57.3	Low	67.9	Low	101 Å²	101	127.5 Å²	127.5	61%	0.612	67%	0.671	S	S	*	*			trans	-89.7	82.2	149.4	-175.8	0	0	0	0	100.3	P20 K24	P20-V22 HydrophobicContact CB-CG2 4.29Å; P20-V22 PolarHBondContact O-N 2.95Å; V22-K24 PolarHBondContact O-N 3.17Å; V22-K24 VanDerWaalsContact CG1-N 3.25Å; V22-K24 HydrophobicContact CG1-CG 4Å
23	E	60.6	Low	66.8	Low	148 Å²	148	127.3 Å²	127.3	69%	0.692	68%	0.677	S	S	*	*				9.4	58.7	70.4	-68.4	-156.2	179.6	0	0	111.5	V21 R25	V21-E23 VanDerWaalsContact C-N 3.29Å; V21-E23 HydrophobicContact CG1-CG 4.27Å; E23-R25 PolarHBondContact O-N 3.18Å
24	K	58.2	Low	65.7	Low	186 Å²	186	127.9 Å²	127.9	81%	0.809	69%	0.687	S	S	*	*				-54.3	97.2	126.1	-70.4	-175.3	-179	-179.8	0	101.6	V22 A26	V22-K24 PolarHBondContact O-N 3.17Å; V22-K24 VanDerWaalsContact CG1-N 3.25Å; V22-K24 HydrophobicContact CG1-CG 4Å; K24-A26 PolarHBondContact O-N 2.96Å
25	R	56.4	Low	64.4	Low	202 Å²	202	127.3 Å²	127.3	76%	0.762	69%	0.692	S	S	*	*			trans	-48.2	98.3	144.9	-76.1	178.1	176.9	172.5	-3.3	102.5	E23 V27	E23-R25 PolarHBondContact O-N 3.18Å; R25-V27 HydrophobicContact CB-CG1 4.21Å; R25-V27 PolarHBondContact O-N 3.19Å
26	A	57.2	Low	63.1	Low	88 Å²	88	125 Å²	125	73%	0.727	70%	0.698	S	S	*	*			trans	-56.4	91.1	136.1	0	0	0	0	0	101.4	K24 P28	K24-A26 PolarHBondContact O-N 2.96Å; A26-P28 VanDerWaalsContact O-CD 3.3Å; A26-P28 WeakPolarHBondContact O-CD 3.38Å; A26-P28 VanDerWaalsContact O-N 3.07Å
27	V	59.2	Low	61.7	Low	103 Å²	103	131.5 Å²	131.5	62%	0.624	73%	0.728	S	S	*	*			trans	-46.6	118.7	157.3	-73.9	0	0	0	0	102.8	R25 S29	R25-V27 HydrophobicContact CB-CG1 4.21Å; R25-V27 PolarHBondContact O-N 3.19Å; V27-S29 VanDerWaalsContact C-N 3.31Å; V27-S29 PolarHBondContact O-N 3.11Å
28	P	58.5	Low	60.5	Low	119 Å²	119	129.8 Å²	129.8	77%	0.773	72%	0.721	S	S	*	*			trans	-57.1	113.7	164.2	23.9	-27	0	0	0	103.7	A26 E30	A26-P28 VanDerWaalsContact O-CD 3.3Å; A26-P28 WeakPolarHBondContact O-CD 3.38Å; A26-P28 VanDerWaalsContact O-N 3.07Å; P28-E30 PolarHBondContact O-N 3.29Å
29	S	58.3	Low	59.1	Low	122 Å²	122	132.2 Å²	132.2	85%	0.853	72%	0.723	S	S	*	*			trans	-71.2	92.6	172.7	175.3	0	0	0	0	105.7	V27	V27-S29 VanDerWaalsContact C-N 3.31Å; V27-S29 PolarHBondContact O-N 3.11Å
30	E	45.6	Very low	58	Low	257 Å²	257	136.5 Å²	136.5	100%	1.201	74%	0.741	S	S	*	*			trans	-141.4	0	157.1	-164.9	166.3	99.1	0	0	109.3	P28	P28-E30 PolarHBondContact O-N 3.29Å

Retrieved 30 of 30 residues in 31.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).