A0A087WQX7_MOUSE Loading...

Transforming growth factor, beta receptor associated protein 1

AlphaFold DB , UniProt , Accession A0A087WQX7, Species MOUSE (Mus musculus, Mouse), Gene Tgfbrap1, Length 52 aa.

						>A0A087WQX7_MOUSE|A0A087WQX7|Tgfbrap1
MFATVAGISQRAPVHWSENVIGAAVCFPYVIALDDEFITVHSMLDQQQKQTL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	83	Confident	90.4	Very high	136 Å²	136	92.9 Å²	92.9	67%	0.67	55%	0.545	S	S	*	.				0	148.7	0	178.4	179	-79.6	0	0	108.6	S9 P13	M1-S9 WeakPolarHBondContact CG-OG 3.49Å; M1-P13 HydrophobicContact CE-CB 4.42Å
2	F	84.2	Confident	90.1	Very high	63 Å²	63	90.3 Å²	90.3	28%	0.276	54%	0.542	S	S	.	.			trans	-116.1	122.5	173.3	-63	-92.8	0	0	0	109.3	S9 R11 M43	F2-S9 WeakPolarHBondContact O-CA 3.37Å; F2-S9 PolarHBondContact O-OG 2.75Å; F2-R11 VanDerWaalsContact CE1-NH2 3.33Å; F2-R11 VanDerWaalsContact CG-CZ 3.44Å; F2-R11 VanDerWaalsContact CZ-NH2 3.29Å; F2-M43 HydrophobicContact CE1-CE 3.3Å; F2-M43 HydrophobicContact CZ-CB 4.15Å; F2-M43 HydrophobicContact CZ-CE 3.31Å; F2-M43 HydrophobicContact CZ-CG 4Å; F2-M43 HydrophobicContact CZ-SD 4.48Å
3	A	90.6	Very high	89.8	Confident	65 Å²	65	87.7 Å²	87.7	54%	0.537	53%	0.529	S	S	.	.	B	Isolated β-bridge	trans	-113.7	148.2	180	0	0	0	0	0	110.6	I8	A3-I8 CarbonylContact C-O 3.58Å; A3-I8 WeakPolarHBondContact CA-O 3.26Å
4	T	92.8	Very high	89.7	Confident	52 Å²	52	82.4 Å²	82.4	32%	0.319	50%	0.497	S	S	.	.			trans	-69.6	170.7	165.5	67.2	0	0	0	0	110.2	A6 G7 I8 Q10	T4-A6 PolarHBondContact O-N 3.23Å; T4-A6 PolarHBondContact OG1-N 3.11Å; T4-G7 PolarHBondContact O-N 3.02Å; T4-I8 PolarHBondContact N-O 3.49Å; T4-I8 PolarHBondContact OG1-N 2.87Å; T4-Q10 HydrophobicContact CG2-CG 4.3Å
5	V	95	Very high	89.6	Confident	165 Å²	165	87.3 Å²	87.3	100%	1	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.8	-17.7	173.5	-61.1	0	0	0	0	113.5	G7	V5-G7 VanDerWaalsContact C-N 3.29Å
6	A	96.3	Very high	89.5	Confident	75 Å²	75	88.8 Å²	88.8	62%	0.62	51%	0.506	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.1	3.4	173.4	0	0	0	0	0	113.4	T4 I8	T4-A6 PolarHBondContact O-N 3.23Å; T4-A6 PolarHBondContact OG1-N 3.11Å; A6-I8 VanDerWaalsContact C-N 3.32Å; A6-I8 HydrophobicContact CB-CD1 4.29Å; A6-I8 HydrophobicContact CB-CG1 4.35Å; A6-I8 PolarHBondContact O-N 2.82Å
7	G	92.9	Very high	89.5	Confident	62 Å²	62	86.1 Å²	86.1	64%	0.639	49%	0.494	S	S	*	.	S	Bend	trans	77.8	13.1	-178.7	0	0	0	0	0	114.5	T4 V5	T4-G7 PolarHBondContact O-N 3.02Å; V5-G7 VanDerWaalsContact C-N 3.29Å
8	I	93.3	Very high	89.4	Confident	102 Å²	102	92 Å²	92	52%	0.523	52%	0.516	S	S	.	.			trans	-95.8	124.6	-176.9	-58.8	173.8	0	0	0	109.6	A3 T4 A6	A3-I8 CarbonylContact C-O 3.58Å; A3-I8 WeakPolarHBondContact CA-O 3.26Å; T4-I8 PolarHBondContact N-O 3.49Å; T4-I8 PolarHBondContact OG1-N 2.87Å; A6-I8 VanDerWaalsContact C-N 3.32Å; A6-I8 HydrophobicContact CB-CD1 4.29Å; A6-I8 HydrophobicContact CB-CG1 4.35Å; A6-I8 PolarHBondContact O-N 2.82Å
9	S	91	Very high	89.7	Confident	38 Å²	38	92.7 Å²	92.7	27%	0.266	52%	0.519	S	S	.	.	B	Isolated β-bridge	trans	-82.1	125.5	166.4	-167.8	0	0	0	0	110.2	M1 F2 R11	M1-S9 WeakPolarHBondContact CG-OG 3.49Å; F2-S9 WeakPolarHBondContact O-CA 3.37Å; F2-S9 PolarHBondContact O-OG 2.75Å; S9-R11 PolarHBondContact OG-O 2.89Å
10	Q	89.3	Confident	89.9	Confident	169 Å²	169	90.4 Å²	90.4	79%	0.79	51%	0.507	S	S	*	.			trans	-95.3	-3.6	176.4	-66.7	-177.4	-19.2	0	0	112.9	T4	T4-Q10 HydrophobicContact CG2-CG 4.3Å
11	R	86.5	Confident	90.3	Very high	95 Å²	95	92 Å²	92	36%	0.358	51%	0.513	S	S	.	.	S	Bend	trans	-136.8	157.4	-178	54.8	-167.7	178.3	160.7	-9.2	111.3	F2 S9 M43	F2-R11 VanDerWaalsContact CE1-NH2 3.33Å; F2-R11 VanDerWaalsContact CG-CZ 3.44Å; F2-R11 VanDerWaalsContact CZ-NH2 3.29Å; S9-R11 PolarHBondContact OG-O 2.89Å; R11-M43 PolarHBondContact NH1-O 3.23Å
12	A	86.1	Confident	90.9	Very high	61 Å²	61	86.9 Å²	86.9	50%	0.504	50%	0.495	S	S	.	.	P	Polyproline II helix	trans	-57.6	151.6	174.2	0	0	0	0	0	110.4	Q46	A12-Q46 PolarHBondContact O-NE2 3.49Å; A12-Q46 PolarHBondContact O-OE1 3.35Å
13	P	86.9	Confident	91.5	Very high	57 Å²	57	87.5 Å²	87.5	37%	0.37	51%	0.512	S	S	.	.	P	Polyproline II helix	trans	-64.2	155	171.9	27.8	-33.4	0	0	0	111.4	M1	M1-P13 HydrophobicContact CE-CB 4.42Å
14	V	88.2	Confident	91.8	Very high	13 Å²	13	87 Å²	87	8%	0.079	51%	0.507	C	S	.	.	P	Polyproline II helix	trans	-73.8	131.4	163.4	176.9	0	0	0	0	106.8	W16 H41 Q46	V14-W16 HydrophobicContact CB-CE3 4.29Å; V14-W16 HydrophobicContact CB-CZ3 4.4Å; V14-W16 HydrophobicContact CG1-CE3 3.82Å; V14-W16 HydrophobicContact CG1-CZ3 4.27Å; V14-H41 HydrophobicContact CG1-CB 3.84Å; V14-Q46 HydrophobicContact CG2-CB 4.06Å; V14-Q46 HydrophobicContact CG2-CG 4.35Å
15	H	87.4	Confident	91.9	Very high	156 Å²	156	89.5 Å²	89.5	72%	0.722	52%	0.522	S	S	*	.	P	Polyproline II helix	trans	-88.8	126.5	172.9	-72.6	-82.6	0	0	0	109.4	H41	H15-H41 PolarHBondContact O-CE1 2.87Å; H15-H41 VanDerWaalsContact O-CE1 3.32Å
16	W	89.1	Confident	91.9	Very high	112 Å²	112	85.3 Å²	85.3	42%	0.424	50%	0.5	S	S	.	.			trans	-145.9	175.1	175.2	51.3	41.7	0	0	0	109.3	V14 V20 V30 A32	V14-W16 HydrophobicContact CB-CE3 4.29Å; V14-W16 HydrophobicContact CB-CZ3 4.4Å; V14-W16 HydrophobicContact CG1-CE3 3.82Å; V14-W16 HydrophobicContact CG1-CZ3 4.27Å; W16-V20 HydrophobicContact CB-CG2 4.47Å; W16-V20 HydrophobicContact CG-CG2 4.18Å; W16-V30 HydrophobicContact CZ3-CG1 3.89Å; W16-A32 HydrophobicContact CE3-CB 4.42Å
17	S	88.5	Confident	91.8	Very high	42 Å²	42	89.3 Å²	89.3	29%	0.294	50%	0.503	S	S	.	.			trans	-52.7	147	176.6	-176.4	0	0	0	0	112.4	N19 V20 D34	S17-N19 PolarHBondContact O-N 2.88Å; S17-N19 PolarHBondContact OG-N 3.09Å; S17-V20 WeakPolarHBondContact O-CG2 3.38Å; S17-D34 WeakPolarHBondContact CB-OD2 3.44Å; S17-D34 PolarHBondContact OG-OD2 2.75Å
18	E	88.8	Confident	91.9	Very high	193 Å²	193	87.9 Å²	87.9	90%	0.902	48%	0.483	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.8	-20.8	175.8	-63.9	-164.2	151.2	0	0	112.2
19	N	93.9	Very high	92	Very high	105 Å²	105	87.8 Å²	87.8	56%	0.561	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.8	32.2	-174.8	-62.8	-36.8	0	0	0	113.1	S17 I21 D34	S17-N19 PolarHBondContact O-N 2.88Å; S17-N19 PolarHBondContact OG-N 3.09Å; N19-I21 WeakPolarHBondContact O-CG2 3.44Å; N19-I21 PolarHBondContact O-N 3.42Å; N19-I21 VanDerWaalsContact O-N 3.09Å; N19-D34 WeakPolarHBondContact O-CB 3.43Å
20	V	94.9	Very high	92.2	Very high	46 Å²	46	86.7 Å²	86.7	28%	0.279	47%	0.468	S	S	.	.			trans	-62.3	116.2	177.3	172.7	0	0	0	0	109.9	W16 S17 G22 A32 L33	W16-V20 HydrophobicContact CB-CG2 4.47Å; W16-V20 HydrophobicContact CG-CG2 4.18Å; S17-V20 WeakPolarHBondContact O-CG2 3.38Å; V20-G22 VanDerWaalsContact CG1-O 3.26Å; V20-G22 WeakPolarHBondContact CG1-O 3.35Å; V20-A32 HydrophobicContact CG1-CB 4.2Å; V20-A32 HydrophobicContact CG2-CB 4.02Å; V20-L33 CarbonylContact C-O 3.55Å; V20-L33 WeakPolarHBondContact CA-O 3.45Å
21	I	97.2	Very high	92.6	Very high	126 Å²	126	81.5 Å²	81.5	65%	0.646	45%	0.445	S	S	*	.			trans	-95.8	-15.8	178.8	61	171.7	0	0	0	112.6	N19 L33	N19-I21 WeakPolarHBondContact O-CG2 3.44Å; N19-I21 PolarHBondContact O-N 3.42Å; N19-I21 VanDerWaalsContact O-N 3.09Å; I21-L33 HydrophobicContact CD1-CD2 4.07Å; I21-L33 HydrophobicContact CD1-CG 4.11Å; I21-L33 HydrophobicContact CG1-CD2 4.1Å; I21-L33 HydrophobicContact CG1-CG 3.91Å; I21-L33 WeakPolarHBondContact CG1-O 3.38Å; I21-L33 PolarHBondContact N-O 2.83Å
22	G	96.4	Very high	93.1	Very high	27 Å²	27	77 Å²	77	28%	0.278	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.8	148	178.8	0	0	0	0	0	112.5	V20 L33	V20-G22 VanDerWaalsContact CG1-O 3.26Å; V20-G22 WeakPolarHBondContact CG1-O 3.35Å; G22-L33 PolarHBondContact N-O 3.46Å; G22-L33 PolarHBondContact O-N 2.98Å
23	A	95.7	Very high	93.6	Very high	77 Å²	77	77.6 Å²	77.6	64%	0.636	42%	0.423	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-141.2	143.2	174.4	0	0	0	0	0	111.3	I31	A23-I31 CarbonylContact C-O 3.56Å; A23-I31 VanDerWaalsContact CA-O 3.23Å; A23-I31 WeakPolarHBondContact CA-O 3.45Å
24	A	97.1	Very high	94.1	Very high	53 Å²	53	75.6 Å²	75.6	44%	0.438	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.4	147.7	174.3	0	0	0	0	0	110.7	V30 I31	A24-V30 WeakPolarHBondContact O-CA 3.02Å; A24-I31 PolarHBondContact N-O 2.86Å; A24-I31 PolarHBondContact O-N 2.96Å
25	V	95.6	Very high	94.4	Very high	105 Å²	105	81 Å²	81	64%	0.636	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.7	124.8	174	178.9	0	0	0	0	108.7	V30 M43	V25-V30 HydrophobicContact CG2-CG2 4.4Å; V25-M43 HydrophobicContact CG1-CE 4.27Å; V25-M43 HydrophobicContact CG1-SD 4.03Å
26	C	95.1	Very high	94.7	Very high	78 Å²	78	80.6 Å²	80.6	53%	0.527	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	87	170.4	-176.5	0	0	0	0	107.2	Y29	C26-Y29 CarbonylContact C-O 3.59Å; C26-Y29 PolarHBondContact N-O 2.86Å; C26-Y29 WeakPolarHBondContact O-CA 3.23Å; C26-Y29 WeakPolarHBondContact O-CB 3.46Å; C26-Y29 PolarHBondContact O-N 2.9Å
27	F	94.1	Very high	95	Very high	158 Å²	158	79.1 Å²	79.1	69%	0.693	43%	0.432	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.5	130.1	-170.9	-179.1	-90.1	0	0	0	111.4
28	P	94.8	Very high	95.4	Very high	33 Å²	33	80.5 Å²	80.5	21%	0.214	44%	0.436	C	S	.	.	T	Hydrogen-bonded Turn	cis	-94	23.3	12.3	38.5	-38.2	0	0	0	115.3	M43 L44	P28-M43 VanDerWaalsContact O-CB 3.28Å; P28-M43 WeakPolarHBondContact O-CB 3.39Å; P28-M43 WeakPolarHBondContact O-CG 3.06Å; P28-M43 PolarHBondContact O-N 3.23Å; P28-L44 HydrophobicContact CB-CD1 4.06Å; P28-L44 HydrophobicContact CB-CD2 4.46Å; P28-L44 HydrophobicContact CB-CG 4.04Å
29	Y	95.8	Very high	95.9	Very high	99 Å²	99	71.9 Å²	71.9	39%	0.388	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	152.9	-173.6	-52.5	-73.9	0	0	0	113.8	C26 V40 H41 K49	C26-Y29 CarbonylContact C-O 3.59Å; C26-Y29 PolarHBondContact N-O 2.86Å; C26-Y29 WeakPolarHBondContact O-CA 3.23Å; C26-Y29 WeakPolarHBondContact O-CB 3.46Å; C26-Y29 PolarHBondContact O-N 2.9Å; Y29-V40 HydrophobicContact CD1-CG1 3.87Å; Y29-V40 HydrophobicContact CG-CG1 3.97Å; Y29-H41 CarbonylContact C-O 3.55Å; Y29-H41 VanDerWaalsContact CA-O 3.27Å; Y29-H41 WeakPolarHBondContact CA-O 3.47Å; Y29-K49 HydrophobicContact CE1-CG 4.26Å
30	V	95.7	Very high	96	Very high	15 Å²	15	68 Å²	68	9%	0.091	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.4	132.8	160	177	0	0	0	0	107.6	W16 A24 V25 H41 M43	W16-V30 HydrophobicContact CZ3-CG1 3.89Å; A24-V30 WeakPolarHBondContact O-CA 3.02Å; V25-V30 HydrophobicContact CG2-CG2 4.4Å; V30-H41 PolarHBondContact N-O 2.7Å; V30-H41 PolarHBondContact O-N 2.89Å; V30-M43 HydrophobicContact CG2-CE 4.26Å; V30-M43 HydrophobicContact CG2-CG 3.62Å; V30-M43 HydrophobicContact CG2-SD 3.86Å
31	I	96.8	Very high	96.1	Very high	60 Å²	60	65.9 Å²	65.9	31%	0.308	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.2	128	174.3	-57.7	166.6	0	0	0	106.7	A23 A24 I38 T39	A23-I31 CarbonylContact C-O 3.56Å; A23-I31 VanDerWaalsContact CA-O 3.23Å; A23-I31 WeakPolarHBondContact CA-O 3.45Å; A24-I31 PolarHBondContact N-O 2.86Å; A24-I31 PolarHBondContact O-N 2.96Å; I31-I38 HydrophobicContact CG2-CG2 3.56Å; I31-T39 WeakPolarHBondContact CA-O 3.27Å
32	A	96.9	Very high	95.9	Very high	0 Å²	0	60.2 Å²	60.2	0%	0	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	131.2	174.3	0	0	0	0	0	109.4	W16 V20 T39	W16-A32 HydrophobicContact CE3-CB 4.42Å; V20-A32 HydrophobicContact CG1-CB 4.2Å; V20-A32 HydrophobicContact CG2-CB 4.02Å; A32-T39 PolarHBondContact N-O 2.75Å; A32-T39 PolarHBondContact O-N 2.9Å
33	L	97.5	Very high	95.7	Very high	74 Å²	74	60.1 Å²	60.1	39%	0.387	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	125.5	175.1	173.4	69.3	0	0	0	108	V20 I21 G22 I38	V20-L33 CarbonylContact C-O 3.55Å; V20-L33 WeakPolarHBondContact CA-O 3.45Å; I21-L33 HydrophobicContact CD1-CD2 4.07Å; I21-L33 HydrophobicContact CD1-CG 4.11Å; I21-L33 HydrophobicContact CG1-CD2 4.1Å; I21-L33 HydrophobicContact CG1-CG 3.91Å; I21-L33 WeakPolarHBondContact CG1-O 3.38Å; I21-L33 PolarHBondContact N-O 2.83Å; G22-L33 PolarHBondContact N-O 3.46Å; G22-L33 PolarHBondContact O-N 2.98Å; L33-I38 HydrophobicContact CD1-CD1 4.44Å; L33-I38 HydrophobicContact CD1-CG1 3.69Å
34	D	95.9	Very high	95.5	Very high	16 Å²	16	62.4 Å²	62.4	9%	0.086	33%	0.328	C	S	.	.			trans	-112.2	-164.9	162.3	64.7	27.6	0	0	0	110.4	S17 N19 E36 F37	S17-D34 WeakPolarHBondContact CB-OD2 3.44Å; S17-D34 PolarHBondContact OG-OD2 2.75Å; N19-D34 WeakPolarHBondContact O-CB 3.43Å; D34-E36 VanDerWaalsContact C-N 3.28Å; D34-E36 PolarHBondContact O-N 3.32Å; D34-E36 PolarHBondContact OD1-N 2.8Å; D34-F37 PolarHBondContact N-O 2.9Å; D34-F37 VanDerWaalsContact N-O 3.11Å; D34-F37 PolarHBondContact OD1-N 2.83Å
35	D	95.1	Very high	95.3	Very high	127 Å²	127	63.4 Å²	63.4	68%	0.679	33%	0.326	S	S	*	.	S	Bend	trans	-73.2	-17.3	-177.2	58.8	-37.2	0	0	0	114.1
36	E	94.8	Very high	95.1	Very high	146 Å²	146	60 Å²	60	68%	0.682	30%	0.304	S	S	*	.	S	Bend	trans	-120.1	-36.9	-173.5	-164.1	176	-174	0	0	112.7	D34	D34-E36 VanDerWaalsContact C-N 3.28Å; D34-E36 PolarHBondContact O-N 3.32Å; D34-E36 PolarHBondContact OD1-N 2.8Å
37	F	95.5	Very high	95	Very high	81 Å²	81	61.8 Å²	61.8	36%	0.355	30%	0.304	S	S	.	.			trans	-134.2	156	-168.7	-60.8	-71.8	0	0	0	114.1	D34 T39 T51 L52	D34-F37 PolarHBondContact N-O 2.9Å; D34-F37 VanDerWaalsContact N-O 3.11Å; D34-F37 PolarHBondContact OD1-N 2.83Å; F37-T39 HydrophobicContact CB-CG2 4.49Å; F37-T51 HydrophobicContact CB-CG2 3.96Å; F37-T51 HydrophobicContact CD1-CG2 3.62Å; F37-T51 HydrophobicContact CE1-CG2 4.35Å; F37-T51 HydrophobicContact CG-CG2 3.88Å; F37-L52 WeakPolarHBondContact CA-O 3.34Å
38	I	96.8	Very high	95.1	Very high	71 Å²	71	59.2 Å²	59.2	36%	0.364	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	120.8	160.6	-61.2	171.6	0	0	0	108.2	I31 L33 T51 L52	I31-I38 HydrophobicContact CG2-CG2 3.56Å; L33-I38 HydrophobicContact CD1-CD1 4.44Å; L33-I38 HydrophobicContact CD1-CG1 3.69Å; I38-T51 CarbonylContact O-C 3.57Å; I38-T51 WeakPolarHBondContact O-CA 3.4Å; I38-L52 HydrophobicContact CB-CB 4.43Å; I38-L52 HydrophobicContact CB-CD1 4.48Å; I38-L52 HydrophobicContact CG2-CD1 4.44Å; I38-L52 PolarHBondContact N-O 2.84Å; I38-L52 PolarHBondContact O-N 2.76Å
39	T	97.5	Very high	95.2	Very high	13 Å²	13	62.7 Å²	62.7	8%	0.08	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	137.4	175.7	58.8	0	0	0	0	111.4	I31 A32 F37 H41 Q50 T51	I31-T39 WeakPolarHBondContact CA-O 3.27Å; A32-T39 PolarHBondContact N-O 2.75Å; A32-T39 PolarHBondContact O-N 2.9Å; F37-T39 HydrophobicContact CB-CG2 4.49Å; T39-H41 WeakPolarHBondContact CB-NE2 3.28Å; T39-H41 PolarHBondContact OG1-NE2 3.42Å; T39-Q50 WeakPolarHBondContact CA-O 3.36Å; T39-T51 HydrophobicContact CG2-CG2 4.25Å
40	V	97.4	Very high	95.2	Very high	22 Å²	22	63 Å²	63	13%	0.133	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	122.7	178.2	-176.3	0	0	0	0	108.7	Y29 Q48 K49 Q50	Y29-V40 HydrophobicContact CD1-CG1 3.87Å; Y29-V40 HydrophobicContact CG-CG1 3.97Å; V40-Q48 CarbonylContact O-C 3.39Å; V40-Q48 WeakPolarHBondContact O-CA 3.39Å; V40-K49 PolarHBondContact O-N 2.89Å; V40-Q50 HydrophobicContact CB-CB 4.09Å; V40-Q50 HydrophobicContact CG2-CB 4.18Å; V40-Q50 PolarHBondContact N-O 2.93Å; V40-Q50 PolarHBondContact O-N 3.45Å
41	H	95.9	Very high	95.3	Very high	2 Å²	2	65.3 Å²	65.3	1%	0.009	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.6	133.2	-178.1	-58.9	-88.2	0	0	0	110.3	V14 H15 Y29 V30 T39	V14-H41 HydrophobicContact CG1-CB 3.84Å; H15-H41 PolarHBondContact O-CE1 2.87Å; H15-H41 VanDerWaalsContact O-CE1 3.32Å; Y29-H41 CarbonylContact C-O 3.55Å; Y29-H41 VanDerWaalsContact CA-O 3.27Å; Y29-H41 WeakPolarHBondContact CA-O 3.47Å; V30-H41 PolarHBondContact N-O 2.7Å; V30-H41 PolarHBondContact O-N 2.89Å; T39-H41 WeakPolarHBondContact CB-NE2 3.28Å; T39-H41 PolarHBondContact OG1-NE2 3.42Å
42	S	94	Very high	95.3	Very high	7 Å²	7	68.8 Å²	68.8	5%	0.049	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.2	130	174.9	151.5	0	0	0	0	110.7	L44 D45 Q46 Q47 K49	S42-L44 PolarHBondContact O-N 3.25Å; S42-L44 PolarHBondContact OG-N 2.62Å; S42-D45 WeakPolarHBondContact CB-OD1 3.33Å; S42-D45 PolarHBondContact OG-N 2.66Å; S42-D45 PolarHBondContact OG-OD1 3.41Å; S42-Q46 WeakPolarHBondContact O-CA 3.01Å; S42-Q46 PolarHBondContact O-N 2.87Å; S42-Q47 PolarHBondContact N-O 3.32Å; S42-K49 VanDerWaalsContact CB-CE 3.41Å
43	M	91.6	Very high	95.2	Very high	26 Å²	26	72.3 Å²	72.3	13%	0.128	36%	0.361	C	S	.	.	T	Hydrogen-bonded Turn	trans	-76.8	-10.1	175.9	-60	171.7	79.3	0	0	112.6	F2 R11 V25 P28 V30	F2-M43 HydrophobicContact CE1-CE 3.3Å; F2-M43 HydrophobicContact CZ-CB 4.15Å; F2-M43 HydrophobicContact CZ-CE 3.31Å; F2-M43 HydrophobicContact CZ-CG 4Å; F2-M43 HydrophobicContact CZ-SD 4.48Å; R11-M43 PolarHBondContact NH1-O 3.23Å; V25-M43 HydrophobicContact CG1-CE 4.27Å; V25-M43 HydrophobicContact CG1-SD 4.03Å; P28-M43 VanDerWaalsContact O-CB 3.28Å; P28-M43 WeakPolarHBondContact O-CB 3.39Å; P28-M43 WeakPolarHBondContact O-CG 3.06Å; P28-M43 PolarHBondContact O-N 3.23Å; V30-M43 HydrophobicContact CG2-CE 4.26Å; V30-M43 HydrophobicContact CG2-CG 3.62Å; V30-M43 HydrophobicContact CG2-SD 3.86Å
44	L	91.7	Very high	95.1	Very high	124 Å²	124	72.2 Å²	72.2	65%	0.649	36%	0.36	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.6	-45.5	-177	-57.8	-179.9	0	0	0	111.2	P28 S42	P28-L44 HydrophobicContact CB-CD1 4.06Å; P28-L44 HydrophobicContact CB-CD2 4.46Å; P28-L44 HydrophobicContact CB-CG 4.04Å; S42-L44 PolarHBondContact O-N 3.25Å; S42-L44 PolarHBondContact OG-N 2.62Å
45	D	91.9	Very high	95	Very high	74 Å²	74	75.3 Å²	75.3	40%	0.396	38%	0.375	S	S	.	.	T	Hydrogen-bonded Turn	trans	-117.4	-2.2	-177.2	63.4	7.1	0	0	0	113.8	S42 Q47 K49	S42-D45 WeakPolarHBondContact CB-OD1 3.33Å; S42-D45 PolarHBondContact OG-N 2.66Å; S42-D45 PolarHBondContact OG-OD1 3.41Å; D45-Q47 HydrophobicContact CB-CG 4.42Å; D45-Q47 PolarHBondContact O-N 3.07Å; D45-Q47 PolarHBondContact OD1-N 3.5Å; D45-K49 WeakPolarHBondContact OD1-CE 3.34Å; D45-K49 IonicContact OD1-NZ 3.52Å; D45-K49 WeakPolarHBondContact OD2-CE 3.35Å; D45-K49 IonicContact OD2-NZ 2.66Å; D45-K49 PolarHBondContact OD2-NZ 2.73Å
46	Q	91.4	Very high	95	Very high	34 Å²	34	72.2 Å²	72.2	16%	0.159	36%	0.357	C	S	.	.			trans	63	22.6	175.1	-45.1	-173.7	147.7	0	0	114	A12 V14 S42	A12-Q46 PolarHBondContact O-NE2 3.49Å; A12-Q46 PolarHBondContact O-OE1 3.35Å; V14-Q46 HydrophobicContact CG2-CB 4.06Å; V14-Q46 HydrophobicContact CG2-CG 4.35Å; S42-Q46 WeakPolarHBondContact O-CA 3.01Å; S42-Q46 PolarHBondContact O-N 2.87Å
47	Q	93.5	Very high	95	Very high	116 Å²	116	67.6 Å²	67.6	54%	0.542	34%	0.337	S	S	.	.			trans	-98.3	143.9	178.4	-61.6	-58.6	-49.7	0	0	111.1	S42 D45 K49	S42-Q47 PolarHBondContact N-O 3.32Å; D45-Q47 HydrophobicContact CB-CG 4.42Å; D45-Q47 PolarHBondContact O-N 3.07Å; D45-Q47 PolarHBondContact OD1-N 3.5Å; Q47-K49 PolarHBondContact O-N 3.18Å
48	Q	95.6	Very high	95	Very high	104 Å²	104	66.7 Å²	66.7	49%	0.486	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.2	128.2	165.4	-173	176.5	-66.5	0	0	109.1	V40 T51	V40-Q48 CarbonylContact O-C 3.39Å; V40-Q48 WeakPolarHBondContact O-CA 3.39Å; Q48-T51 PolarHBondContact NE2-OG1 2.94Å
49	K	97.2	Very high	94.8	Very high	105 Å²	105	66.4 Å²	66.4	46%	0.457	33%	0.334	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	-27.4	-179.2	-59.5	-55.2	-177.6	-179.4	0	112.3	Y29 V40 S42 D45 Q47	Y29-K49 HydrophobicContact CE1-CG 4.26Å; V40-K49 PolarHBondContact O-N 2.89Å; S42-K49 VanDerWaalsContact CB-CE 3.41Å; D45-K49 WeakPolarHBondContact OD1-CE 3.34Å; D45-K49 IonicContact OD1-NZ 3.52Å; D45-K49 WeakPolarHBondContact OD2-CE 3.35Å; D45-K49 IonicContact OD2-NZ 2.66Å; D45-K49 PolarHBondContact OD2-NZ 2.73Å; Q47-K49 PolarHBondContact O-N 3.18Å
50	Q	97.4	Very high	94.6	Very high	105 Å²	105	70.5 Å²	70.5	49%	0.491	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.3	151.8	-178	-167.9	169.9	5.2	0	0	111.4	T39 V40 L52	T39-Q50 WeakPolarHBondContact CA-O 3.36Å; V40-Q50 HydrophobicContact CB-CB 4.09Å; V40-Q50 HydrophobicContact CG2-CB 4.18Å; V40-Q50 PolarHBondContact N-O 2.93Å; V40-Q50 PolarHBondContact O-N 3.45Å; Q50-L52 HydrophobicContact CG-CD1 3.92Å; Q50-L52 HydrophobicContact CG-CG 4.34Å
51	T	96.9	Very high	94.4	Very high	64 Å²	64	74.6 Å²	74.6	39%	0.393	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	134.8	165.4	-59.8	0	0	0	0	107.6	F37 I38 T39 Q48	F37-T51 HydrophobicContact CB-CG2 3.96Å; F37-T51 HydrophobicContact CD1-CG2 3.62Å; F37-T51 HydrophobicContact CE1-CG2 4.35Å; F37-T51 HydrophobicContact CG-CG2 3.88Å; I38-T51 CarbonylContact O-C 3.57Å; I38-T51 WeakPolarHBondContact O-CA 3.4Å; T39-T51 HydrophobicContact CG2-CG2 4.25Å; Q48-T51 PolarHBondContact NE2-OG1 2.94Å
52	L	95.8	Very high	94.3	Very high	134 Å²	134	81.2 Å²	81.2	70%	0.702	41%	0.405	S	S	*	.			trans	-121.2	0	171.4	-59.5	101.2	0	0	0	109.8	F37 I38 Q50	F37-L52 WeakPolarHBondContact CA-O 3.34Å; I38-L52 HydrophobicContact CB-CB 4.43Å; I38-L52 HydrophobicContact CB-CD1 4.48Å; I38-L52 HydrophobicContact CG2-CD1 4.44Å; I38-L52 PolarHBondContact N-O 2.84Å; I38-L52 PolarHBondContact O-N 2.76Å; Q50-L52 HydrophobicContact CG-CD1 3.92Å; Q50-L52 HydrophobicContact CG-CG 4.34Å

Retrieved 52 of 52 residues in 69.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).