A0A087WQZ9_MOUSE Loading...

Lymphocyte antigen 96

AlphaFold DB , UniProt , Accession A0A087WQZ9, Species MOUSE (Mus musculus, Mouse), Gene Ly96, Length 142 aa.

						>A0A087WQZ9_MOUSE|A0A087WQZ9|Ly96
MLPFILFSTLLSPILTESEKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPKLPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.9	Very low	46.7	Very low	233 Å²	233	158.8 Å²	158.8	100%	1.148	83%	0.828	S	S	*	*				0	99.3	0	-49.6	-171.3	-61.9	0	0	104.9
2	L	38.7	Very low	46.8	Very low	167 Å²	167	152.6 Å²	152.6	87%	0.874	81%	0.808	S	S	*	*				60.1	140.1	78.3	-104.1	79.5	0	0	0	112.9
3	P	49.4	Very low	46.9	Very low	92 Å²	92	149.6 Å²	149.6	60%	0.597	80%	0.803	S	S	*	*				-132.2	164.4	-104.7	33.6	-15.5	0	0	0	114.8	I5	P3-I5 HydrophobicContact CG-CG1 4.14Å; P3-I5 PolarHBondContact O-N 3.44Å
4	F	44	Very low	47.3	Very low	214 Å²	214	149.9 Å²	149.9	94%	0.939	80%	0.802	S	S	*	*			trans	-73	95	165.7	-78.8	-87.8	0	0	0	110.1
5	I	51.5	Low	47.1	Very low	137 Å²	137	150.5 Å²	150.5	70%	0.703	80%	0.804	S	S	*	*			trans	-77.3	131.8	172.8	-66	-179.6	0	0	0	109.2	P3	P3-I5 HydrophobicContact CG-CG1 4.14Å; P3-I5 PolarHBondContact O-N 3.44Å
6	L	51.6	Low	46.8	Very low	157 Å²	157	148.6 Å²	148.6	82%	0.822	80%	0.8	S	S	*	*			trans	-69.3	130.4	175.8	-63.1	80.1	0	0	0	109.9
7	F	48.9	Very low	46.8	Very low	198 Å²	198	148.5 Å²	148.5	87%	0.868	79%	0.793	S	S	*	*			trans	-153	105.1	161	-133.1	-85.6	0	0	0	112.1
8	S	45.3	Very low	46.9	Very low	102 Å²	102	146.1 Å²	146.1	71%	0.713	79%	0.79	S	S	*	*	S	Bend	trans	-177.3	138.4	131.5	-82.6	0	0	0	0	112.3
9	T	49.7	Very low	47.5	Very low	119 Å²	119	142.5 Å²	142.5	73%	0.73	77%	0.767	S	S	*	*			trans	49.6	82.2	153.7	57	0	0	0	0	117.8	L11	T9-L11 PolarHBondContact O-N 3.34Å
10	L	44.2	Very low	48.4	Very low	178 Å²	178	144 Å²	144	93%	0.932	77%	0.766	S	S	*	*			trans	-63.4	69.3	138.2	-80.4	163.8	0	0	0	109.3	S12	L10-S12 VanDerWaalsContact C-N 3.31Å; L10-S12 PolarHBondContact O-N 2.88Å
11	L	48.4	Very low	49.1	Very low	150 Å²	150	142.1 Å²	142.1	79%	0.785	75%	0.753	S	S	*	*			trans	-90.2	75.4	170.9	-165.6	74.3	0	0	0	108.2	T9 P13	T9-L11 PolarHBondContact O-N 3.34Å; L11-P13 WeakPolarHBondContact O-CD 2.95Å
12	S	47.8	Very low	50.6	Low	84 Å²	84	134.8 Å²	134.8	59%	0.587	72%	0.716	S	S	*	*			trans	-52.6	123	168.4	-59.2	0	0	0	0	108.3	L10 I14	L10-S12 VanDerWaalsContact C-N 3.31Å; L10-S12 PolarHBondContact O-N 2.88Å; S12-I14 PolarHBondContact O-N 3.14Å
13	P	48.1	Very low	52.6	Low	114 Å²	114	129.4 Å²	129.4	74%	0.74	68%	0.684	S	S	*	*			trans	-63.2	110.3	170.2	26.2	-31.6	0	0	0	106.9	L11 L15	L11-P13 WeakPolarHBondContact O-CD 2.95Å; P13-L15 PolarHBondContact O-N 3.06Å
14	I	53.4	Low	54.5	Low	154 Å²	154	130.1 Å²	130.1	79%	0.79	68%	0.678	S	S	*	*			trans	-67.4	90.9	165.4	-60.1	176.6	0	0	0	104.8	S12 T16	S12-I14 PolarHBondContact O-N 3.14Å; I14-T16 PolarHBondContact O-N 2.83Å
15	L	43.4	Very low	56.7	Low	159 Å²	159	120.5 Å²	120.5	83%	0.832	64%	0.638	S	S	*	*			trans	-71.2	87	173	-158.6	82.8	0	0	0	105.9	P13 E17	P13-L15 PolarHBondContact O-N 3.06Å; L15-E17 PolarHBondContact O-N 2.71Å
16	T	43.2	Very low	58.7	Low	120 Å²	120	118.2 Å²	118.2	74%	0.736	63%	0.627	S	S	*	*			trans	-55.2	106.4	176.8	-52.1	0	0	0	0	107.6	I14 S18	I14-T16 PolarHBondContact O-N 2.83Å; T16-S18 VanDerWaalsContact C-N 3.34Å; T16-S18 PolarHBondContact O-N 3.26Å
17	E	45.5	Very low	60.5	Low	146 Å²	146	111.5 Å²	111.5	68%	0.682	59%	0.593	S	S	*	*			trans	-62.7	98.9	178.3	-176.3	-175.2	-132.7	0	0	106.9	L15 E19 K41	L15-E17 PolarHBondContact O-N 2.71Å; E17-E19 PolarHBondContact O-N 2.75Å; E17-E19 VanDerWaalsContact O-N 3.12Å; E17-K41 IonicContact OE2-NZ 3.94Å; E17-K41 PolarHBondContact OE2-NZ 2.88Å
18	S	49.8	Very low	62.5	Low	105 Å²	105	106 Å²	106	73%	0.734	58%	0.579	S	S	*	*			trans	-52.5	122.3	178.1	179.1	0	0	0	0	108.2	T16 K20	T16-S18 VanDerWaalsContact C-N 3.34Å; T16-S18 PolarHBondContact O-N 3.26Å; S18-K20 PolarHBondContact O-N 2.69Å
19	E	58.7	Low	64.6	Low	78 Å²	78	101.2 Å²	101.2	36%	0.364	55%	0.545	S	S	.	.			trans	-47.2	114.4	-179.8	-82.1	-155	143.1	0	0	109.2	E17 Q21 S35	E17-E19 PolarHBondContact O-N 2.75Å; E17-E19 VanDerWaalsContact O-N 3.12Å; E19-Q21 PolarHBondContact O-N 2.78Å; E19-S35 WeakPolarHBondContact OE2-CB 3.16Å; E19-S35 PolarHBondContact OE2-OG 3.03Å
20	K	64	Low	66.5	Low	172 Å²	172	95.6 Å²	95.6	75%	0.748	51%	0.511	S	S	*	.			trans	-73.5	99.3	-176	-170.4	178.7	-179.4	-176.9	0	107.9	S18 Q22	S18-K20 PolarHBondContact O-N 2.69Å; K20-Q22 PolarHBondContact O-N 3.36Å
21	Q	63.2	Low	68.8	Low	105 Å²	105	88.7 Å²	88.7	49%	0.491	47%	0.474	S	S	.	.			trans	-52.6	109.4	174.1	-174.4	-179.6	-29.7	0	0	108.9	E19	E19-Q21 PolarHBondContact O-N 2.78Å
22	Q	74.8	Confident	70.9	Confident	80 Å²	80	81.9 Å²	81.9	37%	0.374	44%	0.439	S	S	.	.			trans	-81.2	-29.9	-162.5	179.3	62.6	22.1	0	0	111.7	K20 Y34 Y36	K20-Q22 PolarHBondContact O-N 3.36Å; Q22-Y34 HydrophobicContact CB-CD2 4.11Å; Q22-Y34 HydrophobicContact CB-CE2 3.68Å; Q22-Y34 HydrophobicContact CG-CE2 3.73Å; Q22-Y34 PolarHBondContact N-O 3.1Å; Q22-Y36 HydrophobicContact CB-CD2 4.49Å; Q22-Y36 HydrophobicContact CB-CE2 4.08Å; Q22-Y36 HydrophobicContact CG-CE2 3.79Å
23	W	80.3	Confident	73	Confident	53 Å²	53	78.6 Å²	78.6	20%	0.201	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.9	158.2	176.7	-179.9	76.1	0	0	0	111.4	C25 I32 S33 Y34 S48	W23-C25 HydrophobicContact CH2-CB 3.72Å; W23-C25 WeakPolarHBondContact CH2-SG 3.21Å; W23-C25 HydrophobicContact CZ2-CB 3.52Å; W23-C25 HydrophobicContact CZ3-CB 4.47Å; W23-I32 HydrophobicContact CZ3-CB 4.46Å; W23-I32 HydrophobicContact CZ3-CG2 3.98Å; W23-S33 WeakPolarHBondContact O-CA 3.44Å; W23-S33 VanDerWaalsContact O-CB 3.25Å; W23-S33 WeakPolarHBondContact O-CB 3.17Å; W23-Y34 HydrophobicContact CB-CD1 4.09Å; W23-Y34 HydrophobicContact CB-CE1 3.47Å; W23-Y34 VanDerWaalsContact CB-CE1 3.47Å; W23-Y34 HydrophobicContact CD2-CE1 4.11Å; W23-Y34 AromaticContact CE3-CD1 3.84Å; W23-Y34 HydrophobicContact CE3-CD1 3.84Å; W23-Y34 AromaticContact CE3-CE1 3.76Å; W23-Y34 HydrophobicContact CE3-CE1 3.76Å; W23-Y34 HydrophobicContact CG-CE1 4.06Å; W23-Y34 PolarHBondContact O-N 3.04Å; W23-S48 WeakPolarHBondContact CH2-OG 3.48Å
24	F	89.7	Confident	74.9	Confident	107 Å²	107	73.3 Å²	73.3	47%	0.469	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.9	137	-179.9	173.6	-92.7	0	0	0	109.5	N26 I31 I32	F24-N26 HydrophobicContact CE1-CB 3.95Å; F24-N26 HydrophobicContact CZ-CB 4.23Å; F24-I31 HydrophobicContact CD2-CG2 3.99Å; F24-I31 HydrophobicContact CE2-CG2 3.28Å; F24-I31 HydrophobicContact CZ-CG2 3.85Å; F24-I32 CarbonylContact C-O 3.57Å; F24-I32 WeakPolarHBondContact CA-O 3.37Å
25	C	90.3	Very high	76.6	Confident	13 Å²	13	66.7 Å²	66.7	9%	0.088	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138	153.3	165.2	91.3	0	0	0	0	111.8	W23 I32 C51	W23-C25 HydrophobicContact CH2-CB 3.72Å; W23-C25 WeakPolarHBondContact CH2-SG 3.21Å; W23-C25 HydrophobicContact CZ2-CB 3.52Å; W23-C25 HydrophobicContact CZ3-CB 4.47Å; C25-I32 PolarHBondContact N-O 2.98Å; C25-I32 PolarHBondContact O-N 2.79Å; C25-C51 HydrophobicContact CB-CB 3.6Å; C25-C51 WeakPolarHBondContact CB-SG 3.2Å; C25-C51 VanDerWaalsContact SG-CA 3.57Å; C25-C51 WeakPolarHBondContact SG-CB 3.39Å; C25-C51 CovalentContact SG-SG 2.03Å; C25-C51 PolarHBondContact SG-SG 2.89Å
26	N	92	Very high	78.5	Confident	89 Å²	89	60.8 Å²	60.8	48%	0.476	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	117.7	-175.1	-175.7	-25.6	0	0	0	108	F24 C51 R138	F24-N26 HydrophobicContact CE1-CB 3.95Å; F24-N26 HydrophobicContact CZ-CB 4.23Å; N26-C51 PolarHBondContact N-SG 3.32Å; N26-R138 PolarHBondContact OD1-NH1 2.75Å; N26-R138 PolarHBondContact OD1-NH2 3.05Å
27	S	91	Very high	80.4	Confident	16 Å²	16	56.3 Å²	56.3	11%	0.112	29%	0.289	C	S	.	.			trans	-111	-172.2	176.7	75	0	0	0	0	110.6	A30 I52 R138	S27-A30 PolarHBondContact N-O 2.88Å; S27-A30 PolarHBondContact OG-N 2.65Å; S27-A30 PolarHBondContact OG-O 3.22Å; S27-I52 WeakPolarHBondContact CB-O 3.32Å; S27-I52 PolarHBondContact OG-O 3.29Å; S27-R138 PolarHBondContact O-NH2 3.26Å
28	S	90.2	Very high	81.3	Confident	81 Å²	81	54.9 Å²	54.9	57%	0.566	29%	0.286	S	S	*	.	S	Bend	trans	-74.6	-23.4	-178.1	50.2	0	0	0	0	114.7	R53	S28-R53 PolarHBondContact OG-NE 3.49Å
29	D	88.6	Confident	82.2	Confident	3 Å²	3	58.3 Å²	58.3	2%	0.016	29%	0.29	C	S	.	.	S	Bend	trans	-120.7	-22.2	178.9	55.4	26.9	0	0	0	113.8	R53 L54 R55 H137 R138 R139	D29-R53 WeakPolarHBondContact OD1-CA 3.02Å; D29-L54 PolarHBondContact OD1-N 3.07Å; D29-L54 PolarHBondContact OD2-N 3.26Å; D29-R55 PolarHBondContact OD2-N 3.02Å; D29-H137 PolarHBondContact O-CD2 3.25Å; D29-R138 PolarHBondContact O-N 3.48Å; D29-R139 PolarHBondContact O-N 2.74Å
30	A	89.9	Confident	82.3	Confident	0 Å²	0	56.4 Å²	56.4	0%	0	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	158.2	-175.2	0	0	0	0	0	113.6	S27 I32 L54 I136 R138	S27-A30 PolarHBondContact N-O 2.88Å; S27-A30 PolarHBondContact OG-N 2.65Å; S27-A30 PolarHBondContact OG-O 3.22Å; A30-I32 HydrophobicContact CB-CG1 4.43Å; A30-L54 HydrophobicContact CB-CD1 3.79Å; A30-L54 HydrophobicContact CB-CG 3.91Å; A30-I136 CarbonylContact C-O 3.55Å; A30-I136 WeakPolarHBondContact CA-O 3.39Å; A30-R138 PolarHBondContact O-NH2 2.04Å
31	I	92.3	Very high	82.2	Confident	33 Å²	33	54.8 Å²	54.8	17%	0.169	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	134.2	158.5	-63.4	174	0	0	0	106.1	F24 I135 I136	F24-I31 HydrophobicContact CD2-CG2 3.99Å; F24-I31 HydrophobicContact CE2-CG2 3.28Å; F24-I31 HydrophobicContact CZ-CG2 3.85Å; I31-I135 CarbonylContact O-C 3.45Å; I31-I135 WeakPolarHBondContact O-CA 3.2Å; I31-I136 HydrophobicContact CB-CB 4.29Å; I31-I136 PolarHBondContact N-O 2.72Å; I31-I136 PolarHBondContact O-N 3.18Å
32	I	92.1	Very high	82.3	Confident	8 Å²	8	53.2 Å²	53.2	4%	0.041	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.7	137.3	179.7	-54.2	-172.2	0	0	0	109.3	W23 F24 C25 A30 I52 F133 T134 I135	W23-I32 HydrophobicContact CZ3-CB 4.46Å; W23-I32 HydrophobicContact CZ3-CG2 3.98Å; F24-I32 CarbonylContact C-O 3.57Å; F24-I32 WeakPolarHBondContact CA-O 3.37Å; C25-I32 PolarHBondContact N-O 2.98Å; C25-I32 PolarHBondContact O-N 2.79Å; A30-I32 HydrophobicContact CB-CG1 4.43Å; I32-I52 HydrophobicContact CD1-CB 3.71Å; I32-I52 HydrophobicContact CD1-CD1 4.28Å; I32-I52 HydrophobicContact CD1-CG2 4.1Å; I32-F133 HydrophobicContact CG2-CD1 4.37Å; I32-T134 WeakPolarHBondContact CA-O 3.37Å; I32-I135 HydrophobicContact CD1-CG1 4.41Å; I32-I135 HydrophobicContact CG1-CG1 4.16Å; I32-I135 HydrophobicContact CG1-CG2 4.25Å; I32-I135 HydrophobicContact CG2-CG1 4.11Å
33	S	92.3	Very high	82.1	Confident	15 Å²	15	54.3 Å²	54.3	11%	0.105	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148	168.2	171.1	58.7	0	0	0	0	110.9	W23 F133 T134	W23-S33 WeakPolarHBondContact O-CA 3.44Å; W23-S33 VanDerWaalsContact O-CB 3.25Å; W23-S33 WeakPolarHBondContact O-CB 3.17Å; S33-F133 CarbonylContact O-C 3.53Å; S33-F133 VanDerWaalsContact O-CA 3.31Å; S33-F133 WeakPolarHBondContact O-CA 2.9Å; S33-T134 PolarHBondContact N-O 2.77Å; S33-T134 PolarHBondContact O-N 3.33Å
34	Y	89.3	Confident	81.9	Confident	2 Å²	2	51.9 Å²	51.9	1%	0.008	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	150.4	164.2	63.7	-96	0	0	0	112.1	Q22 W23 I46 L131 N132 F133	Q22-Y34 HydrophobicContact CB-CD2 4.11Å; Q22-Y34 HydrophobicContact CB-CE2 3.68Å; Q22-Y34 HydrophobicContact CG-CE2 3.73Å; Q22-Y34 PolarHBondContact N-O 3.1Å; W23-Y34 HydrophobicContact CB-CD1 4.09Å; W23-Y34 HydrophobicContact CB-CE1 3.47Å; W23-Y34 VanDerWaalsContact CB-CE1 3.47Å; W23-Y34 HydrophobicContact CD2-CE1 4.11Å; W23-Y34 AromaticContact CE3-CD1 3.84Å; W23-Y34 HydrophobicContact CE3-CD1 3.84Å; W23-Y34 AromaticContact CE3-CE1 3.76Å; W23-Y34 HydrophobicContact CE3-CE1 3.76Å; W23-Y34 HydrophobicContact CG-CE1 4.06Å; W23-Y34 PolarHBondContact O-N 3.04Å; Y34-I46 HydrophobicContact CE1-CB 4.03Å; Y34-I46 WeakPolarHBondContact CE1-O 3.12Å; Y34-I46 PolarHBondContact OH-N 2.03Å; Y34-I46 PolarHBondContact OH-O 3.35Å; Y34-L131 HydrophobicContact CD2-CD1 4.49Å; Y34-L131 HydrophobicContact CD2-CD2 3.79Å; Y34-L131 HydrophobicContact CE2-CD1 4.47Å; Y34-L131 HydrophobicContact CE2-CD2 3.92Å; Y34-N132 WeakPolarHBondContact CA-O 3.19Å; Y34-F133 HydrophobicContact CD1-CD1 4.06Å; Y34-F133 AromaticContact CD1-CE1 3.52Å; Y34-F133 HydrophobicContact CD1-CE1 3.52Å; Y34-F133 HydrophobicContact CD1-CZ 4Å; Y34-F133 HydrophobicContact CE1-CE1 4.33Å; Y34-F133 HydrophobicContact CG-CD1 4.36Å; Y34-F133 HydrophobicContact CG-CE1 4.09Å; Y34-F133 HydrophobicContact CG-CZ 4.37Å
35	S	87.4	Confident	81.4	Confident	15 Å²	15	49.4 Å²	49.4	11%	0.105	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	162.5	156.6	58.5	0	0	0	0	109.9	E19 N132	E19-S35 WeakPolarHBondContact OE2-CB 3.16Å; E19-S35 PolarHBondContact OE2-OG 3.03Å; S35-N132 PolarHBondContact N-O 3.19Å; S35-N132 PolarHBondContact O-N 2.92Å
36	Y	84.6	Confident	81.2	Confident	35 Å²	35	50 Å²	50	14%	0.137	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68	150.2	158.9	-65.3	-75.2	0	0	0	109	Q22 F42 I44 L131	Q22-Y36 HydrophobicContact CB-CD2 4.49Å; Q22-Y36 HydrophobicContact CB-CE2 4.08Å; Q22-Y36 HydrophobicContact CG-CE2 3.79Å; Y36-F42 WeakPolarHBondContact CE1-O 3.34Å; Y36-F42 PolarHBondContact OH-O 3.21Å; Y36-I44 HydrophobicContact CE1-CG2 3.76Å; Y36-I44 PolarHBondContact OH-N 3.05Å; Y36-I44 PolarHBondContact OH-O 3.18Å; Y36-I44 VanDerWaalsContact OH-O 3.09Å; Y36-L131 HydrophobicContact CD1-CD2 3.78Å; Y36-L131 HydrophobicContact CE1-CD2 3.94Å
37	C	82.1	Confident	81	Confident	26 Å²	26	47.5 Å²	47.5	18%	0.176	26%	0.259	C	S	.	.			trans	-72.7	134.4	166.9	-46.2	0	0	0	0	109.9	H39 L40 C130	C37-H39 PolarHBondContact O-N 3.19Å; C37-L40 PolarHBondContact O-N 2.95Å; C37-C130 HydrophobicContact CB-CB 3.6Å; C37-C130 WeakPolarHBondContact CB-SG 3.47Å; C37-C130 PolarHBondContact N-O 2.72Å; C37-C130 WeakPolarHBondContact SG-CB 3.5Å; C37-C130 PolarHBondContact SG-O 2.76Å; C37-C130 VanDerWaalsContact SG-O 3.35Å; C37-C130 CovalentContact SG-SG 2.03Å; C37-C130 PolarHBondContact SG-SG 2.68Å
38	D	65.1	Low	80.9	Confident	116 Å²	116	47.4 Å²	47.4	62%	0.62	26%	0.258	S	S	*	.	T	Hydrogen-bonded Turn	trans	-30.1	-37.6	-175.7	-79.2	-68.9	0	0	0	117.7
39	H	68.1	Low	80.9	Confident	177 Å²	177	50 Å²	50	82%	0.819	26%	0.261	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.7	-8.7	-168.8	-53	-30	0	0	0	115.2	C37	C37-H39 PolarHBondContact O-N 3.19Å
40	L	61.2	Low	81.1	Confident	39 Å²	39	53.2 Å²	53.2	20%	0.204	28%	0.283	C	S	.	.			trans	-136.4	68.9	-169.5	-76.3	149.7	0	0	0	112.7	C37 F42 K127 C130	C37-L40 PolarHBondContact O-N 2.95Å; L40-F42 HydrophobicContact CD2-CD2 4.37Å; L40-F42 HydrophobicContact CD2-CE2 3.61Å; L40-F42 HydrophobicContact CD2-CZ 4.36Å; L40-F42 PolarHBondContact O-N 3.32Å; L40-K127 HydrophobicContact CD1-CB 3.57Å; L40-K127 HydrophobicContact CD1-CD 3.54Å; L40-K127 HydrophobicContact CD1-CG 4.13Å; L40-K127 HydrophobicContact CD2-CB 3.99Å; L40-K127 HydrophobicContact CG-CB 4.44Å; L40-C130 HydrophobicContact CB-CB 4.46Å; L40-C130 HydrophobicContact CD1-CB 4.32Å
41	K	61.6	Low	81.2	Confident	137 Å²	137	54.3 Å²	54.3	60%	0.596	29%	0.29	S	S	*	.			trans	-82.1	81.5	176.1	-63.2	-179	-179.8	178.4	0	111.6	E17	E17-K41 IonicContact OE2-NZ 3.94Å; E17-K41 PolarHBondContact OE2-NZ 2.88Å
42	F	66.3	Low	81.1	Confident	73 Å²	73	54.6 Å²	54.6	32%	0.32	29%	0.291	S	S	.	.			trans	-102.5	144.8	166.7	-64.9	-63.5	0	0	0	110.7	Y36 L40 I44 K68 L128	Y36-F42 WeakPolarHBondContact CE1-O 3.34Å; Y36-F42 PolarHBondContact OH-O 3.21Å; L40-F42 HydrophobicContact CD2-CD2 4.37Å; L40-F42 HydrophobicContact CD2-CE2 3.61Å; L40-F42 HydrophobicContact CD2-CZ 4.36Å; L40-F42 PolarHBondContact O-N 3.32Å; F42-I44 PolarHBondContact O-N 3.2Å; F42-K68 VanDerWaalsContact CZ-NZ 3.32Å; F42-L128 WeakPolarHBondContact CD2-O 3.31Å
43	P	69.3	Low	80.9	Confident	102 Å²	102	59.6 Å²	59.6	66%	0.662	31%	0.31	S	S	*	.			trans	-72.5	100.4	-179.8	29.7	-34	0	0	0	111.2
44	I	76.3	Confident	80.6	Confident	3 Å²	3	59.4 Å²	59.4	2%	0.015	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	125.3	168.3	172.1	163.4	0	0	0	109.7	Y36 F42 I46 V63 E64 F65 F129 L131	Y36-I44 HydrophobicContact CE1-CG2 3.76Å; Y36-I44 PolarHBondContact OH-N 3.05Å; Y36-I44 PolarHBondContact OH-O 3.18Å; Y36-I44 VanDerWaalsContact OH-O 3.09Å; F42-I44 PolarHBondContact O-N 3.2Å; I44-I46 HydrophobicContact CD1-CD1 3.99Å; I44-I46 HydrophobicContact CD1-CG1 4.05Å; I44-I46 HydrophobicContact CG1-CD1 4.34Å; I44-I46 HydrophobicContact CG1-CG1 3.88Å; I44-V63 HydrophobicContact CD1-CG1 4.34Å; I44-E64 WeakPolarHBondContact CA-O 3.3Å; I44-F65 HydrophobicContact CB-CB 3.85Å; I44-F65 HydrophobicContact CD1-CB 4.01Å; I44-F65 HydrophobicContact CD1-CG 4.2Å; I44-F65 HydrophobicContact CG1-CB 3.87Å; I44-F129 HydrophobicContact CD1-CD1 3.8Å; I44-F129 HydrophobicContact CD1-CD2 4.27Å; I44-F129 HydrophobicContact CD1-CE1 3.56Å; I44-F129 HydrophobicContact CD1-CE2 4.06Å; I44-F129 HydrophobicContact CD1-CG 4.15Å; I44-F129 HydrophobicContact CD1-CZ 3.69Å; I44-F129 HydrophobicContact CG2-CB 4.08Å; I44-F129 HydrophobicContact CG2-CG 4.24Å; I44-L131 HydrophobicContact CG2-CD2 4.11Å
45	S	80.4	Confident	80.5	Confident	54 Å²	54	64.4 Å²	64.4	38%	0.378	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	121.7	173.2	-164.1	0	0	0	0	108.9	V63 E64	S45-V63 WeakPolarHBondContact O-CA 3.46Å; S45-E64 PolarHBondContact N-O 3.22Å; S45-E64 PolarHBondContact O-N 3.1Å
46	I	84.5	Confident	80.4	Confident	25 Å²	25	64.4 Å²	64.4	13%	0.128	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	131.7	170.7	-54.5	-170.6	0	0	0	107.7	Y34 I44 V61 H62 V63 L131 F133	Y34-I46 HydrophobicContact CE1-CB 4.03Å; Y34-I46 WeakPolarHBondContact CE1-O 3.12Å; Y34-I46 PolarHBondContact OH-N 2.03Å; Y34-I46 PolarHBondContact OH-O 3.35Å; I44-I46 HydrophobicContact CD1-CD1 3.99Å; I44-I46 HydrophobicContact CD1-CG1 4.05Å; I44-I46 HydrophobicContact CG1-CD1 4.34Å; I44-I46 HydrophobicContact CG1-CG1 3.88Å; I46-V61 HydrophobicContact CG2-CG1 3.6Å; I46-H62 WeakPolarHBondContact CA-O 3.35Å; I46-V63 HydrophobicContact CG1-CG1 4.39Å; I46-L131 HydrophobicContact CD1-CD1 3.47Å; I46-L131 VanDerWaalsContact CD1-CD1 3.47Å; I46-L131 HydrophobicContact CG1-CD1 4.19Å; I46-F133 HydrophobicContact CD1-CZ 4.42Å
47	S	88.9	Confident	80.6	Confident	37 Å²	37	63.2 Å²	63.2	26%	0.259	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.6	161.6	168.7	69.8	0	0	0	0	110.6	V61 H62	S47-V61 CarbonylContact O-C 3.4Å; S47-V61 VanDerWaalsContact O-CA 3.32Å; S47-V61 WeakPolarHBondContact O-CA 3.3Å; S47-V61 WeakPolarHBondContact O-CG1 3.39Å; S47-H62 PolarHBondContact N-O 3.1Å; S47-H62 PolarHBondContact O-N 2.82Å
48	S	88.8	Confident	81	Confident	14 Å²	14	67.2 Å²	67.2	10%	0.098	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	129.1	176.9	66.6	0	0	0	0	111.1	W23 P50 C51 F60	W23-S48 WeakPolarHBondContact CH2-OG 3.48Å; S48-P50 CarbonylContact C-O 3.55Å; S48-P50 CarbonylContact O-C 3.58Å; S48-P50 VanDerWaalsContact O-C 3.3Å; S48-P50 PolarHBondContact OG-O 2.86Å; S48-C51 PolarHBondContact O-N 2.94Å; S48-F60 CarbonylContact C-O 3.49Å; S48-F60 WeakPolarHBondContact CA-O 3.47Å
49	E	90.4	Very high	82.3	Confident	135 Å²	135	62.2 Å²	62.2	63%	0.631	32%	0.321	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119	117.9	172.3	-169.5	167.4	174.8	0	0	110.9	G59 F60	E49-G59 CarbonylContact O-C 3.3Å; E49-G59 WeakPolarHBondContact O-CA 3.08Å; E49-F60 PolarHBondContact N-O 3.11Å; E49-F60 PolarHBondContact O-N 2.91Å
50	P	92.4	Very high	83.2	Confident	71 Å²	71	58.8 Å²	58.8	46%	0.461	30%	0.304	S	S	.	.	S	Bend	cis	-69.9	170.8	-9.7	33	-37.2	0	0	0	112.7	S48 I52 T57 N58	S48-P50 CarbonylContact C-O 3.55Å; S48-P50 CarbonylContact O-C 3.58Å; S48-P50 VanDerWaalsContact O-C 3.3Å; S48-P50 PolarHBondContact OG-O 2.86Å; P50-I52 PolarHBondContact O-N 2.8Å; P50-T57 HydrophobicContact CG-CG2 4.18Å; P50-N58 WeakPolarHBondContact CD-O 3.01Å
51	C	91.3	Very high	84.5	Confident	24 Å²	24	58.4 Å²	58.4	16%	0.162	30%	0.303	C	S	.	.	P	Polyproline II helix	trans	-59.9	131.8	171.2	-179.8	0	0	0	0	111.6	C25 N26 S48 R53	C25-C51 HydrophobicContact CB-CB 3.6Å; C25-C51 WeakPolarHBondContact CB-SG 3.2Å; C25-C51 VanDerWaalsContact SG-CA 3.57Å; C25-C51 WeakPolarHBondContact SG-CB 3.39Å; C25-C51 CovalentContact SG-SG 2.03Å; C25-C51 PolarHBondContact SG-SG 2.89Å; N26-C51 PolarHBondContact N-SG 3.32Å; S48-C51 PolarHBondContact O-N 2.94Å; C51-R53 PolarHBondContact O-N 3.08Å
52	I	90.1	Very high	85.6	Confident	38 Å²	38	54.5 Å²	54.5	20%	0.195	29%	0.287	C	S	.	.	P	Polyproline II helix	trans	-59.6	128.1	-173.6	-63.8	163.9	0	0	0	112.2	S27 I32 P50 F101 F103	S27-I52 WeakPolarHBondContact CB-O 3.32Å; S27-I52 PolarHBondContact OG-O 3.29Å; I32-I52 HydrophobicContact CD1-CB 3.71Å; I32-I52 HydrophobicContact CD1-CD1 4.28Å; I32-I52 HydrophobicContact CD1-CG2 4.1Å; P50-I52 PolarHBondContact O-N 2.8Å; I52-F101 HydrophobicContact CD1-CE2 4.28Å; I52-F101 HydrophobicContact CD1-CZ 4.27Å; I52-F101 HydrophobicContact CG1-CE2 3.8Å; I52-F101 HydrophobicContact CG1-CZ 3.64Å; I52-F103 HydrophobicContact CG2-CE1 3.66Å; I52-F103 HydrophobicContact CG2-CZ 3.63Å
53	R	89.8	Confident	86.5	Confident	114 Å²	114	51.9 Å²	51.9	43%	0.43	28%	0.277	S	S	.	.	P	Polyproline II helix	trans	-101.2	129.7	167.6	-62.7	169.3	62.5	-158.5	-4.2	109.7	S28 D29 C51 R55 G56 T57 F103	S28-R53 PolarHBondContact OG-NE 3.49Å; D29-R53 WeakPolarHBondContact OD1-CA 3.02Å; C51-R53 PolarHBondContact O-N 3.08Å; R53-R55 PolarHBondContact O-N 2.66Å; R53-G56 CarbonylContact O-C 3.59Å; R53-G56 PolarHBondContact O-N 2.69Å; R53-T57 WeakPolarHBondContact CA-OG1 3.44Å; R53-T57 PolarHBondContact N-OG1 2.88Å; R53-T57 PolarHBondContact O-OG1 2.88Å; R53-F103 VanDerWaalsContact O-CZ 3.23Å; R53-F103 WeakPolarHBondContact O-CZ 3.23Å
54	L	85.7	Confident	87.1	Confident	11 Å²	11	51.4 Å²	51.4	6%	0.058	27%	0.266	C	S	.	.	T	Hydrogen-bonded Turn	trans	-75.7	-18.2	-176.5	-72.2	169.8	0	0	0	113.7	D29 A30 G56 F108 I135 H137	D29-L54 PolarHBondContact OD1-N 3.07Å; D29-L54 PolarHBondContact OD2-N 3.26Å; A30-L54 HydrophobicContact CB-CD1 3.79Å; A30-L54 HydrophobicContact CB-CG 3.91Å; L54-G56 PolarHBondContact O-N 2.88Å; L54-F108 HydrophobicContact CB-CD2 3.94Å; L54-F108 HydrophobicContact CB-CG 4.42Å; L54-F108 HydrophobicContact CD2-CD1 4.31Å; L54-F108 HydrophobicContact CD2-CD2 3.8Å; L54-F108 HydrophobicContact CD2-CE1 4.34Å; L54-F108 HydrophobicContact CD2-CE2 3.83Å; L54-F108 HydrophobicContact CD2-CG 4.05Å; L54-F108 HydrophobicContact CD2-CZ 4.11Å; L54-F108 HydrophobicContact CG-CD2 4.41Å; L54-F108 WeakPolarHBondContact O-CD2 3.04Å; L54-I135 HydrophobicContact CD1-CG2 3.89Å; L54-H137 HydrophobicContact CD1-CB 3.53Å; L54-H137 VanDerWaalsContact CD1-CD2 3.48Å; L54-H137 WeakPolarHBondContact CD1-CD2 3.44Å; L54-H137 VanDerWaalsContact CD1-CG 3.46Å
55	R	85.4	Confident	87.2	Confident	107 Å²	107	53.1 Å²	53.1	40%	0.404	27%	0.273	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.3	-21.3	164.4	-78.3	-170	175.2	-158.2	1.3	113.2	D29 R53 V141 N142	D29-R55 PolarHBondContact OD2-N 3.02Å; R53-R55 PolarHBondContact O-N 2.66Å; R55-V141 VanDerWaalsContact CZ-CG1 3.49Å; R55-V141 VanDerWaalsContact NH2-CG1 3.35Å; R55-V141 PolarHBondContact NH2-O 3.44Å; R55-N142 PolarHBondContact NH2-O 3.3Å
56	G	86.7	Confident	86.8	Confident	15 Å²	15	55.1 Å²	55.1	16%	0.155	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	142.5	144.5	-179	0	0	0	0	0	112.1	R53 L54 F103	R53-G56 CarbonylContact O-C 3.59Å; R53-G56 PolarHBondContact O-N 2.69Å; L54-G56 PolarHBondContact O-N 2.88Å; G56-F103 CarbonylContact C-O 3.43Å; G56-F103 WeakPolarHBondContact CA-O 3.48Å
57	T	89.1	Confident	85.8	Confident	10 Å²	10	54.7 Å²	54.7	6%	0.061	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.8	139.1	-177.1	-54.1	0	0	0	0	111.5	P50 R53 F101 S102 F103	P50-T57 HydrophobicContact CG-CG2 4.18Å; R53-T57 WeakPolarHBondContact CA-OG1 3.44Å; R53-T57 PolarHBondContact N-OG1 2.88Å; R53-T57 PolarHBondContact O-OG1 2.88Å; T57-F101 HydrophobicContact CG2-CE2 3.73Å; T57-F101 HydrophobicContact CG2-CZ 3.62Å; T57-S102 WeakPolarHBondContact O-CA 3.44Å; T57-F103 PolarHBondContact N-O 2.88Å; T57-F103 PolarHBondContact O-N 3.46Å
58	N	90.6	Very high	84.5	Confident	109 Å²	109	56 Å²	56	58%	0.583	28%	0.278	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.7	135.3	162.9	-62	-22.6	0	0	0	107.9	P50 F101 S102	P50-N58 WeakPolarHBondContact CD-O 3.01Å; N58-F101 WeakPolarHBondContact CA-O 3.28Å; N58-S102 VanDerWaalsContact OD1-CB 3.28Å; N58-S102 WeakPolarHBondContact OD1-CB 3.41Å; N58-S102 PolarHBondContact OD1-OG 2.83Å
59	G	91	Very high	82.6	Confident	12 Å²	12	59 Å²	59	12%	0.124	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	177.9	-161.9	-176.3	0	0	0	0	0	113.8	E49 P100 F101	E49-G59 CarbonylContact O-C 3.3Å; E49-G59 WeakPolarHBondContact O-CA 3.08Å; G59-P100 WeakPolarHBondContact O-CA 3.35Å; G59-F101 VanDerWaalsContact C-CD1 3.41Å; G59-F101 VanDerWaalsContact C-CE1 3.43Å; G59-F101 PolarHBondContact N-O 2.81Å; G59-F101 VanDerWaalsContact O-CD1 3.31Å; G59-F101 WeakPolarHBondContact O-CD1 3Å; G59-F101 PolarHBondContact O-N 3.24Å
60	F	87.8	Confident	80.9	Confident	104 Å²	104	55.9 Å²	55.9	46%	0.456	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123	141.3	175.3	-58.2	-86.3	0	0	0	110.8	S48 E49 I99 P100	S48-F60 CarbonylContact C-O 3.49Å; S48-F60 WeakPolarHBondContact CA-O 3.47Å; E49-F60 PolarHBondContact N-O 3.11Å; E49-F60 PolarHBondContact O-N 2.91Å; F60-I99 CarbonylContact C-O 3.59Å; F60-I99 WeakPolarHBondContact CA-O 3.22Å; F60-P100 HydrophobicContact CD1-CB 4.04Å; F60-P100 HydrophobicContact CE1-CB 3.92Å
61	V	88.4	Confident	78.3	Confident	32 Å²	32	57 Å²	57	19%	0.194	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	115.8	163.8	-175.4	0	0	0	0	107.5	I46 S47 V63 I99 F101	I46-V61 HydrophobicContact CG2-CG1 3.6Å; S47-V61 CarbonylContact O-C 3.4Å; S47-V61 VanDerWaalsContact O-CA 3.32Å; S47-V61 WeakPolarHBondContact O-CA 3.3Å; S47-V61 WeakPolarHBondContact O-CG1 3.39Å; V61-V63 HydrophobicContact CG1-CG2 3.87Å; V61-I99 PolarHBondContact N-O 3.11Å; V61-I99 PolarHBondContact O-N 2.8Å; V61-F101 HydrophobicContact CG2-CD1 3.59Å; V61-F101 HydrophobicContact CG2-CE1 3.91Å; V61-F101 HydrophobicContact CG2-CG 4.21Å
62	H	85.4	Confident	76.1	Confident	55 Å²	55	62.6 Å²	62.6	26%	0.255	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.9	128.9	171.8	-51.3	-76.1	0	0	0	108.3	I46 S47 T97 S98	I46-H62 WeakPolarHBondContact CA-O 3.35Å; S47-H62 PolarHBondContact N-O 3.1Å; S47-H62 PolarHBondContact O-N 2.82Å; H62-T97 WeakPolarHBondContact CA-O 3.43Å; H62-S98 PolarHBondContact CE1-OG 2.66Å; H62-S98 PolarHBondContact ND1-OG 2.81Å
63	V	84.1	Confident	74.2	Confident	17 Å²	17	70.2 Å²	70.2	10%	0.103	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	119.7	-179.6	-170.2	0	0	0	0	108.4	I44 S45 I46 V61 F65 N96 T97 I99	I44-V63 HydrophobicContact CD1-CG1 4.34Å; S45-V63 WeakPolarHBondContact O-CA 3.46Å; I46-V63 HydrophobicContact CG1-CG1 4.39Å; V61-V63 HydrophobicContact CG1-CG2 3.87Å; V63-F65 HydrophobicContact CG1-CD1 3.72Å; V63-F65 HydrophobicContact CG1-CE1 3.97Å; V63-N96 WeakPolarHBondContact O-CA 3.43Å; V63-T97 PolarHBondContact N-O 2.82Å; V63-T97 PolarHBondContact O-N 2.88Å; V63-T97 VanDerWaalsContact O-N 3.1Å; V63-I99 HydrophobicContact CG2-CD1 3.9Å
64	E	82	Confident	72.9	Confident	92 Å²	92	73.3 Å²	73.3	43%	0.43	35%	0.351	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	115.7	175.3	-176.8	169.4	-123.9	0	0	110.2	I44 S45 V95 N96	I44-E64 WeakPolarHBondContact CA-O 3.3Å; S45-E64 PolarHBondContact N-O 3.22Å; S45-E64 PolarHBondContact O-N 3.1Å; E64-V95 CarbonylContact C-O 3.59Å; E64-V95 VanDerWaalsContact CA-O 3.26Å; E64-V95 WeakPolarHBondContact CA-O 3.37Å; E64-N96 HydrophobicContact CG-CB 4.38Å; E64-N96 PolarHBondContact OE1-ND2 3.05Å
65	F	79.2	Confident	71.9	Confident	40 Å²	40	75.1 Å²	75.1	18%	0.175	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-160	168.6	-179.6	75	-66	0	0	0	112.3	I44 V63 P67 V95 F129	I44-F65 HydrophobicContact CB-CB 3.85Å; I44-F65 HydrophobicContact CD1-CB 4.01Å; I44-F65 HydrophobicContact CD1-CG 4.2Å; I44-F65 HydrophobicContact CG1-CB 3.87Å; V63-F65 HydrophobicContact CG1-CD1 3.72Å; V63-F65 HydrophobicContact CG1-CE1 3.97Å; F65-P67 HydrophobicContact CD2-CB 4.35Å; F65-P67 HydrophobicContact CE2-CB 3.74Å; F65-P67 HydrophobicContact CZ-CB 4.34Å; F65-V95 HydrophobicContact CD1-CB 3.88Å; F65-V95 HydrophobicContact CD1-CG1 4.06Å; F65-V95 HydrophobicContact CE1-CB 3.72Å; F65-V95 HydrophobicContact CE1-CG1 3.61Å; F65-V95 HydrophobicContact CE1-CG2 4.25Å; F65-V95 HydrophobicContact CZ-CB 4.4Å; F65-V95 HydrophobicContact CZ-CG1 4.47Å; F65-V95 HydrophobicContact CZ-CG2 4.47Å; F65-V95 PolarHBondContact N-O 3.23Å; F65-V95 PolarHBondContact O-N 2.9Å; F65-F129 HydrophobicContact CD2-CE1 4.38Å; F65-F129 HydrophobicContact CE2-CE1 4.34Å
66	I	71.5	Confident	71.3	Confident	96 Å²	96	74.9 Å²	74.9	49%	0.492	37%	0.369	S	S	.	.			trans	-108.9	120.4	170	-58.6	174.8	0	0	0	107.7
67	P	63	Low	70.8	Confident	16 Å²	16	75.4 Å²	75.4	10%	0.104	37%	0.369	C	S	.	.			trans	-83	154.1	-172.7	33.8	-33.2	0	0	0	112.6	F65 A89 E93 V95	F65-P67 HydrophobicContact CD2-CB 4.35Å; F65-P67 HydrophobicContact CE2-CB 3.74Å; F65-P67 HydrophobicContact CZ-CB 4.34Å; P67-A89 HydrophobicContact CG-CB 4.39Å; P67-E93 WeakPolarHBondContact CD-O 3.31Å; P67-V95 HydrophobicContact CG-CG2 4.05Å
68	K	62.6	Low	70.2	Confident	63 Å²	63	80.6 Å²	80.6	27%	0.274	39%	0.393	S	S	.	.			trans	-113.6	167.2	148.6	-31.3	170.7	-175.8	169	0	107.5	F42 E126 L128	F42-K68 VanDerWaalsContact CZ-NZ 3.32Å; K68-E126 IonicContact NZ-OE2 2.72Å; K68-L128 HydrophobicContact CB-CD2 3.51Å; K68-L128 HydrophobicContact CD-CD2 4.3Å; K68-L128 HydrophobicContact CG-CD2 4.13Å; K68-L128 WeakPolarHBondContact O-CD2 3.33Å
69	L	48.9	Very low	69.2	Low	77 Å²	77	77.9 Å²	77.9	40%	0.403	39%	0.391	S	S	.	.			trans	-74.6	157.8	-160.4	-58.3	171.2	0	0	0	113.3	K91 A121	L69-K91 HydrophobicContact CD2-CB 4.32Å; L69-K91 HydrophobicContact CG-CB 4.35Å; L69-A121 WeakPolarHBondContact O-CA 3.39Å; L69-A121 WeakPolarHBondContact O-CB 3.48Å
70	P	54.7	Low	68.2	Low	70 Å²	70	84.4 Å²	84.4	46%	0.455	42%	0.418	S	S	.	.			trans	-131.9	163.5	-158.5	41.3	-26.2	0	0	0	117
71	K	36.2	Very low	67.6	Low	95 Å²	95	85.5 Å²	85.5	41%	0.413	43%	0.428	S	S	.	.			trans	143.1	126.2	150.2	-87.3	162.4	174.3	178.9	0	111.2	C77 H78 G122	K71-C77 WeakPolarHBondContact CE-O 2.98Å; K71-H78 WeakPolarHBondContact CE-O 3.18Å; K71-H78 PolarHBondContact NZ-O 2.85Å; K71-G122 WeakPolarHBondContact O-CA 3.35Å
72	R	46.1	Very low	67.2	Low	141 Å²	141	85.3 Å²	85.3	53%	0.532	43%	0.426	S	S	.	.			cis	-132.9	-150.8	0	-81.8	169.8	162.2	175.4	-8.3	106.1	V75	R72-V75 HydrophobicContact CB-CG2 4.32Å; R72-V75 HydrophobicContact CG-CG1 4.37Å; R72-V75 HydrophobicContact CG-CG2 3.83Å; R72-V75 VanDerWaalsContact NE-CG1 3.33Å
73	K	51	Low	67.1	Low	199 Å²	199	90.3 Å²	90.3	87%	0.865	46%	0.455	S	S	*	.	S	Bend	cis	-147.5	132.6	0.8	175.4	-170	172.2	-171.2	0	106.1
74	E	60.7	Low	66.9	Low	179 Å²	179	93.2 Å²	93.2	84%	0.836	46%	0.464	S	S	*	.	S	Bend	cis	-54.6	175	4.8	-75.7	168.8	123	0	0	116.9
75	V	65.4	Low	66.9	Low	49 Å²	49	93 Å²	93	30%	0.297	47%	0.474	S	S	.	.			trans	-116.9	101.2	-171.5	-168.7	0	0	0	0	109.6	R72 C77	R72-V75 HydrophobicContact CB-CG2 4.32Å; R72-V75 HydrophobicContact CG-CG1 4.37Å; R72-V75 HydrophobicContact CG-CG2 3.83Å; R72-V75 VanDerWaalsContact NE-CG1 3.33Å; V75-C77 WeakPolarHBondContact CG1-O 3.32Å
76	L	73.1	Confident	67	Low	102 Å²	102	92.9 Å²	92.9	53%	0.534	47%	0.473	S	S	.	.	S	Bend	trans	-87.5	-24.2	168.4	-61.2	178.6	0	0	0	112.2	Y84 F86 C87	L76-Y84 HydrophobicContact CB-CD2 4.42Å; L76-Y84 HydrophobicContact CD2-CE2 4.03Å; L76-F86 HydrophobicContact CB-CE2 4.22Å; L76-F86 HydrophobicContact CB-CZ 4.24Å; L76-F86 HydrophobicContact CD1-CE2 4.44Å; L76-F86 HydrophobicContact CD1-CZ 4.13Å; L76-C87 PolarHBondContact O-SG 2.96Å
77	C	76.1	Confident	67.2	Low	25 Å²	25	89.8 Å²	89.8	17%	0.169	46%	0.459	C	S	.	.			trans	-131.8	115.4	-179.7	-49.8	0	0	0	0	110.6	K71 V75 C87	K71-C77 WeakPolarHBondContact CE-O 2.98Å; V75-C77 WeakPolarHBondContact CG1-O 3.32Å; C77-C87 VanDerWaalsContact CA-SG 3.52Å; C77-C87 HydrophobicContact CB-CB 3.68Å; C77-C87 WeakPolarHBondContact CB-SG 3.48Å; C77-C87 WeakPolarHBondContact SG-CA 3.33Å; C77-C87 WeakPolarHBondContact SG-CB 3.34Å; C77-C87 CovalentContact SG-SG 2.04Å; C77-C87 PolarHBondContact SG-SG 2.82Å
78	H	76.4	Confident	68.1	Low	119 Å²	119	98.1 Å²	98.1	55%	0.551	49%	0.489	S	S	*	.			trans	-81.6	-34.3	173.1	-65.1	-121.7	0	0	0	110.4	K71 D82	K71-H78 WeakPolarHBondContact CE-O 3.18Å; K71-H78 PolarHBondContact NZ-O 2.85Å; H78-D82 WeakPolarHBondContact CA-OD1 3.45Å; H78-D82 VanDerWaalsContact CB-OD1 3.3Å; H78-D82 WeakPolarHBondContact CB-OD1 2.96Å; H78-D82 IonicContact CD2-OD1 2.71Å; H78-D82 IonicContact CG-OD1 2.69Å; H78-D82 PolarHBondContact N-OD1 2.94Å
79	G	70.3	Confident	68.9	Low	53 Å²	53	96.3 Å²	96.3	55%	0.546	49%	0.486	S	S	.	.	S	Bend	trans	103.9	9.7	176.1	0	0	0	0	0	115.1	D82	G79-D82 WeakPolarHBondContact CA-OD2 3.5Å; G79-D82 PolarHBondContact N-OD1 3.43Å; G79-D82 PolarHBondContact N-OD2 3.24Å
80	H	70.3	Confident	70.2	Confident	148 Å²	148	97.8 Å²	97.8	69%	0.685	49%	0.493	S	S	*	.	S	Bend	trans	-155.2	129.2	168.4	179.7	16.1	0	0	0	106.6	D82	H80-D82 VanDerWaalsContact C-N 3.29Å; H80-D82 PolarHBondContact O-N 3.29Å
81	D	73.9	Confident	70.9	Confident	128 Å²	128	101.8 Å²	101.8	68%	0.684	50%	0.504	S	S	*	.	S	Bend	trans	51	45.7	178	-62.5	4.5	0	0	0	113.8
82	D	81	Confident	72.7	Confident	28 Å²	28	99.7 Å²	99.7	15%	0.15	51%	0.509	C	S	.	.			trans	-71.7	137.9	176	-66.9	-45.1	0	0	0	112.5	H78 G79 H80 Y84 C87	H78-D82 WeakPolarHBondContact CA-OD1 3.45Å; H78-D82 VanDerWaalsContact CB-OD1 3.3Å; H78-D82 WeakPolarHBondContact CB-OD1 2.96Å; H78-D82 IonicContact CD2-OD1 2.71Å; H78-D82 IonicContact CG-OD1 2.69Å; H78-D82 PolarHBondContact N-OD1 2.94Å; G79-D82 WeakPolarHBondContact CA-OD2 3.5Å; G79-D82 PolarHBondContact N-OD1 3.43Å; G79-D82 PolarHBondContact N-OD2 3.24Å; H80-D82 VanDerWaalsContact C-N 3.29Å; H80-D82 PolarHBondContact O-N 3.29Å; D82-Y84 PolarHBondContact O-N 2.93Å; D82-C87 HydrophobicContact CB-CB 3.7Å
83	D	82.7	Confident	74.2	Confident	159 Å²	159	97.4 Å²	97.4	85%	0.85	51%	0.505	S	S	*	.	S	Bend	trans	-61	-25.8	-179.9	-65.3	-54.8	0	0	0	113.9
84	Y	80.6	Confident	75.6	Confident	78 Å²	78	92.7 Å²	92.7	31%	0.306	49%	0.493	S	S	.	.			trans	-105.9	127.3	-173.3	-60.8	-64.8	0	0	0	113.1	L76 D82 F86 C87 I99	L76-Y84 HydrophobicContact CB-CD2 4.42Å; L76-Y84 HydrophobicContact CD2-CE2 4.03Å; D82-Y84 PolarHBondContact O-N 2.93Å; Y84-F86 AromaticContact CD1-CE1 3.86Å; Y84-F86 HydrophobicContact CD1-CE1 3.86Å; Y84-F86 HydrophobicContact CD1-CZ 4.31Å; Y84-F86 HydrophobicContact CD2-CE1 4.17Å; Y84-F86 AromaticContact CD2-CZ 3.78Å; Y84-F86 HydrophobicContact CD2-CZ 3.78Å; Y84-F86 HydrophobicContact CG-CD1 4.36Å; Y84-F86 AromaticContact CG-CE1 3.54Å; Y84-F86 HydrophobicContact CG-CE1 3.54Å; Y84-F86 AromaticContact CG-CZ 3.62Å; Y84-F86 HydrophobicContact CG-CZ 3.62Å; Y84-F86 PolarHBondContact O-N 2.85Å; Y84-C87 VanDerWaalsContact O-CB 3.3Å; Y84-C87 WeakPolarHBondContact O-CB 3.26Å; Y84-C87 PolarHBondContact O-N 3.04Å; Y84-I99 HydrophobicContact CE1-CG2 3.81Å
85	S	81.6	Confident	76.7	Confident	89 Å²	89	84.6 Å²	84.6	62%	0.622	46%	0.456	S	S	*	.	G	3₁₀ helix	trans	-56.1	-34.5	178.6	55	0	0	0	0	113.9	C87 R88	S85-C87 PolarHBondContact O-N 2.98Å; S85-R88 PolarHBondContact O-N 2.92Å
86	F	80.1	Confident	77.7	Confident	37 Å²	37	87.4 Å²	87.4	16%	0.162	47%	0.469	C	S	.	.	G	3₁₀ helix	trans	-65.1	-17.7	179.2	64.3	-107.4	0	0	0	113.8	L76 Y84 R88 A89 V95 T97 I99	L76-F86 HydrophobicContact CB-CE2 4.22Å; L76-F86 HydrophobicContact CB-CZ 4.24Å; L76-F86 HydrophobicContact CD1-CE2 4.44Å; L76-F86 HydrophobicContact CD1-CZ 4.13Å; Y84-F86 AromaticContact CD1-CE1 3.86Å; Y84-F86 HydrophobicContact CD1-CE1 3.86Å; Y84-F86 HydrophobicContact CD1-CZ 4.31Å; Y84-F86 HydrophobicContact CD2-CE1 4.17Å; Y84-F86 AromaticContact CD2-CZ 3.78Å; Y84-F86 HydrophobicContact CD2-CZ 3.78Å; Y84-F86 HydrophobicContact CG-CD1 4.36Å; Y84-F86 AromaticContact CG-CE1 3.54Å; Y84-F86 HydrophobicContact CG-CE1 3.54Å; Y84-F86 AromaticContact CG-CZ 3.62Å; Y84-F86 HydrophobicContact CG-CZ 3.62Å; Y84-F86 PolarHBondContact O-N 2.85Å; F86-R88 PolarHBondContact O-N 3.12Å; F86-R88 VanDerWaalsContact O-N 3.1Å; F86-A89 WeakPolarHBondContact O-CB 3.38Å; F86-A89 PolarHBondContact O-N 3.09Å; F86-A89 VanDerWaalsContact O-N 3.11Å; F86-V95 HydrophobicContact CB-CG1 3.72Å; F86-T97 HydrophobicContact CD1-CG2 3.98Å; F86-I99 HydrophobicContact CD1-CD1 4.38Å; F86-I99 HydrophobicContact CE1-CD1 3.63Å; F86-I99 HydrophobicContact CE1-CG1 4.08Å; F86-I99 HydrophobicContact CZ-CD1 4.33Å
87	C	77.6	Confident	78.2	Confident	31 Å²	31	83.9 Å²	83.9	21%	0.209	45%	0.451	C	S	.	.	G	3₁₀ helix	trans	-65.3	-10.3	175	-65.4	0	0	0	0	113.8	L76 C77 D82 Y84 S85	L76-C87 PolarHBondContact O-SG 2.96Å; C77-C87 VanDerWaalsContact CA-SG 3.52Å; C77-C87 HydrophobicContact CB-CB 3.68Å; C77-C87 WeakPolarHBondContact CB-SG 3.48Å; C77-C87 WeakPolarHBondContact SG-CA 3.33Å; C77-C87 WeakPolarHBondContact SG-CB 3.34Å; C77-C87 CovalentContact SG-SG 2.04Å; C77-C87 PolarHBondContact SG-SG 2.82Å; D82-C87 HydrophobicContact CB-CB 3.7Å; Y84-C87 VanDerWaalsContact O-CB 3.3Å; Y84-C87 WeakPolarHBondContact O-CB 3.26Å; Y84-C87 PolarHBondContact O-N 3.04Å; S85-C87 PolarHBondContact O-N 2.98Å
88	R	80.1	Confident	78.7	Confident	190 Å²	190	85.4 Å²	85.4	72%	0.717	46%	0.462	S	S	*	.	G	3₁₀ helix	trans	-100.4	-4.8	176.3	-55.3	-176.7	-172.6	-173.3	0.4	113.7	S85 F86	S85-R88 PolarHBondContact O-N 2.92Å; F86-R88 PolarHBondContact O-N 3.12Å; F86-R88 VanDerWaalsContact O-N 3.1Å
89	A	80.4	Confident	79.1	Confident	26 Å²	26	81.3 Å²	81.3	22%	0.215	44%	0.444	C	S	.	.			trans	-71.5	137.3	-175.2	0	0	0	0	0	112.2	P67 F86 E93 V95	P67-A89 HydrophobicContact CG-CB 4.39Å; F86-A89 WeakPolarHBondContact O-CB 3.38Å; F86-A89 PolarHBondContact O-N 3.09Å; F86-A89 VanDerWaalsContact O-N 3.11Å; A89-E93 WeakPolarHBondContact CA-OE2 3.5Å; A89-V95 HydrophobicContact CB-CG2 3.49Å; A89-V95 VanDerWaalsContact CB-CG2 3.49Å
90	L	76	Confident	79.8	Confident	107 Å²	107	82.8 Å²	82.8	56%	0.56	44%	0.444	S	S	*	.			trans	-91.9	159.6	-179.1	-55.6	179.4	0	0	0	112	G92 E93	L90-G92 PolarHBondContact O-N 2.85Å; L90-G92 VanDerWaalsContact O-N 3.1Å; L90-E93 HydrophobicContact CB-CG 4.06Å; L90-E93 PolarHBondContact N-OE2 2.93Å; L90-E93 WeakPolarHBondContact O-CB 3.35Å; L90-E93 PolarHBondContact O-N 3.19Å
91	K	70.1	Confident	80.7	Confident	154 Å²	154	77.8 Å²	77.8	67%	0.67	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.1	114.9	178.1	179.5	179.5	178.1	174.3	0	110.6	L69	L69-K91 HydrophobicContact CD2-CB 4.32Å; L69-K91 HydrophobicContact CG-CB 4.35Å
92	G	72.4	Confident	81.2	Confident	52 Å²	52	75.9 Å²	75.9	54%	0.536	42%	0.417	S	S	.	.	T	Hydrogen-bonded Turn	trans	98.7	-5.2	-179.4	0	0	0	0	0	115.4	L90	L90-G92 PolarHBondContact O-N 2.85Å; L90-G92 VanDerWaalsContact O-N 3.1Å
93	E	79.1	Confident	81.4	Confident	93 Å²	93	76.9 Å²	76.9	44%	0.435	42%	0.421	S	S	.	.			trans	-77.7	145.5	170.8	-64.5	-178.9	159.9	0	0	110.9	P67 A89 L90 V95	P67-E93 WeakPolarHBondContact CD-O 3.31Å; A89-E93 WeakPolarHBondContact CA-OE2 3.5Å; L90-E93 HydrophobicContact CB-CG 4.06Å; L90-E93 PolarHBondContact N-OE2 2.93Å; L90-E93 WeakPolarHBondContact O-CB 3.35Å; L90-E93 PolarHBondContact O-N 3.19Å; E93-V95 PolarHBondContact O-N 3.5Å
94	T	80.4	Confident	81.5	Confident	99 Å²	99	77.1 Å²	77.1	61%	0.607	42%	0.416	S	S	*	.			trans	-77.4	114.1	173.7	-54.3	0	0	0	0	109.7
95	V	83	Confident	80.9	Confident	10 Å²	10	76.8 Å²	76.8	6%	0.061	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	113.8	166.3	177.9	0	0	0	0	107.7	E64 F65 P67 F86 A89 E93 T97	E64-V95 CarbonylContact C-O 3.59Å; E64-V95 VanDerWaalsContact CA-O 3.26Å; E64-V95 WeakPolarHBondContact CA-O 3.37Å; F65-V95 HydrophobicContact CD1-CB 3.88Å; F65-V95 HydrophobicContact CD1-CG1 4.06Å; F65-V95 HydrophobicContact CE1-CB 3.72Å; F65-V95 HydrophobicContact CE1-CG1 3.61Å; F65-V95 HydrophobicContact CE1-CG2 4.25Å; F65-V95 HydrophobicContact CZ-CB 4.4Å; F65-V95 HydrophobicContact CZ-CG1 4.47Å; F65-V95 HydrophobicContact CZ-CG2 4.47Å; F65-V95 PolarHBondContact N-O 3.23Å; F65-V95 PolarHBondContact O-N 2.9Å; P67-V95 HydrophobicContact CG-CG2 4.05Å; F86-V95 HydrophobicContact CB-CG1 3.72Å; A89-V95 HydrophobicContact CB-CG2 3.49Å; A89-V95 VanDerWaalsContact CB-CG2 3.49Å; E93-V95 PolarHBondContact O-N 3.5Å; V95-T97 HydrophobicContact CG1-CG2 3.99Å
96	N	86.3	Confident	80.6	Confident	107 Å²	107	77.1 Å²	77.1	57%	0.572	43%	0.431	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-126.8	114.6	167.2	-178.7	-38.1	0	0	0	107	V63 E64	V63-N96 WeakPolarHBondContact O-CA 3.43Å; E64-N96 HydrophobicContact CG-CB 4.38Å; E64-N96 PolarHBondContact OE1-ND2 3.05Å
97	T	84.3	Confident	80.3	Confident	28 Å²	28	81.9 Å²	81.9	17%	0.172	46%	0.457	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.6	159.7	-172.6	-169.1	0	0	0	0	112.3	H62 V63 F86 V95 I99	H62-T97 WeakPolarHBondContact CA-O 3.43Å; V63-T97 PolarHBondContact N-O 2.82Å; V63-T97 PolarHBondContact O-N 2.88Å; V63-T97 VanDerWaalsContact O-N 3.1Å; F86-T97 HydrophobicContact CD1-CG2 3.98Å; V95-T97 HydrophobicContact CG1-CG2 3.99Å; T97-I99 HydrophobicContact CG2-CG1 4.29Å
98	S	85.5	Confident	80.3	Confident	57 Å²	57	83.1 Å²	83.1	40%	0.399	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120	107.5	-179.9	-56.8	0	0	0	0	109.3	H62	H62-S98 PolarHBondContact CE1-OG 2.66Å; H62-S98 PolarHBondContact ND1-OG 2.81Å
99	I	85.9	Confident	80.3	Confident	33 Å²	33	78.1 Å²	78.1	17%	0.169	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	115.1	-175.7	-55.5	176.4	0	0	0	108.4	F60 V61 V63 Y84 F86 T97	F60-I99 CarbonylContact C-O 3.59Å; F60-I99 WeakPolarHBondContact CA-O 3.22Å; V61-I99 PolarHBondContact N-O 3.11Å; V61-I99 PolarHBondContact O-N 2.8Å; V63-I99 HydrophobicContact CG2-CD1 3.9Å; Y84-I99 HydrophobicContact CE1-CG2 3.81Å; F86-I99 HydrophobicContact CD1-CD1 4.38Å; F86-I99 HydrophobicContact CE1-CD1 3.63Å; F86-I99 HydrophobicContact CE1-CG1 4.08Å; F86-I99 HydrophobicContact CZ-CD1 4.33Å; T97-I99 HydrophobicContact CG2-CG1 4.29Å
100	P	85.1	Confident	80.5	Confident	85 Å²	85	82.3 Å²	82.3	55%	0.552	47%	0.465	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-66.9	138.4	174.9	28.3	-33.7	0	0	0	110.3	G59 F60	G59-P100 WeakPolarHBondContact O-CA 3.35Å; F60-P100 HydrophobicContact CD1-CB 4.04Å; F60-P100 HydrophobicContact CE1-CB 3.92Å
101	F	87.6	Confident	81	Confident	42 Å²	42	78.7 Å²	78.7	18%	0.184	45%	0.454	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.5	150.8	175.8	78.9	-80.7	0	0	0	111.9	I52 T57 N58 G59 V61 F103	I52-F101 HydrophobicContact CD1-CE2 4.28Å; I52-F101 HydrophobicContact CD1-CZ 4.27Å; I52-F101 HydrophobicContact CG1-CE2 3.8Å; I52-F101 HydrophobicContact CG1-CZ 3.64Å; T57-F101 HydrophobicContact CG2-CE2 3.73Å; T57-F101 HydrophobicContact CG2-CZ 3.62Å; N58-F101 WeakPolarHBondContact CA-O 3.28Å; G59-F101 VanDerWaalsContact C-CD1 3.41Å; G59-F101 VanDerWaalsContact C-CE1 3.43Å; G59-F101 PolarHBondContact N-O 2.81Å; G59-F101 VanDerWaalsContact O-CD1 3.31Å; G59-F101 WeakPolarHBondContact O-CD1 3Å; G59-F101 PolarHBondContact O-N 3.24Å; V61-F101 HydrophobicContact CG2-CD1 3.59Å; V61-F101 HydrophobicContact CG2-CE1 3.91Å; V61-F101 HydrophobicContact CG2-CG 4.21Å; F101-F103 HydrophobicContact CD2-CD1 4.31Å; F101-F103 HydrophobicContact CE2-CD1 4.36Å; F101-F103 HydrophobicContact CE2-CE1 4.22Å
102	S	85.1	Confident	81.9	Confident	88 Å²	88	77.2 Å²	77.2	62%	0.615	45%	0.449	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-147.1	134.2	176.1	178.5	0	0	0	0	109.3	T57 N58	T57-S102 WeakPolarHBondContact O-CA 3.44Å; N58-S102 VanDerWaalsContact OD1-CB 3.28Å; N58-S102 WeakPolarHBondContact OD1-CB 3.41Å; N58-S102 PolarHBondContact OD1-OG 2.83Å
103	F	86.1	Confident	82.4	Confident	50 Å²	50	78.1 Å²	78.1	22%	0.219	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.3	148.1	163.2	74.4	-86.3	0	0	0	111.2	I52 R53 G56 T57 F101 F108	I52-F103 HydrophobicContact CG2-CE1 3.66Å; I52-F103 HydrophobicContact CG2-CZ 3.63Å; R53-F103 VanDerWaalsContact O-CZ 3.23Å; R53-F103 WeakPolarHBondContact O-CZ 3.23Å; G56-F103 CarbonylContact C-O 3.43Å; G56-F103 WeakPolarHBondContact CA-O 3.48Å; T57-F103 PolarHBondContact N-O 2.88Å; T57-F103 PolarHBondContact O-N 3.46Å; F101-F103 HydrophobicContact CD2-CD1 4.31Å; F101-F103 HydrophobicContact CE2-CD1 4.36Å; F101-F103 HydrophobicContact CE2-CE1 4.22Å; F103-F108 HydrophobicContact CE2-CE2 4.07Å
104	E	85.1	Confident	82.8	Confident	163 Å²	163	81.8 Å²	81.8	76%	0.762	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-150.4	164.9	176	-173.4	163.8	-159.9	0	0	109.5	I106	E104-I106 VanDerWaalsContact C-N 3.3Å; E104-I106 PolarHBondContact O-N 3.24Å
105	G	67.4	Low	82.9	Confident	72 Å²	72	80.3 Å²	80.3	74%	0.742	44%	0.439	S	S	*	.			trans	80.8	-9.8	169.2	0	0	0	0	0	116.9	L107	G105-L107 PolarHBondContact O-N 2.94Å
106	I	74.1	Confident	82.9	Confident	96 Å²	96	82.8 Å²	82.8	49%	0.492	46%	0.455	S	S	.	.			trans	-80.6	119.2	177.9	-59.3	169	0	0	0	110.5	E104 F108	E104-I106 VanDerWaalsContact C-N 3.3Å; E104-I106 PolarHBondContact O-N 3.24Å; I106-F108 HydrophobicContact CB-CD2 4.36Å; I106-F108 HydrophobicContact CB-CE2 3.75Å; I106-F108 HydrophobicContact CB-CZ 4.16Å; I106-F108 HydrophobicContact CG2-CD1 4.47Å; I106-F108 HydrophobicContact CG2-CD2 3.95Å; I106-F108 HydrophobicContact CG2-CE1 4.04Å; I106-F108 HydrophobicContact CG2-CE2 3.47Å; I106-F108 VanDerWaalsContact CG2-CE2 3.47Å; I106-F108 HydrophobicContact CG2-CG 4.43Å; I106-F108 HydrophobicContact CG2-CZ 3.53Å; I106-F108 WeakPolarHBondContact O-CD2 3.47Å; I106-F108 PolarHBondContact O-N 2.86Å
107	L	74.9	Confident	82.7	Confident	137 Å²	137	79.4 Å²	79.4	72%	0.717	44%	0.442	S	S	*	.			trans	-88.2	85.2	-177.9	-170	77.6	0	0	0	112.3	G105 P109	G105-L107 PolarHBondContact O-N 2.94Å; L107-P109 WeakPolarHBondContact O-CD 3.35Å
108	F	78.2	Confident	82.4	Confident	57 Å²	57	82.2 Å²	82.2	25%	0.25	45%	0.453	C	S	.	.	P	Polyproline II helix	trans	-69.8	127.5	173.7	-61.7	-86.6	0	0	0	112	L54 F103 I106 H137 R139	L54-F108 HydrophobicContact CB-CD2 3.94Å; L54-F108 HydrophobicContact CB-CG 4.42Å; L54-F108 HydrophobicContact CD2-CD1 4.31Å; L54-F108 HydrophobicContact CD2-CD2 3.8Å; L54-F108 HydrophobicContact CD2-CE1 4.34Å; L54-F108 HydrophobicContact CD2-CE2 3.83Å; L54-F108 HydrophobicContact CD2-CG 4.05Å; L54-F108 HydrophobicContact CD2-CZ 4.11Å; L54-F108 HydrophobicContact CG-CD2 4.41Å; L54-F108 WeakPolarHBondContact O-CD2 3.04Å; F103-F108 HydrophobicContact CE2-CE2 4.07Å; I106-F108 HydrophobicContact CB-CD2 4.36Å; I106-F108 HydrophobicContact CB-CE2 3.75Å; I106-F108 HydrophobicContact CB-CZ 4.16Å; I106-F108 HydrophobicContact CG2-CD1 4.47Å; I106-F108 HydrophobicContact CG2-CD2 3.95Å; I106-F108 HydrophobicContact CG2-CE1 4.04Å; I106-F108 HydrophobicContact CG2-CE2 3.47Å; I106-F108 VanDerWaalsContact CG2-CE2 3.47Å; I106-F108 HydrophobicContact CG2-CG 4.43Å; I106-F108 HydrophobicContact CG2-CZ 3.53Å; I106-F108 WeakPolarHBondContact O-CD2 3.47Å; I106-F108 PolarHBondContact O-N 2.86Å; F108-H137 PolarHBondContact O-CE1 2.83Å; F108-H137 PolarHBondContact O-ND1 3.02Å; F108-R139 PolarHBondContact O-NH1 2.84Å
109	P	79.8	Confident	81.9	Confident	85 Å²	85	80.5 Å²	80.5	55%	0.552	44%	0.442	S	S	*	.	P	Polyproline II helix	trans	-61.7	164.7	169.8	9.5	-13.6	0	0	0	112.8	L107 Y113 H137	L107-P109 WeakPolarHBondContact O-CD 3.35Å; P109-Y113 VanDerWaalsContact C-OH 3.29Å; P109-Y113 WeakPolarHBondContact CD-OH 3.47Å; P109-Y113 WeakPolarHBondContact CG-OH 3.12Å; P109-Y113 PolarHBondContact O-OH 2.97Å; P109-H137 PolarHBondContact O-ND1 2.82Å
110	K	85	Confident	81.1	Confident	113 Å²	113	81.4 Å²	81.4	49%	0.491	45%	0.447	S	S	.	.	S	Bend	trans	-65.8	147.5	169.9	-53.9	-151.4	-172.7	-168.5	0	109.8	R139 D140	K110-R139 HydrophobicContact CD-CB 4.43Å; K110-R139 WeakPolarHBondContact CD-O 3.01Å; K110-R139 WeakPolarHBondContact CE-O 3.06Å; K110-R139 HydrophobicContact CG-CB 4.14Å; K110-R139 PolarHBondContact NZ-O 2.74Å; K110-D140 IonicContact NZ-OD1 2.69Å; K110-D140 PolarHBondContact NZ-OD1 2.94Å; K110-D140 IonicContact NZ-OD2 3.98Å; K110-D140 PolarHBondContact NZ-OD2 2.63Å
111	G	84.8	Confident	80.2	Confident	32 Å²	32	77.5 Å²	77.5	33%	0.33	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	141.2	-166.9	169.3	0	0	0	0	0	115.5	H137	G111-H137 PolarHBondContact N-O 3.41Å; G111-H137 PolarHBondContact O-N 2.03Å
112	H	89.1	Confident	78.8	Confident	123 Å²	123	77.3 Å²	77.3	57%	0.569	43%	0.431	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.3	112.9	-177.6	177.7	-65.2	0	0	0	110	T134	H112-T134 WeakPolarHBondContact NE2-CG2 3.37Å
113	Y	84.4	Confident	77.6	Confident	71 Å²	71	78.4 Å²	78.4	28%	0.278	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	147	176.5	-55.3	-92.9	0	0	0	110.5	P109 I135 H137	P109-Y113 VanDerWaalsContact C-OH 3.29Å; P109-Y113 WeakPolarHBondContact CD-OH 3.47Å; P109-Y113 WeakPolarHBondContact CG-OH 3.12Å; P109-Y113 PolarHBondContact O-OH 2.97Å; Y113-I135 PolarHBondContact N-O 3.06Å; Y113-I135 PolarHBondContact O-N 3Å; Y113-H137 HydrophobicContact CE2-CB 3.91Å
114	R	86	Confident	76.4	Confident	169 Å²	169	79.6 Å²	79.6	64%	0.638	44%	0.442	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.4	127.3	170.1	-167.4	175.2	75.4	105.1	-6.4	108.7	N132 F133	R114-N132 VanDerWaalsContact CD-OD1 3.32Å; R114-N132 WeakPolarHBondContact CD-OD1 3.34Å; R114-N132 WeakPolarHBondContact CG-OD1 3.5Å; R114-N132 PolarHBondContact NH1-OD1 3.47Å; R114-N132 VanDerWaalsContact NH1-OD1 3.08Å; R114-F133 CarbonylContact C-O 3.57Å; R114-F133 WeakPolarHBondContact CA-O 3.32Å
115	C	82.7	Confident	75.6	Confident	68 Å²	68	78.8 Å²	78.8	46%	0.459	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	119	177.4	-175.2	0	0	0	0	108.4	F133	C115-F133 HydrophobicContact CB-CB 4.28Å; C115-F133 PolarHBondContact N-O 2.94Å; C115-F133 WeakPolarHBondContact O-CA 3.44Å; C115-F133 WeakPolarHBondContact O-CB 3.48Å; C115-F133 PolarHBondContact O-N 3.02Å
116	V	83.2	Confident	75.6	Confident	63 Å²	63	80 Å²	80	38%	0.382	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.5	110.2	175.3	-176.6	0	0	0	0	107.7	E118 L131	V116-E118 HydrophobicContact CG1-CG 3.96Å; V116-L131 WeakPolarHBondContact CA-O 3.45Å
117	A	82.7	Confident	75.5	Confident	36 Å²	36	79.2 Å²	79.2	30%	0.298	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94	103.4	175.4	0	0	0	0	0	108.9	C130 L131 F133	A117-C130 WeakPolarHBondContact O-CA 3.45Å; A117-L131 PolarHBondContact N-O 3.47Å; A117-L131 PolarHBondContact O-N 2.97Å; A117-F133 HydrophobicContact CB-CD2 4.19Å; A117-F133 HydrophobicContact CB-CE2 3.98Å
118	E	77.9	Confident	75.4	Confident	87 Å²	87	73.9 Å²	73.9	41%	0.407	39%	0.389	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	128.9	170.7	-54.4	-156	132.6	0	0	109.7	V116 K127 C130	V116-E118 HydrophobicContact CG1-CG 3.96Å; E118-K127 IonicContact OE1-NZ 3.62Å; E118-K127 PolarHBondContact OE1-NZ 2.89Å; E118-K127 WeakPolarHBondContact OE2-CE 3.39Å; E118-K127 IonicContact OE2-NZ 2.68Å; E118-K127 PolarHBondContact OE2-NZ 2.78Å; E118-C130 HydrophobicContact CG-CB 4.39Å; E118-C130 PolarHBondContact OE1-SG 3.32Å; E118-C130 VanDerWaalsContact OE1-SG 3.36Å
119	A	75.2	Confident	75.4	Confident	21 Å²	21	72.9 Å²	72.9	17%	0.174	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	136.1	168.1	0	0	0	0	0	109	K127 L128 F129	A119-K127 CarbonylContact O-C 3.57Å; A119-L128 HydrophobicContact CB-CB 3.91Å; A119-L128 HydrophobicContact CB-CD1 4.2Å; A119-L128 HydrophobicContact CB-CG 4.5Å; A119-L128 WeakPolarHBondContact O-CB 3.42Å; A119-L128 PolarHBondContact O-N 2.9Å; A119-F129 HydrophobicContact CB-CD1 3.92Å; A119-F129 HydrophobicContact CB-CD2 3.91Å; A119-F129 HydrophobicContact CB-CE1 3.62Å; A119-F129 HydrophobicContact CB-CE2 3.61Å; A119-F129 HydrophobicContact CB-CG 4.07Å; A119-F129 HydrophobicContact CB-CZ 3.46Å; A119-F129 VanDerWaalsContact CB-CZ 3.46Å; A119-F129 PolarHBondContact N-O 2.95Å
120	I	68.1	Low	75.5	Confident	52 Å²	52	69 Å²	69	27%	0.267	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132	141.3	-170.3	-54.4	-178	0	0	0	110.7	K127	I120-K127 HydrophobicContact CG1-CG 4.41Å
121	A	67.7	Low	75.5	Confident	3 Å²	3	63.6 Å²	63.6	3%	0.025	34%	0.336	C	S	.	.			trans	-78.5	127	176.4	0	0	0	0	0	111.3	L69 D123 T124 E125 E126 L128	L69-A121 WeakPolarHBondContact O-CA 3.39Å; L69-A121 WeakPolarHBondContact O-CB 3.48Å; A121-D123 VanDerWaalsContact C-N 3.35Å; A121-D123 PolarHBondContact O-N 3.37Å; A121-T124 WeakPolarHBondContact CB-OG1 3.25Å; A121-E125 WeakPolarHBondContact O-CA 3.33Å; A121-E125 PolarHBondContact O-N 2.79Å; A121-E126 HydrophobicContact CB-CB 4.13Å; A121-E126 WeakPolarHBondContact CB-O 3.45Å; A121-E126 PolarHBondContact N-O 2.86Å; A121-L128 HydrophobicContact CB-CD2 3.89Å; A121-L128 HydrophobicContact CB-CG 4.41Å
122	G	57.1	Low	75.7	Confident	37 Å²	37	63.4 Å²	63.4	38%	0.381	33%	0.327	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.7	-12.6	-169.6	0	0	0	0	0	115.8	K71	K71-G122 WeakPolarHBondContact O-CA 3.35Å
123	D	59.1	Low	75.6	Confident	112 Å²	112	59.2 Å²	59.2	60%	0.599	31%	0.308	S	S	*	.	T	Hydrogen-bonded Turn	trans	-100.1	-21.9	180	57.1	-36	0	0	0	112.9	A121	A121-D123 VanDerWaalsContact C-N 3.35Å; A121-D123 PolarHBondContact O-N 3.37Å
124	T	62.4	Low	75.9	Confident	75 Å²	75	57.4 Å²	57.4	46%	0.46	30%	0.304	S	S	.	.	T	Hydrogen-bonded Turn	trans	-128.9	-7	-175.9	60.9	0	0	0	0	115.2	A121 E126	A121-T124 WeakPolarHBondContact CB-OG1 3.25Å; T124-E126 PolarHBondContact O-N 3.44Å; T124-E126 VanDerWaalsContact O-N 3.14Å; T124-E126 WeakPolarHBondContact OG1-CB 3.1Å; T124-E126 WeakPolarHBondContact OG1-CG 3.37Å; T124-E126 PolarHBondContact OG1-N 3.41Å
125	E	67.1	Low	76.1	Confident	145 Å²	145	51 Å²	51	68%	0.678	28%	0.282	S	S	*	.			trans	55.7	17.6	-167.7	-63.4	-73.4	168	0	0	113.5	A121	A121-E125 WeakPolarHBondContact O-CA 3.33Å; A121-E125 PolarHBondContact O-N 2.79Å
126	E	67.9	Low	76.4	Confident	99 Å²	99	50.8 Å²	50.8	46%	0.463	28%	0.276	S	S	.	.			trans	-70.7	132.7	175.2	-79.4	-177.7	-145.6	0	0	111.7	K68 A121 T124 L128	K68-E126 IonicContact NZ-OE2 2.72Å; A121-E126 HydrophobicContact CB-CB 4.13Å; A121-E126 WeakPolarHBondContact CB-O 3.45Å; A121-E126 PolarHBondContact N-O 2.86Å; T124-E126 PolarHBondContact O-N 3.44Å; T124-E126 VanDerWaalsContact O-N 3.14Å; T124-E126 WeakPolarHBondContact OG1-CB 3.1Å; T124-E126 WeakPolarHBondContact OG1-CG 3.37Å; T124-E126 PolarHBondContact OG1-N 3.41Å; E126-L128 PolarHBondContact O-N 3.34Å
127	K	72.8	Confident	76.7	Confident	78 Å²	78	48 Å²	48	34%	0.339	26%	0.259	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.7	120.1	172.8	-64.2	-172.2	172.6	-171.8	0	110.9	L40 E118 A119 I120	L40-K127 HydrophobicContact CD1-CB 3.57Å; L40-K127 HydrophobicContact CD1-CD 3.54Å; L40-K127 HydrophobicContact CD1-CG 4.13Å; L40-K127 HydrophobicContact CD2-CB 3.99Å; L40-K127 HydrophobicContact CG-CB 4.44Å; E118-K127 IonicContact OE1-NZ 3.62Å; E118-K127 PolarHBondContact OE1-NZ 2.89Å; E118-K127 WeakPolarHBondContact OE2-CE 3.39Å; E118-K127 IonicContact OE2-NZ 2.68Å; E118-K127 PolarHBondContact OE2-NZ 2.78Å; A119-K127 CarbonylContact O-C 3.57Å; I120-K127 HydrophobicContact CG1-CG 4.41Å
128	L	71.8	Confident	76.7	Confident	25 Å²	25	51.3 Å²	51.3	13%	0.131	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.6	-44.3	178.1	-59.8	179.4	0	0	0	111.6	F42 K68 A119 A121 E126	F42-L128 WeakPolarHBondContact CD2-O 3.31Å; K68-L128 HydrophobicContact CB-CD2 3.51Å; K68-L128 HydrophobicContact CD-CD2 4.3Å; K68-L128 HydrophobicContact CG-CD2 4.13Å; K68-L128 WeakPolarHBondContact O-CD2 3.33Å; A119-L128 HydrophobicContact CB-CB 3.91Å; A119-L128 HydrophobicContact CB-CD1 4.2Å; A119-L128 HydrophobicContact CB-CG 4.5Å; A119-L128 WeakPolarHBondContact O-CB 3.42Å; A119-L128 PolarHBondContact O-N 2.9Å; A121-L128 HydrophobicContact CB-CD2 3.89Å; A121-L128 HydrophobicContact CB-CG 4.41Å; E126-L128 PolarHBondContact O-N 3.34Å
129	F	78.1	Confident	76.3	Confident	36 Å²	36	50 Å²	50	16%	0.158	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-164.2	162.8	170.4	54.8	-102.2	0	0	0	109.7	I44 F65 A119 L131	I44-F129 HydrophobicContact CD1-CD1 3.8Å; I44-F129 HydrophobicContact CD1-CD2 4.27Å; I44-F129 HydrophobicContact CD1-CE1 3.56Å; I44-F129 HydrophobicContact CD1-CE2 4.06Å; I44-F129 HydrophobicContact CD1-CG 4.15Å; I44-F129 HydrophobicContact CD1-CZ 3.69Å; I44-F129 HydrophobicContact CG2-CB 4.08Å; I44-F129 HydrophobicContact CG2-CG 4.24Å; F65-F129 HydrophobicContact CD2-CE1 4.38Å; F65-F129 HydrophobicContact CE2-CE1 4.34Å; A119-F129 HydrophobicContact CB-CD1 3.92Å; A119-F129 HydrophobicContact CB-CD2 3.91Å; A119-F129 HydrophobicContact CB-CE1 3.62Å; A119-F129 HydrophobicContact CB-CE2 3.61Å; A119-F129 HydrophobicContact CB-CG 4.07Å; A119-F129 HydrophobicContact CB-CZ 3.46Å; A119-F129 VanDerWaalsContact CB-CZ 3.46Å; A119-F129 PolarHBondContact N-O 2.95Å; F129-L131 HydrophobicContact CD2-CD1 4.3Å; F129-L131 HydrophobicContact CD2-CG 4.1Å; F129-L131 HydrophobicContact CE2-CD1 4.37Å
130	C	82.3	Confident	75.7	Confident	3 Å²	3	55.4 Å²	55.4	2%	0.02	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.8	120.6	173.5	-178.7	0	0	0	0	108.8	C37 L40 A117 E118	C37-C130 HydrophobicContact CB-CB 3.6Å; C37-C130 WeakPolarHBondContact CB-SG 3.47Å; C37-C130 PolarHBondContact N-O 2.72Å; C37-C130 WeakPolarHBondContact SG-CB 3.5Å; C37-C130 PolarHBondContact SG-O 2.76Å; C37-C130 VanDerWaalsContact SG-O 3.35Å; C37-C130 CovalentContact SG-SG 2.03Å; C37-C130 PolarHBondContact SG-SG 2.68Å; L40-C130 HydrophobicContact CB-CB 4.46Å; L40-C130 HydrophobicContact CD1-CB 4.32Å; A117-C130 WeakPolarHBondContact O-CA 3.45Å; E118-C130 HydrophobicContact CG-CB 4.39Å; E118-C130 PolarHBondContact OE1-SG 3.32Å; E118-C130 VanDerWaalsContact OE1-SG 3.36Å
131	L	85.9	Confident	75.2	Confident	0 Å²	0	56 Å²	56	0%	0	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.1	124.8	-179.5	-60.5	179.9	0	0	0	110.2	Y34 Y36 I44 I46 V116 A117 F129 F133	Y34-L131 HydrophobicContact CD2-CD1 4.49Å; Y34-L131 HydrophobicContact CD2-CD2 3.79Å; Y34-L131 HydrophobicContact CE2-CD1 4.47Å; Y34-L131 HydrophobicContact CE2-CD2 3.92Å; Y36-L131 HydrophobicContact CD1-CD2 3.78Å; Y36-L131 HydrophobicContact CE1-CD2 3.94Å; I44-L131 HydrophobicContact CG2-CD2 4.11Å; I46-L131 HydrophobicContact CD1-CD1 3.47Å; I46-L131 VanDerWaalsContact CD1-CD1 3.47Å; I46-L131 HydrophobicContact CG1-CD1 4.19Å; V116-L131 WeakPolarHBondContact CA-O 3.45Å; A117-L131 PolarHBondContact N-O 3.47Å; A117-L131 PolarHBondContact O-N 2.97Å; F129-L131 HydrophobicContact CD2-CD1 4.3Å; F129-L131 HydrophobicContact CD2-CG 4.1Å; F129-L131 HydrophobicContact CE2-CD1 4.37Å; L131-F133 HydrophobicContact CB-CD2 4.08Å; L131-F133 HydrophobicContact CB-CE2 3.64Å; L131-F133 HydrophobicContact CB-CZ 4.38Å; L131-F133 HydrophobicContact CD1-CE2 4.04Å; L131-F133 HydrophobicContact CD1-CZ 4.11Å; L131-F133 PolarHBondContact O-N 3.41Å
132	N	87.6	Confident	74.2	Confident	28 Å²	28	66 Å²	66	15%	0.15	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	86.5	-179.5	-178.1	37.2	0	0	0	108.9	Y34 S35 R114	Y34-N132 WeakPolarHBondContact CA-O 3.19Å; S35-N132 PolarHBondContact N-O 3.19Å; S35-N132 PolarHBondContact O-N 2.92Å; R114-N132 VanDerWaalsContact CD-OD1 3.32Å; R114-N132 WeakPolarHBondContact CD-OD1 3.34Å; R114-N132 WeakPolarHBondContact CG-OD1 3.5Å; R114-N132 PolarHBondContact NH1-OD1 3.47Å; R114-N132 VanDerWaalsContact NH1-OD1 3.08Å
133	F	88.6	Confident	75	Confident	36 Å²	36	67.4 Å²	67.4	16%	0.158	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	131.3	178.9	-71.7	-92.9	0	0	0	111.4	I32 S33 Y34 I46 R114 C115 A117 L131	I32-F133 HydrophobicContact CG2-CD1 4.37Å; S33-F133 CarbonylContact O-C 3.53Å; S33-F133 VanDerWaalsContact O-CA 3.31Å; S33-F133 WeakPolarHBondContact O-CA 2.9Å; Y34-F133 HydrophobicContact CD1-CD1 4.06Å; Y34-F133 AromaticContact CD1-CE1 3.52Å; Y34-F133 HydrophobicContact CD1-CE1 3.52Å; Y34-F133 HydrophobicContact CD1-CZ 4Å; Y34-F133 HydrophobicContact CE1-CE1 4.33Å; Y34-F133 HydrophobicContact CG-CD1 4.36Å; Y34-F133 HydrophobicContact CG-CE1 4.09Å; Y34-F133 HydrophobicContact CG-CZ 4.37Å; I46-F133 HydrophobicContact CD1-CZ 4.42Å; R114-F133 CarbonylContact C-O 3.57Å; R114-F133 WeakPolarHBondContact CA-O 3.32Å; C115-F133 HydrophobicContact CB-CB 4.28Å; C115-F133 PolarHBondContact N-O 2.94Å; C115-F133 WeakPolarHBondContact O-CA 3.44Å; C115-F133 WeakPolarHBondContact O-CB 3.48Å; C115-F133 PolarHBondContact O-N 3.02Å; A117-F133 HydrophobicContact CB-CD2 4.19Å; A117-F133 HydrophobicContact CB-CE2 3.98Å; L131-F133 HydrophobicContact CB-CD2 4.08Å; L131-F133 HydrophobicContact CB-CE2 3.64Å; L131-F133 HydrophobicContact CB-CZ 4.38Å; L131-F133 HydrophobicContact CD1-CE2 4.04Å; L131-F133 HydrophobicContact CD1-CZ 4.11Å; L131-F133 PolarHBondContact O-N 3.41Å
134	T	90.3	Very high	75.9	Confident	32 Å²	32	65.1 Å²	65.1	20%	0.196	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	126.4	168.9	-67.1	0	0	0	0	108.9	I32 S33 H112 I136	I32-T134 WeakPolarHBondContact CA-O 3.37Å; S33-T134 PolarHBondContact N-O 2.77Å; S33-T134 PolarHBondContact O-N 3.33Å; H112-T134 WeakPolarHBondContact NE2-CG2 3.37Å; T134-I136 HydrophobicContact CG2-CG1 4.21Å
135	I	89.3	Confident	76.6	Confident	35 Å²	35	64.5 Å²	64.5	18%	0.179	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127	113	-178.9	-60.1	167	0	0	0	108.3	I31 I32 L54 Y113	I31-I135 CarbonylContact O-C 3.45Å; I31-I135 WeakPolarHBondContact O-CA 3.2Å; I32-I135 HydrophobicContact CD1-CG1 4.41Å; I32-I135 HydrophobicContact CG1-CG1 4.16Å; I32-I135 HydrophobicContact CG1-CG2 4.25Å; I32-I135 HydrophobicContact CG2-CG1 4.11Å; L54-I135 HydrophobicContact CD1-CG2 3.89Å; Y113-I135 PolarHBondContact N-O 3.06Å; Y113-I135 PolarHBondContact O-N 3Å
136	I	90.1	Very high	77.2	Confident	64 Å²	64	59.8 Å²	59.8	33%	0.328	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.5	104.1	177.9	-51.8	176.8	0	0	0	108.4	A30 I31 T134 R138	A30-I136 CarbonylContact C-O 3.55Å; A30-I136 WeakPolarHBondContact CA-O 3.39Å; I31-I136 HydrophobicContact CB-CB 4.29Å; I31-I136 PolarHBondContact N-O 2.72Å; I31-I136 PolarHBondContact O-N 3.18Å; T134-I136 HydrophobicContact CG2-CG1 4.21Å; I136-R138 HydrophobicContact CG2-CG 4.32Å; I136-R138 PolarHBondContact O-N 2.95Å
137	H	89	Confident	77.8	Confident	5 Å²	5	57.3 Å²	57.3	2%	0.023	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	94.2	172.6	-167	-164.4	0	0	0	109.1	D29 L54 F108 P109 G111 Y113	D29-H137 PolarHBondContact O-CD2 3.25Å; L54-H137 HydrophobicContact CD1-CB 3.53Å; L54-H137 VanDerWaalsContact CD1-CD2 3.48Å; L54-H137 WeakPolarHBondContact CD1-CD2 3.44Å; L54-H137 VanDerWaalsContact CD1-CG 3.46Å; F108-H137 PolarHBondContact O-CE1 2.83Å; F108-H137 PolarHBondContact O-ND1 3.02Å; P109-H137 PolarHBondContact O-ND1 2.82Å; G111-H137 PolarHBondContact N-O 3.41Å; G111-H137 PolarHBondContact O-N 2.03Å; Y113-H137 HydrophobicContact CE2-CB 3.91Å
138	R	83.1	Confident	78.1	Confident	104 Å²	104	55.9 Å²	55.9	39%	0.392	28%	0.28	S	S	.	.			trans	-66.2	-40	-178.8	-73.5	176.5	-73.8	177.3	-9.6	111.9	N26 S27 D29 A30 I136 D140	N26-R138 PolarHBondContact OD1-NH1 2.75Å; N26-R138 PolarHBondContact OD1-NH2 3.05Å; S27-R138 PolarHBondContact O-NH2 3.26Å; D29-R138 PolarHBondContact O-N 3.48Å; A30-R138 PolarHBondContact O-NH2 2.04Å; I136-R138 HydrophobicContact CG2-CG 4.32Å; I136-R138 PolarHBondContact O-N 2.95Å; R138-D140 PolarHBondContact O-N 2.86Å
139	R	68.5	Low	78.5	Confident	59 Å²	59	58.1 Å²	58.1	22%	0.223	29%	0.291	C	S	.	.			trans	27.1	76.7	176.4	-159.6	-170.8	-173.6	141.2	5.7	115.1	D29 F108 K110	D29-R139 PolarHBondContact O-N 2.74Å; F108-R139 PolarHBondContact O-NH1 2.84Å; K110-R139 HydrophobicContact CD-CB 4.43Å; K110-R139 WeakPolarHBondContact CD-O 3.01Å; K110-R139 WeakPolarHBondContact CE-O 3.06Å; K110-R139 HydrophobicContact CG-CB 4.14Å; K110-R139 PolarHBondContact NZ-O 2.74Å
140	D	63.3	Low	78.6	Confident	136 Å²	136	59.8 Å²	59.8	73%	0.727	30%	0.301	S	S	*	.			trans	-121.1	102	143	-86.2	-55.9	0	0	0	108.1	K110 R138	K110-D140 IonicContact NZ-OD1 2.69Å; K110-D140 PolarHBondContact NZ-OD1 2.94Å; K110-D140 IonicContact NZ-OD2 3.98Å; K110-D140 PolarHBondContact NZ-OD2 2.63Å; R138-D140 PolarHBondContact O-N 2.86Å
141	V	56.4	Low	78.3	Confident	63 Å²	63	64.6 Å²	64.6	38%	0.382	33%	0.325	S	S	.	.			trans	-145	115.7	177.3	-170.9	0	0	0	0	104.4	R55	R55-V141 VanDerWaalsContact CZ-CG1 3.49Å; R55-V141 VanDerWaalsContact NH2-CG1 3.35Å; R55-V141 PolarHBondContact NH2-O 3.44Å
142	N	47.1	Very low	77.6	Confident	213 Å²	213	70.5 Å²	70.5	100%	1.139	35%	0.354	S	S	*	.			trans	-60.7	0	174.1	-66	-9.7	0	0	0	112.4	R55	R55-N142 PolarHBondContact NH2-O 3.3Å

Retrieved 142 of 142 residues in 228 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).