A0A087WR00_MOUSE Loading...

BCL2-related ovarian killer

AlphaFold DB , UniProt , Accession A0A087WR00, Species MOUSE (Mus musculus, Mouse), Gene Bok, Length 121 aa.

						>A0A087WR00_MOUSE|A0A087WR00|Bok
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERASPAPGGRLAEVCTVLLRLGDELEQIRPSVYRNVARQLHIPLQSEPVVTDAFLAVAGHIFSAGITW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.3	Low	61.7	Low	210 Å²	210	120.6 Å²	120.6	100%	1.034	61%	0.607	S	S	*	*				0	-14.1	0	-106.4	-164.5	-96.5	0	0	114	V3 R5	M1-V3 PolarHBondContact O-N 2.87Å; M1-R5 PolarHBondContact O-N 3.26Å
2	E	55	Low	62.4	Low	143 Å²	143	114.9 Å²	114.9	67%	0.668	59%	0.592	S	S	*	*	H	α-helix	trans	-56.3	-42	179.1	-149.9	94.2	-170.4	0	0	114.8	R5 R6	E2-R5 PolarHBondContact O-N 2.97Å; E2-R6 WeakPolarHBondContact O-CG 3.24Å; E2-R6 PolarHBondContact O-N 2.73Å
3	V	56.5	Low	62.9	Low	112 Å²	112	115.6 Å²	115.6	68%	0.679	59%	0.591	S	S	*	*	H	α-helix	trans	-68.4	-42	-171.9	-158.7	0	0	0	0	111.3	M1 R5 R6 S7	M1-V3 PolarHBondContact O-N 2.87Å; V3-R5 VanDerWaalsContact C-N 3.32Å; V3-R5 PolarHBondContact O-N 2.87Å; V3-R6 PolarHBondContact O-N 3.42Å; V3-S7 PolarHBondContact O-N 3.08Å; V3-S7 PolarHBondContact O-OG 3.42Å; V3-S7 VanDerWaalsContact O-OG 3.05Å
4	L	56.4	Low	63.3	Low	134 Å²	134	112.2 Å²	112.2	70%	0.702	57%	0.574	S	S	*	*	H	α-helix	trans	-64.8	-36.6	175	-72	162.9	0	0	0	111.8	S7 S8	L4-S7 PolarHBondContact O-N 3.22Å; L4-S8 PolarHBondContact O-N 3.2Å; L4-S8 PolarHBondContact O-OG 2.98Å
5	R	60.7	Low	63.5	Low	170 Å²	170	112.8 Å²	112.8	64%	0.642	58%	0.576	S	S	*	*	H	α-helix	trans	-70.6	-36.5	177.6	-148.8	-169.3	87	82.1	0.4	112.5	M1 E2 V3 S8 V9	M1-R5 PolarHBondContact O-N 3.26Å; E2-R5 PolarHBondContact O-N 2.97Å; V3-R5 VanDerWaalsContact C-N 3.32Å; V3-R5 PolarHBondContact O-N 2.87Å; R5-S8 WeakPolarHBondContact CA-OG 3.41Å; R5-S8 PolarHBondContact O-OG 3.42Å; R5-V9 VanDerWaalsContact O-CG2 3.26Å; R5-V9 WeakPolarHBondContact O-CG2 3.47Å; R5-V9 PolarHBondContact O-N 3.34Å; R5-V9 VanDerWaalsContact O-N 3.14Å
6	R	60	Low	63.7	Low	190 Å²	190	110 Å²	110	72%	0.717	56%	0.562	S	S	*	*	H	α-helix	trans	-69	-40	173.9	-70.9	176.3	79.5	169.6	4	111.3	E2 V3 V9 F10	E2-R6 WeakPolarHBondContact O-CG 3.24Å; E2-R6 PolarHBondContact O-N 2.73Å; V3-R6 PolarHBondContact O-N 3.42Å; R6-V9 PolarHBondContact O-N 2.99Å; R6-F10 WeakPolarHBondContact O-CB 3.27Å; R6-F10 PolarHBondContact O-N 3.48Å; R6-F10 VanDerWaalsContact O-N 3.09Å
7	S	61.3	Low	63.5	Low	72 Å²	72	106.8 Å²	106.8	50%	0.503	56%	0.556	S	S	.	*	H	α-helix	trans	-65.3	-37.5	174.4	-59.7	0	0	0	0	112.9	V3 L4 A11	V3-S7 PolarHBondContact O-N 3.08Å; V3-S7 PolarHBondContact O-OG 3.42Å; V3-S7 VanDerWaalsContact O-OG 3.05Å; L4-S7 PolarHBondContact O-N 3.22Å; S7-A11 WeakPolarHBondContact O-CB 3.4Å; S7-A11 PolarHBondContact O-N 2.74Å
8	S	64	Low	63.3	Low	64 Å²	64	109.4 Å²	109.4	45%	0.448	56%	0.563	S	S	.	*	H	α-helix	trans	-72.4	-33.9	178.1	62.5	0	0	0	0	113.4	L4 R5 A12	L4-S8 PolarHBondContact O-N 3.2Å; L4-S8 PolarHBondContact O-OG 2.98Å; R5-S8 WeakPolarHBondContact CA-OG 3.41Å; R5-S8 PolarHBondContact O-OG 3.42Å; S8-A12 WeakPolarHBondContact O-CB 3.45Å; S8-A12 PolarHBondContact O-N 3.15Å
9	V	69	Low	63.3	Low	59 Å²	59	111.1 Å²	111.1	36%	0.358	57%	0.573	S	S	.	*	H	α-helix	trans	-68.7	-44.7	174.8	170.8	0	0	0	0	110.4	R5 R6 A11 A12 E13	R5-V9 VanDerWaalsContact O-CG2 3.26Å; R5-V9 WeakPolarHBondContact O-CG2 3.47Å; R5-V9 PolarHBondContact O-N 3.34Å; R5-V9 VanDerWaalsContact O-N 3.14Å; R6-V9 PolarHBondContact O-N 2.99Å; V9-A11 VanDerWaalsContact C-N 3.35Å; V9-A11 PolarHBondContact O-N 3.1Å; V9-A12 PolarHBondContact O-N 3.24Å; V9-E13 WeakPolarHBondContact O-CG 3.28Å; V9-E13 PolarHBondContact O-N 3.16Å
10	F	67.6	Low	63.5	Low	129 Å²	129	114.7 Å²	114.7	57%	0.566	58%	0.579	S	S	*	*	H	α-helix	trans	-62.1	-41.3	175.1	-177	-110.6	0	0	0	112.4	R6 A12 E13 I14	R6-F10 WeakPolarHBondContact O-CB 3.27Å; R6-F10 PolarHBondContact O-N 3.48Å; R6-F10 VanDerWaalsContact O-N 3.09Å; F10-A12 VanDerWaalsContact C-N 3.34Å; F10-A12 PolarHBondContact O-N 2.91Å; F10-E13 PolarHBondContact O-N 2.88Å; F10-I14 HydrophobicContact CD1-CD1 3.76Å; F10-I14 HydrophobicContact CE1-CD1 3.31Å; F10-I14 HydrophobicContact CE1-CG1 4.41Å; F10-I14 HydrophobicContact CE2-CD1 4.17Å; F10-I14 HydrophobicContact CG-CD1 4.37Å; F10-I14 HydrophobicContact CZ-CD1 3.55Å; F10-I14 HydrophobicContact CZ-CG1 4.36Å; F10-I14 WeakPolarHBondContact O-CG1 3.42Å; F10-I14 PolarHBondContact O-N 3.25Å
11	A	70.4	Confident	64.3	Low	44 Å²	44	112.1 Å²	112.1	36%	0.364	57%	0.572	S	S	.	*	H	α-helix	trans	-63.7	-38.4	174.1	0	0	0	0	0	112.4	S7 V9 I14 M15	S7-A11 WeakPolarHBondContact O-CB 3.4Å; S7-A11 PolarHBondContact O-N 2.74Å; V9-A11 VanDerWaalsContact C-N 3.35Å; V9-A11 PolarHBondContact O-N 3.1Å; A11-I14 PolarHBondContact O-N 3.01Å; A11-M15 WeakPolarHBondContact O-CG 3.32Å; A11-M15 PolarHBondContact O-N 3.21Å
12	A	70.8	Confident	65.6	Low	52 Å²	52	105 Å²	105	43%	0.43	54%	0.541	S	S	.	.	H	α-helix	trans	-67.9	-39.6	175.9	0	0	0	0	0	112.5	S8 V9 F10 M15 D16	S8-A12 WeakPolarHBondContact O-CB 3.45Å; S8-A12 PolarHBondContact O-N 3.15Å; V9-A12 PolarHBondContact O-N 3.24Å; F10-A12 VanDerWaalsContact C-N 3.34Å; F10-A12 PolarHBondContact O-N 2.91Å; A12-M15 PolarHBondContact O-N 3.26Å; A12-D16 WeakPolarHBondContact O-CB 3.48Å; A12-D16 PolarHBondContact O-N 2.88Å
13	E	68.9	Low	67.3	Low	124 Å²	124	101.8 Å²	101.8	58%	0.579	53%	0.531	S	S	*	.	H	α-helix	trans	-64.8	-40	174.3	-75	175	176.5	0	0	112.1	V9 F10 A17	V9-E13 WeakPolarHBondContact O-CG 3.28Å; V9-E13 PolarHBondContact O-N 3.16Å; F10-E13 PolarHBondContact O-N 2.88Å; E13-A17 VanDerWaalsContact O-CB 3.27Å; E13-A17 WeakPolarHBondContact O-CB 3.31Å; E13-A17 PolarHBondContact O-N 2.84Å
14	I	67.8	Low	69.1	Low	68 Å²	68	102.7 Å²	102.7	35%	0.349	53%	0.532	S	S	.	.	H	α-helix	trans	-63.4	-47	174.4	-73.1	174.6	0	0	0	110.4	F10 A11 A17 F18	F10-I14 HydrophobicContact CD1-CD1 3.76Å; F10-I14 HydrophobicContact CE1-CD1 3.31Å; F10-I14 HydrophobicContact CE1-CG1 4.41Å; F10-I14 HydrophobicContact CE2-CD1 4.17Å; F10-I14 HydrophobicContact CG-CD1 4.37Å; F10-I14 HydrophobicContact CZ-CD1 3.55Å; F10-I14 HydrophobicContact CZ-CG1 4.36Å; F10-I14 WeakPolarHBondContact O-CG1 3.42Å; F10-I14 PolarHBondContact O-N 3.25Å; A11-I14 PolarHBondContact O-N 3.01Å; I14-A17 WeakPolarHBondContact O-CB 3.23Å; I14-A17 PolarHBondContact O-N 3.05Å; I14-F18 HydrophobicContact CG2-CD2 3.64Å; I14-F18 HydrophobicContact CG2-CE2 3.54Å; I14-F18 WeakPolarHBondContact O-CD2 3.34Å; I14-F18 PolarHBondContact O-N 2.92Å
15	M	66.7	Low	70.8	Confident	121 Å²	121	104.8 Å²	104.8	60%	0.596	54%	0.536	S	S	*	.	H	α-helix	trans	-63.7	-43	178.6	-71.4	-164.6	-60.7	0	0	112.1	A11 A12 A17 F18 D19	A11-M15 WeakPolarHBondContact O-CG 3.32Å; A11-M15 PolarHBondContact O-N 3.21Å; A12-M15 PolarHBondContact O-N 3.26Å; M15-A17 VanDerWaalsContact C-N 3.29Å; M15-A17 PolarHBondContact O-N 3.17Å; M15-F18 PolarHBondContact O-N 2.76Å; M15-D19 PolarHBondContact O-N 2.88Å
16	D	66.1	Low	72.3	Confident	68 Å²	68	101.3 Å²	101.3	36%	0.364	53%	0.527	S	S	.	.	H	α-helix	trans	-64.5	-32.1	174.8	-174	41.1	0	0	0	112	A12 R20	A12-D16 WeakPolarHBondContact O-CB 3.48Å; A12-D16 PolarHBondContact O-N 2.88Å; D16-R20 WeakPolarHBondContact O-CB 3.43Å; D16-R20 VanDerWaalsContact O-CG 3.23Å; D16-R20 WeakPolarHBondContact O-CG 3.49Å; D16-R20 PolarHBondContact O-N 3.42Å; D16-R20 VanDerWaalsContact O-N 3.15Å; D16-R20 IonicContact OD1-CZ 3.25Å; D16-R20 VanDerWaalsContact OD1-CZ 3.25Å; D16-R20 IonicContact OD1-NE 2.91Å; D16-R20 PolarHBondContact OD1-NE 2.99Å; D16-R20 IonicContact OD1-NH2 2.91Å; D16-R20 PolarHBondContact OD1-NH2 3.11Å; D16-R20 IonicContact OD2-CZ 3.08Å; D16-R20 IonicContact OD2-NE 3.45Å; D16-R20 PolarHBondContact OD2-NE 3.27Å; D16-R20 IonicContact OD2-NH1 3.72Å; D16-R20 IonicContact OD2-NH2 2.69Å; D16-R20 PolarHBondContact OD2-NH2 3.37Å
17	A	61.3	Low	73.8	Confident	56 Å²	56	96.2 Å²	96.2	46%	0.463	51%	0.513	S	S	.	.	H	α-helix	trans	-70.6	-36.7	173.1	0	0	0	0	0	112.7	E13 I14 M15 R20 S21	E13-A17 VanDerWaalsContact O-CB 3.27Å; E13-A17 WeakPolarHBondContact O-CB 3.31Å; E13-A17 PolarHBondContact O-N 2.84Å; I14-A17 WeakPolarHBondContact O-CB 3.23Å; I14-A17 PolarHBondContact O-N 3.05Å; M15-A17 VanDerWaalsContact C-N 3.29Å; M15-A17 PolarHBondContact O-N 3.17Å; A17-R20 PolarHBondContact O-N 3.22Å; A17-S21 PolarHBondContact O-N 2.7Å; A17-S21 VanDerWaalsContact O-N 3.11Å; A17-S21 PolarHBondContact O-OG 2.69Å
18	F	59.5	Low	75.4	Confident	153 Å²	153	96.4 Å²	96.4	67%	0.671	51%	0.511	S	S	*	.	H	α-helix	trans	-67.8	-41.5	172.6	-85.1	-71.8	0	0	0	111.6	I14 M15 R20 S21	I14-F18 HydrophobicContact CG2-CD2 3.64Å; I14-F18 HydrophobicContact CG2-CE2 3.54Å; I14-F18 WeakPolarHBondContact O-CD2 3.34Å; I14-F18 PolarHBondContact O-N 2.92Å; M15-F18 PolarHBondContact O-N 2.76Å; F18-R20 PolarHBondContact O-N 3.29Å; F18-S21 VanDerWaalsContact O-CB 3.31Å; F18-S21 WeakPolarHBondContact O-CB 3.47Å; F18-S21 PolarHBondContact O-N 2.76Å; F18-S21 VanDerWaalsContact O-N 3.07Å
19	D	62.9	Low	76.8	Confident	142 Å²	142	96.2 Å²	96.2	76%	0.759	51%	0.514	S	S	*	.	H	α-helix	trans	-66	-23.4	177.7	-73.5	-21.8	0	0	0	112.8	M15	M15-D19 PolarHBondContact O-N 2.88Å
20	R	68.5	Low	77.9	Confident	183 Å²	183	97.2 Å²	97.2	69%	0.691	52%	0.515	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.9	2.9	174.9	-65.3	176.8	-164.6	-173.6	6.1	114	D16 A17 F18	D16-R20 WeakPolarHBondContact O-CB 3.43Å; D16-R20 VanDerWaalsContact O-CG 3.23Å; D16-R20 WeakPolarHBondContact O-CG 3.49Å; D16-R20 PolarHBondContact O-N 3.42Å; D16-R20 VanDerWaalsContact O-N 3.15Å; D16-R20 IonicContact OD1-CZ 3.25Å; D16-R20 VanDerWaalsContact OD1-CZ 3.25Å; D16-R20 IonicContact OD1-NE 2.91Å; D16-R20 PolarHBondContact OD1-NE 2.99Å; D16-R20 IonicContact OD1-NH2 2.91Å; D16-R20 PolarHBondContact OD1-NH2 3.11Å; D16-R20 IonicContact OD2-CZ 3.08Å; D16-R20 IonicContact OD2-NE 3.45Å; D16-R20 PolarHBondContact OD2-NE 3.27Å; D16-R20 IonicContact OD2-NH1 3.72Å; D16-R20 IonicContact OD2-NH2 2.69Å; D16-R20 PolarHBondContact OD2-NH2 3.37Å; A17-R20 PolarHBondContact O-N 3.22Å; F18-R20 PolarHBondContact O-N 3.29Å
21	S	78.9	Confident	79.2	Confident	61 Å²	61	94 Å²	94	43%	0.427	51%	0.511	S	S	.	.	S	Bend	trans	-68	133.7	179.4	-71.3	0	0	0	0	109.7	A17 F18 T23	A17-S21 PolarHBondContact O-N 2.7Å; A17-S21 VanDerWaalsContact O-N 3.11Å; A17-S21 PolarHBondContact O-OG 2.69Å; F18-S21 VanDerWaalsContact O-CB 3.31Å; F18-S21 WeakPolarHBondContact O-CB 3.47Å; F18-S21 PolarHBondContact O-N 2.76Å; F18-S21 VanDerWaalsContact O-N 3.07Å; S21-T23 PolarHBondContact O-N 2.64Å
22	P	84.8	Confident	80.3	Confident	60 Å²	60	99 Å²	99	39%	0.39	53%	0.525	S	S	.	.	P	Polyproline II helix	trans	-62.8	137	-179	27.3	-34.8	0	0	0	109.6	E26 L27	P22-E26 WeakPolarHBondContact CA-OE2 3.43Å; P22-E26 HydrophobicContact CB-CB 4.2Å; P22-L27 HydrophobicContact CB-CD2 4.04Å; P22-L27 HydrophobicContact CB-CG 4.07Å; P22-L27 HydrophobicContact CG-CD1 4.44Å; P22-L27 HydrophobicContact CG-CD2 3.6Å; P22-L27 HydrophobicContact CG-CG 3.96Å
23	T	92.1	Very high	81.3	Confident	76 Å²	76	97.1 Å²	97.1	47%	0.466	51%	0.51	S	S	.	.	P	Polyproline II helix	trans	-65.7	157.5	173	62.6	0	0	0	0	110.7	S21 K25 E26 L27	S21-T23 PolarHBondContact O-N 2.64Å; T23-K25 PolarHBondContact O-N 3.47Å; T23-K25 VanDerWaalsContact O-N 3.1Å; T23-E26 PolarHBondContact N-OE2 3Å; T23-E26 WeakPolarHBondContact O-CA 3.34Å; T23-E26 WeakPolarHBondContact O-CB 3.47Å; T23-E26 PolarHBondContact O-N 3.47Å; T23-E26 VanDerWaalsContact OG1-CG 3.31Å; T23-E26 WeakPolarHBondContact OG1-CG 3.33Å; T23-E26 PolarHBondContact OG1-N 3.05Å; T23-E26 PolarHBondContact OG1-OE2 3.15Å; T23-L27 PolarHBondContact O-N 3.47Å
24	D	93.3	Very high	82.5	Confident	131 Å²	131	92.5 Å²	92.5	70%	0.701	49%	0.489	S	S	*	.	H	α-helix	trans	-51.6	-37.4	172.9	-67.1	0.3	0	0	0	112.2	L27 V28	D24-L27 PolarHBondContact O-N 3.24Å; D24-V28 WeakPolarHBondContact O-CB 3.37Å; D24-V28 WeakPolarHBondContact O-CG2 3.45Å; D24-V28 PolarHBondContact O-N 2.98Å
25	K	92.3	Very high	83.8	Confident	178 Å²	178	91 Å²	91	77%	0.774	49%	0.49	S	S	*	.	H	α-helix	trans	-64.4	-41.7	177.7	-69.5	-178.5	179.8	175.5	0	111.9	T23 A29	T23-K25 PolarHBondContact O-N 3.47Å; T23-K25 VanDerWaalsContact O-N 3.1Å; K25-A29 WeakPolarHBondContact O-CB 3.33Å; K25-A29 PolarHBondContact O-N 3.17Å
26	E	91.5	Very high	85	Confident	96 Å²	96	88.6 Å²	88.6	45%	0.449	47%	0.474	S	S	.	.	H	α-helix	trans	-69	-43.3	176.9	-72	165.4	142.1	0	0	111.2	P22 T23 V28 A29 Q30	P22-E26 WeakPolarHBondContact CA-OE2 3.43Å; P22-E26 HydrophobicContact CB-CB 4.2Å; T23-E26 PolarHBondContact N-OE2 3Å; T23-E26 WeakPolarHBondContact O-CA 3.34Å; T23-E26 WeakPolarHBondContact O-CB 3.47Å; T23-E26 PolarHBondContact O-N 3.47Å; T23-E26 VanDerWaalsContact OG1-CG 3.31Å; T23-E26 WeakPolarHBondContact OG1-CG 3.33Å; T23-E26 PolarHBondContact OG1-N 3.05Å; T23-E26 PolarHBondContact OG1-OE2 3.15Å; E26-V28 PolarHBondContact O-N 3.44Å; E26-A29 PolarHBondContact O-N 3.36Å; E26-Q30 WeakPolarHBondContact O-CB 3.4Å; E26-Q30 VanDerWaalsContact O-CG 3.23Å; E26-Q30 WeakPolarHBondContact O-CG 3.48Å; E26-Q30 PolarHBondContact O-N 3.5Å
27	L	93.1	Very high	86.2	Confident	83 Å²	83	86.3 Å²	86.3	44%	0.435	46%	0.462	S	S	.	.	H	α-helix	trans	-59	-46.2	175	-70.8	175.4	0	0	0	111.4	P22 T23 D24 A29 Q30 A31	P22-L27 HydrophobicContact CB-CD2 4.04Å; P22-L27 HydrophobicContact CB-CG 4.07Å; P22-L27 HydrophobicContact CG-CD1 4.44Å; P22-L27 HydrophobicContact CG-CD2 3.6Å; P22-L27 HydrophobicContact CG-CG 3.96Å; T23-L27 PolarHBondContact O-N 3.47Å; D24-L27 PolarHBondContact O-N 3.24Å; L27-A29 PolarHBondContact O-N 3.3Å; L27-Q30 PolarHBondContact O-N 3.24Å; L27-A31 VanDerWaalsContact O-CB 3.26Å; L27-A31 WeakPolarHBondContact O-CB 3.47Å; L27-A31 PolarHBondContact O-N 3.12Å
28	V	94.9	Very high	87.7	Confident	76 Å²	76	86.5 Å²	86.5	46%	0.461	45%	0.451	S	S	.	.	H	α-helix	trans	-63	-41.5	176.4	169.8	0	0	0	0	111.3	D24 E26 K32	D24-V28 WeakPolarHBondContact O-CB 3.37Å; D24-V28 WeakPolarHBondContact O-CG2 3.45Å; D24-V28 PolarHBondContact O-N 2.98Å; E26-V28 PolarHBondContact O-N 3.44Å; V28-K32 HydrophobicContact CG1-CD 4.05Å; V28-K32 WeakPolarHBondContact O-CB 3.34Å; V28-K32 VanDerWaalsContact O-CG 3.25Å; V28-K32 WeakPolarHBondContact O-CG 3.28Å; V28-K32 PolarHBondContact O-N 2.97Å
29	A	91.8	Very high	89.3	Confident	60 Å²	60	83.3 Å²	83.3	50%	0.496	44%	0.443	S	S	.	.	H	α-helix	trans	-64.5	-44.5	177.7	0	0	0	0	0	111.9	K25 E26 L27 K32 A33	K25-A29 WeakPolarHBondContact O-CB 3.33Å; K25-A29 PolarHBondContact O-N 3.17Å; E26-A29 PolarHBondContact O-N 3.36Å; L27-A29 PolarHBondContact O-N 3.3Å; A29-K32 PolarHBondContact O-N 3.13Å; A29-A33 PolarHBondContact O-N 2.89Å
30	Q	93	Very high	90.6	Very high	81 Å²	81	78.6 Å²	78.6	38%	0.379	42%	0.417	S	S	.	.	H	α-helix	trans	-64.2	-46.9	176.8	-70	172.9	14.2	0	0	111.4	E26 L27 K32 A33 L34 L64	E26-Q30 WeakPolarHBondContact O-CB 3.4Å; E26-Q30 VanDerWaalsContact O-CG 3.23Å; E26-Q30 WeakPolarHBondContact O-CG 3.48Å; E26-Q30 PolarHBondContact O-N 3.5Å; L27-Q30 PolarHBondContact O-N 3.24Å; Q30-K32 VanDerWaalsContact C-N 3.34Å; Q30-K32 PolarHBondContact O-N 3.42Å; Q30-A33 WeakPolarHBondContact O-CB 3.31Å; Q30-A33 PolarHBondContact O-N 2.97Å; Q30-A33 VanDerWaalsContact O-N 3.17Å; Q30-L34 WeakPolarHBondContact O-CG 3.24Å; Q30-L34 PolarHBondContact O-N 3.37Å; Q30-L64 HydrophobicContact CB-CD1 3.91Å; Q30-L64 HydrophobicContact CB-CD2 4.49Å; Q30-L64 HydrophobicContact CG-CD1 4.02Å; Q30-L64 HydrophobicContact CG-CD2 4.2Å
31	A	94.8	Very high	91.6	Very high	60 Å²	60	71.2 Å²	71.2	50%	0.496	40%	0.395	S	S	.	.	H	α-helix	trans	-60.3	-42.2	177.5	0	0	0	0	0	112.1	L27 L34 G35	L27-A31 VanDerWaalsContact O-CB 3.26Å; L27-A31 WeakPolarHBondContact O-CB 3.47Å; L27-A31 PolarHBondContact O-N 3.12Å; A31-L34 PolarHBondContact O-N 3.45Å; A31-G35 PolarHBondContact O-N 2.99Å
32	K	94.1	Very high	92.2	Very high	149 Å²	149	70.1 Å²	70.1	65%	0.648	38%	0.381	S	S	*	.	H	α-helix	trans	-62.7	-41.3	174.7	-76.9	176.3	179.1	-178.9	0	112.3	V28 A29 Q30 R36	V28-K32 HydrophobicContact CG1-CD 4.05Å; V28-K32 WeakPolarHBondContact O-CB 3.34Å; V28-K32 VanDerWaalsContact O-CG 3.25Å; V28-K32 WeakPolarHBondContact O-CG 3.28Å; V28-K32 PolarHBondContact O-N 2.97Å; A29-K32 PolarHBondContact O-N 3.13Å; Q30-K32 VanDerWaalsContact C-N 3.34Å; Q30-K32 PolarHBondContact O-N 3.42Å; K32-R36 WeakPolarHBondContact O-CB 3.39Å; K32-R36 PolarHBondContact O-N 2.93Å; K32-R36 VanDerWaalsContact O-N 3.11Å
33	A	91.8	Very high	92.5	Very high	14 Å²	14	70.9 Å²	70.9	12%	0.116	38%	0.382	C	S	.	.	H	α-helix	trans	-63.4	-51.5	176.4	0	0	0	0	0	110.7	A29 Q30 G35 R36 E37 L64	A29-A33 PolarHBondContact O-N 2.89Å; Q30-A33 WeakPolarHBondContact O-CB 3.31Å; Q30-A33 PolarHBondContact O-N 2.97Å; Q30-A33 VanDerWaalsContact O-N 3.17Å; A33-G35 PolarHBondContact O-N 3.5Å; A33-R36 PolarHBondContact O-N 3.49Å; A33-E37 WeakPolarHBondContact O-CG 3.5Å; A33-E37 PolarHBondContact O-N 2.94Å; A33-L64 HydrophobicContact CB-CD2 4.22Å
34	L	94.3	Very high	92.3	Very high	26 Å²	26	71.3 Å²	71.3	14%	0.136	38%	0.381	C	S	.	.	H	α-helix	trans	-59.5	-47.1	179.1	-67.9	170.7	0	0	0	112.4	Q30 A31 R36 E37 Y38 L64 V67 C68 L71	Q30-L34 WeakPolarHBondContact O-CG 3.24Å; Q30-L34 PolarHBondContact O-N 3.37Å; A31-L34 PolarHBondContact O-N 3.45Å; L34-R36 VanDerWaalsContact C-N 3.33Å; L34-R36 PolarHBondContact O-N 3.32Å; L34-E37 PolarHBondContact O-N 3.22Å; L34-Y38 WeakPolarHBondContact O-CB 3.38Å; L34-Y38 PolarHBondContact O-N 2.69Å; L34-L64 HydrophobicContact CD1-CD1 3.95Å; L34-L64 HydrophobicContact CD2-CD1 3.94Å; L34-L64 HydrophobicContact CD2-CG 4.44Å; L34-L64 HydrophobicContact CG-CD1 3.87Å; L34-V67 HydrophobicContact CD1-CG1 3.94Å; L34-V67 HydrophobicContact CD2-CG1 4.13Å; L34-C68 HydrophobicContact CD2-CB 3.65Å; L34-L71 HydrophobicContact CB-CD2 4.03Å; L34-L71 HydrophobicContact CD2-CD2 4.47Å
35	G	94.2	Very high	92.1	Very high	36 Å²	36	71.3 Å²	71.3	37%	0.371	37%	0.371	S	S	.	.	H	α-helix	trans	-61.3	-40.1	178.9	0	0	0	0	0	112.8	A31 A33 Y38 V39	A31-G35 PolarHBondContact O-N 2.99Å; A33-G35 PolarHBondContact O-N 3.5Å; G35-Y38 PolarHBondContact O-N 3.07Å; G35-V39 WeakPolarHBondContact O-CG2 3.35Å; G35-V39 PolarHBondContact O-N 3.37Å
36	R	92	Very high	92	Very high	71 Å²	71	66 Å²	66	27%	0.268	36%	0.36	S	S	.	.	H	α-helix	trans	-63.7	-49.1	175.9	-177.2	-171.6	65.3	-122.8	2.3	111.7	K32 A33 L34 Y38 V39 H40 A56	K32-R36 WeakPolarHBondContact O-CB 3.39Å; K32-R36 PolarHBondContact O-N 2.93Å; K32-R36 VanDerWaalsContact O-N 3.11Å; A33-R36 PolarHBondContact O-N 3.49Å; L34-R36 VanDerWaalsContact C-N 3.33Å; L34-R36 PolarHBondContact O-N 3.32Å; R36-Y38 VanDerWaalsContact C-N 3.3Å; R36-Y38 PolarHBondContact O-N 3.2Å; R36-V39 PolarHBondContact O-N 3.19Å; R36-H40 VanDerWaalsContact O-CB 3.3Å; R36-H40 WeakPolarHBondContact O-CB 3.46Å; R36-H40 PolarHBondContact O-N 2.88Å; R36-A56 PolarHBondContact NH2-O 3.17Å
37	E	91.2	Very high	91.9	Very high	21 Å²	21	64.3 Å²	64.3	10%	0.098	37%	0.369	C	S	.	.	H	α-helix	trans	-63.3	-38.8	178.7	-61	-53.1	126.4	0	0	111.2	A33 L34 H40 A41 S57 P58	A33-E37 WeakPolarHBondContact O-CG 3.5Å; A33-E37 PolarHBondContact O-N 2.94Å; L34-E37 PolarHBondContact O-N 3.22Å; E37-H40 PolarHBondContact O-N 3.28Å; E37-A41 WeakPolarHBondContact O-CB 3.43Å; E37-A41 PolarHBondContact O-N 3.06Å; E37-S57 VanDerWaalsContact CD-OG 3.27Å; E37-S57 PolarHBondContact OE2-OG 3.24Å; E37-P58 HydrophobicContact CG-CG 4.31Å
38	Y	93.6	Very high	91.5	Very high	60 Å²	60	66 Å²	66	24%	0.235	38%	0.377	C	S	.	.	H	α-helix	trans	-60.6	-50.2	176.9	-166.8	-86.5	0	0	0	112.1	L34 G35 R36 A41 R42 L71 L72 G75	L34-Y38 WeakPolarHBondContact O-CB 3.38Å; L34-Y38 PolarHBondContact O-N 2.69Å; G35-Y38 PolarHBondContact O-N 3.07Å; R36-Y38 VanDerWaalsContact C-N 3.3Å; R36-Y38 PolarHBondContact O-N 3.2Å; Y38-A41 PolarHBondContact O-N 2.98Å; Y38-R42 HydrophobicContact CD1-CG 4.22Å; Y38-R42 HydrophobicContact CE1-CG 4.05Å; Y38-R42 VanDerWaalsContact O-CG 3.24Å; Y38-R42 WeakPolarHBondContact O-CG 3.49Å; Y38-R42 PolarHBondContact O-N 3.45Å; Y38-R42 VanDerWaalsContact O-N 3.13Å; Y38-R42 PolarHBondContact OH-NH2 3.42Å; Y38-L71 HydrophobicContact CD2-CD2 4.15Å; Y38-L71 HydrophobicContact CD2-CG 3.91Å; Y38-L71 HydrophobicContact CE2-CG 4.3Å; Y38-L72 HydrophobicContact CD2-CD2 3.84Å; Y38-L72 HydrophobicContact CE2-CD2 4.48Å; Y38-L72 HydrophobicContact CG-CD2 4.38Å; Y38-G75 VanDerWaalsContact OH-CA 3.31Å; Y38-G75 WeakPolarHBondContact OH-CA 3.39Å
39	V	92.4	Very high	90.5	Very high	85 Å²	85	66.1 Å²	66.1	52%	0.515	38%	0.382	S	S	.	.	H	α-helix	trans	-63.3	-43.6	176.7	173.3	0	0	0	0	110.8	G35 R36 A41 R42 L43	G35-V39 WeakPolarHBondContact O-CG2 3.35Å; G35-V39 PolarHBondContact O-N 3.37Å; R36-V39 PolarHBondContact O-N 3.19Å; V39-A41 PolarHBondContact O-N 2.94Å; V39-R42 PolarHBondContact O-N 3.48Å; V39-L43 HydrophobicContact CG1-CD1 3.91Å; V39-L43 HydrophobicContact CG1-CG 4.29Å; V39-L43 WeakPolarHBondContact O-CG 3.49Å; V39-L43 PolarHBondContact O-N 3.3Å
40	H	89.7	Confident	89.3	Confident	44 Å²	44	73.8 Å²	73.8	20%	0.204	40%	0.398	C	S	.	.	H	α-helix	trans	-60.5	-47.7	179.2	-175.7	61.6	0	0	0	112	R36 E37 R42 L43 L44	R36-H40 VanDerWaalsContact O-CB 3.3Å; R36-H40 WeakPolarHBondContact O-CB 3.46Å; R36-H40 PolarHBondContact O-N 2.88Å; E37-H40 PolarHBondContact O-N 3.28Å; H40-R42 VanDerWaalsContact C-N 3.27Å; H40-R42 PolarHBondContact O-N 2.92Å; H40-L43 PolarHBondContact O-N 3.25Å; H40-L44 WeakPolarHBondContact NE2-CD1 3.3Å; H40-L44 WeakPolarHBondContact O-CG 2.99Å; H40-L44 PolarHBondContact O-N 2.98Å
41	A	90.7	Very high	87.6	Confident	28 Å²	28	74.5 Å²	74.5	23%	0.231	41%	0.412	C	S	.	.	H	α-helix	trans	-59.1	-38.3	176.7	0	0	0	0	0	112.2	E37 Y38 V39 R45 L72	E37-A41 WeakPolarHBondContact O-CB 3.43Å; E37-A41 PolarHBondContact O-N 3.06Å; Y38-A41 PolarHBondContact O-N 2.98Å; V39-A41 PolarHBondContact O-N 2.94Å; A41-R45 WeakPolarHBondContact O-CB 3.33Å; A41-R45 PolarHBondContact O-N 3.04Å; A41-L72 HydrophobicContact CB-CD1 4.44Å; A41-L72 HydrophobicContact CB-CD2 3.59Å
42	R	91.3	Very high	85.7	Confident	38 Å²	38	75.5 Å²	75.5	14%	0.143	42%	0.42	C	S	.	.	H	α-helix	trans	-67.8	-40.6	176.2	-69.3	-71.8	-176.9	-103.9	14.2	112.6	Y38 V39 H40 R45 A46 G75 D76 E79	Y38-R42 HydrophobicContact CD1-CG 4.22Å; Y38-R42 HydrophobicContact CE1-CG 4.05Å; Y38-R42 VanDerWaalsContact O-CG 3.24Å; Y38-R42 WeakPolarHBondContact O-CG 3.49Å; Y38-R42 PolarHBondContact O-N 3.45Å; Y38-R42 VanDerWaalsContact O-N 3.13Å; Y38-R42 PolarHBondContact OH-NH2 3.42Å; V39-R42 PolarHBondContact O-N 3.48Å; H40-R42 VanDerWaalsContact C-N 3.27Å; H40-R42 PolarHBondContact O-N 2.92Å; R42-R45 PolarHBondContact O-N 3.47Å; R42-A46 WeakPolarHBondContact O-CB 3.26Å; R42-A46 PolarHBondContact O-N 3.3Å; R42-G75 PolarHBondContact NH2-O 3.06Å; R42-D76 IonicContact CZ-OD1 3.07Å; R42-D76 IonicContact NH1-OD1 2.64Å; R42-D76 PolarHBondContact NH1-OD1 3.4Å; R42-D76 VanDerWaalsContact NH2-N 3.18Å; R42-D76 IonicContact NH2-OD1 3.65Å; R42-D76 PolarHBondContact NH2-OD1 3.01Å; R42-E79 IonicContact CZ-OE1 2.76Å; R42-E79 IonicContact NE-OE1 3.55Å; R42-E79 PolarHBondContact NE-OE1 3.17Å; R42-E79 IonicContact NH2-OE1 2.76Å; R42-E79 PolarHBondContact NH2-OE1 3.42Å; R42-E79 IonicContact NH2-OE2 3.62Å
43	L	90.1	Very high	84	Confident	75 Å²	75	70.6 Å²	70.6	39%	0.393	40%	0.403	S	S	.	.	H	α-helix	trans	-66.3	-44	175.4	-69.7	172.1	0	0	0	111.8	V39 H40 R45 A46 G47 L48	V39-L43 HydrophobicContact CG1-CD1 3.91Å; V39-L43 HydrophobicContact CG1-CG 4.29Å; V39-L43 WeakPolarHBondContact O-CG 3.49Å; V39-L43 PolarHBondContact O-N 3.3Å; H40-L43 PolarHBondContact O-N 3.25Å; L43-R45 VanDerWaalsContact C-N 3.35Å; L43-R45 PolarHBondContact O-N 2.93Å; L43-A46 CarbonylContact O-C 3.58Å; L43-A46 PolarHBondContact O-N 3.42Å; L43-A46 VanDerWaalsContact O-N 3.15Å; L43-G47 PolarHBondContact O-N 3.13Å; L43-L48 HydrophobicContact CD2-CB 4.27Å; L43-L48 HydrophobicContact CD2-CD1 4.23Å; L43-L48 PolarHBondContact O-N 3.44Å
44	L	89.1	Confident	82.2	Confident	85 Å²	85	79.8 Å²	79.8	45%	0.445	44%	0.444	S	S	.	.	H	α-helix	trans	-57.3	-47.9	173.9	-73	-179.6	0	0	0	111.2	H40 A46 G47 S49	H40-L44 WeakPolarHBondContact NE2-CD1 3.3Å; H40-L44 WeakPolarHBondContact O-CG 2.99Å; H40-L44 PolarHBondContact O-N 2.98Å; L44-A46 PolarHBondContact O-N 3.34Å; L44-G47 PolarHBondContact O-N 2.87Å; L44-S49 VanDerWaalsContact CD2-CB 3.48Å
45	R	88.8	Confident	80.5	Confident	132 Å²	132	87.9 Å²	87.9	50%	0.498	47%	0.473	S	S	.	.	H	α-helix	trans	-62.1	-31.1	177.6	-170.1	178.8	68.6	-179.3	2.9	112.8	A41 R42 L43 G47 D76 E79	A41-R45 WeakPolarHBondContact O-CB 3.33Å; A41-R45 PolarHBondContact O-N 3.04Å; R42-R45 PolarHBondContact O-N 3.47Å; L43-R45 VanDerWaalsContact C-N 3.35Å; L43-R45 PolarHBondContact O-N 2.93Å; R45-G47 PolarHBondContact O-N 3.32Å; R45-D76 IonicContact CZ-OD1 3.84Å; R45-D76 IonicContact NH1-OD1 2.69Å; R45-D76 PolarHBondContact NH1-OD1 2.92Å; R45-E79 IonicContact CZ-OE2 2.7Å; R45-E79 IonicContact NH1-OE2 2.92Å; R45-E79 IonicContact NH2-OE1 3.2Å; R45-E79 IonicContact NH2-OE2 3.74Å; R45-E79 PolarHBondContact NH2-OE2 3.38Å
46	A	89.1	Confident	78.7	Confident	65 Å²	65	90.6 Å²	90.6	54%	0.537	49%	0.491	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.1	-1.2	175.4	0	0	0	0	0	113.7	R42 L43 L44 L48	R42-A46 WeakPolarHBondContact O-CB 3.26Å; R42-A46 PolarHBondContact O-N 3.3Å; L43-A46 CarbonylContact O-C 3.58Å; L43-A46 PolarHBondContact O-N 3.42Å; L43-A46 VanDerWaalsContact O-N 3.15Å; L44-A46 PolarHBondContact O-N 3.34Å; A46-L48 VanDerWaalsContact C-N 3.25Å; A46-L48 HydrophobicContact CB-CD1 4.05Å; A46-L48 HydrophobicContact CB-CG 4.09Å; A46-L48 PolarHBondContact O-N 3.25Å
47	G	89.2	Confident	77.4	Confident	62 Å²	62	90.3 Å²	90.3	64%	0.639	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.8	15.8	-175.9	0	0	0	0	0	113.9	L43 L44 R45	L43-G47 PolarHBondContact O-N 3.13Å; L44-G47 PolarHBondContact O-N 2.87Å; R45-G47 PolarHBondContact O-N 3.32Å
48	L	86.4	Confident	76.2	Confident	118 Å²	118	90.2 Å²	90.2	62%	0.618	50%	0.502	S	S	*	.			trans	-99.2	33.8	-176.8	-60.7	174.8	0	0	0	111.8	L43 A46 W50	L43-L48 HydrophobicContact CD2-CB 4.27Å; L43-L48 HydrophobicContact CD2-CD1 4.23Å; L43-L48 PolarHBondContact O-N 3.44Å; A46-L48 VanDerWaalsContact C-N 3.25Å; A46-L48 HydrophobicContact CB-CD1 4.05Å; A46-L48 HydrophobicContact CB-CG 4.09Å; A46-L48 PolarHBondContact O-N 3.25Å; L48-W50 PolarHBondContact O-N 3.34Å
49	S	73	Confident	75	Confident	79 Å²	79	90.8 Å²	90.8	55%	0.552	52%	0.519	S	S	*	.	P	Polyproline II helix	trans	-64.4	123.7	-174	65.2	0	0	0	0	111.8	L44	L44-S49 VanDerWaalsContact CD2-CB 3.48Å
50	W	66.5	Low	73.9	Confident	221 Å²	221	93 Å²	93	84%	0.837	54%	0.535	S	S	*	.	P	Polyproline II helix	trans	-94.7	163.8	160.1	-160.1	-85.7	0	0	0	109.2	L48 A52	L48-W50 PolarHBondContact O-N 3.34Å; W50-A52 PolarHBondContact O-N 3.19Å
51	S	56.7	Low	73	Confident	95 Å²	95	94.6 Å²	94.6	66%	0.664	56%	0.563	S	S	*	*	S	Bend	trans	-47.8	140	170.2	47.3	0	0	0	0	110.7
52	A	56	Low	72.8	Confident	81 Å²	81	94.7 Å²	94.7	67%	0.669	57%	0.567	S	S	*	*			trans	-43.9	148.5	-167.6	0	0	0	0	0	114.3	W50 E54	W50-A52 PolarHBondContact O-N 3.19Å; A52-E54 PolarHBondContact O-N 3.39Å
53	P	57.2	Low	72.6	Confident	46 Å²	46	103 Å²	103	30%	0.299	60%	0.598	S	S	.	*			trans	-56	127.6	177.6	21.8	-31.1	0	0	0	110.6	R55	P53-R55 PolarHBondContact O-N 2.93Å
54	E	54.5	Low	72.6	Confident	208 Å²	208	101.7 Å²	101.7	97%	0.972	59%	0.591	S	S	*	*	S	Bend	trans	-61.6	-8.2	-176.5	-136.2	175.8	-167.1	0	0	113.9	A52	A52-E54 PolarHBondContact O-N 3.39Å
55	R	58.9	Low	72.6	Confident	196 Å²	196	98.5 Å²	98.5	74%	0.74	58%	0.577	S	S	*	*	S	Bend	trans	-115.8	138	178.5	-80	-176.7	176.4	163.9	0.8	111.6	P53 S57	P53-R55 PolarHBondContact O-N 2.93Å; R55-S57 PolarHBondContact O-N 3.2Å
56	A	57.2	Low	72.8	Confident	92 Å²	92	98.2 Å²	98.2	76%	0.76	58%	0.581	S	S	*	*	P	Polyproline II helix	trans	-48.2	124.3	-179.3	0	0	0	0	0	112.1	R36	R36-A56 PolarHBondContact NH2-O 3.17Å
57	S	63.1	Low	73.1	Confident	66 Å²	66	98 Å²	98	46%	0.462	57%	0.573	S	S	.	*	P	Polyproline II helix	trans	-54.3	155.1	161.7	-163.4	0	0	0	0	109	E37 R55 A59	E37-S57 VanDerWaalsContact CD-OG 3.27Å; E37-S57 PolarHBondContact OE2-OG 3.24Å; R55-S57 PolarHBondContact O-N 3.2Å; S57-A59 PolarHBondContact O-N 2.94Å
58	P	67.3	Low	73.3	Confident	19 Å²	19	95.6 Å²	95.6	12%	0.123	55%	0.547	C	S	.	.	S	Bend	trans	-47.7	136.5	175	-25.2	33.7	0	0	0	110.5	E37 L64 A65	E37-P58 HydrophobicContact CG-CG 4.31Å; P58-L64 HydrophobicContact CB-CB 4.35Å; P58-L64 HydrophobicContact CB-CD2 4.18Å; P58-L64 HydrophobicContact CB-CG 4.18Å; P58-L64 HydrophobicContact CG-CD2 4.24Å; P58-L64 HydrophobicContact CG-CG 4.27Å; P58-A65 HydrophobicContact CB-CB 4.26Å
59	A	68.6	Low	73.7	Confident	72 Å²	72	94.6 Å²	94.6	60%	0.595	55%	0.546	S	S	*	.	P	Polyproline II helix	trans	-53.4	127	-178.3	0	0	0	0	0	109.9	S57 G61 G62	S57-A59 PolarHBondContact O-N 2.94Å; A59-G61 PolarHBondContact O-N 3.02Å; A59-G62 PolarHBondContact O-N 3.14Å; A59-G62 VanDerWaalsContact O-N 3.12Å
60	P	68	Low	74.8	Confident	132 Å²	132	94.8 Å²	94.8	86%	0.857	54%	0.543	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.1	135.2	-176.7	22.2	-31.1	0	0	0	110.2	G62	P60-G62 VanDerWaalsContact C-N 3.33Å
61	G	71.8	Confident	76.2	Confident	76 Å²	76	87.4 Å²	87.4	78%	0.784	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.6	1.7	-177.6	0	0	0	0	0	115.6	A59	A59-G61 PolarHBondContact O-N 3.02Å
62	G	85.2	Confident	78	Confident	30 Å²	30	84.9 Å²	84.9	31%	0.309	50%	0.499	S	S	.	.	S	Bend	trans	-85.1	157.9	171.4	0	0	0	0	0	113.2	A59 P60 L64 A65 E66	A59-G62 PolarHBondContact O-N 3.14Å; A59-G62 VanDerWaalsContact O-N 3.12Å; P60-G62 VanDerWaalsContact C-N 3.33Å; G62-L64 PolarHBondContact O-N 3.03Å; G62-L64 VanDerWaalsContact O-N 3.14Å; G62-A65 WeakPolarHBondContact O-CA 3.25Å; G62-A65 VanDerWaalsContact O-CB 3.28Å; G62-A65 WeakPolarHBondContact O-CB 3.16Å; G62-A65 PolarHBondContact O-N 3.45Å; G62-E66 PolarHBondContact O-N 2.89Å
63	R	88.4	Confident	79.9	Confident	212 Å²	212	89 Å²	89	80%	0.8	50%	0.497	S	S	*	.	H	α-helix	trans	-51.1	-39	176.9	-176	179.4	-179.7	116.4	-1.6	113.6	A65 E66 V67	R63-A65 VanDerWaalsContact C-N 3.29Å; R63-A65 PolarHBondContact O-N 3.43Å; R63-E66 WeakPolarHBondContact O-CB 3.33Å; R63-E66 PolarHBondContact O-N 2.86Å; R63-V67 WeakPolarHBondContact O-CG2 3.45Å; R63-V67 PolarHBondContact O-N 3.35Å
64	L	89.1	Confident	81.8	Confident	48 Å²	48	90.6 Å²	90.6	25%	0.251	50%	0.503	S	S	.	.	H	α-helix	trans	-67.1	-31.1	178.5	-171.7	65.2	0	0	0	112.3	Q30 A33 L34 P58 G62 C68	Q30-L64 HydrophobicContact CB-CD1 3.91Å; Q30-L64 HydrophobicContact CB-CD2 4.49Å; Q30-L64 HydrophobicContact CG-CD1 4.02Å; Q30-L64 HydrophobicContact CG-CD2 4.2Å; A33-L64 HydrophobicContact CB-CD2 4.22Å; L34-L64 HydrophobicContact CD1-CD1 3.95Å; L34-L64 HydrophobicContact CD2-CD1 3.94Å; L34-L64 HydrophobicContact CD2-CG 4.44Å; L34-L64 HydrophobicContact CG-CD1 3.87Å; P58-L64 HydrophobicContact CB-CB 4.35Å; P58-L64 HydrophobicContact CB-CD2 4.18Å; P58-L64 HydrophobicContact CB-CG 4.18Å; P58-L64 HydrophobicContact CG-CD2 4.24Å; P58-L64 HydrophobicContact CG-CG 4.27Å; G62-L64 PolarHBondContact O-N 3.03Å; G62-L64 VanDerWaalsContact O-N 3.14Å; L64-C68 WeakPolarHBondContact O-CB 3.31Å; L64-C68 PolarHBondContact O-N 3.33Å
65	A	89.8	Confident	83.8	Confident	19 Å²	19	81 Å²	81	16%	0.157	46%	0.459	C	S	.	.	H	α-helix	trans	-68.5	-41	174.1	0	0	0	0	0	111	P58 G62 R63 C68 T69	P58-A65 HydrophobicContact CB-CB 4.26Å; G62-A65 WeakPolarHBondContact O-CA 3.25Å; G62-A65 VanDerWaalsContact O-CB 3.28Å; G62-A65 WeakPolarHBondContact O-CB 3.16Å; G62-A65 PolarHBondContact O-N 3.45Å; R63-A65 VanDerWaalsContact C-N 3.29Å; R63-A65 PolarHBondContact O-N 3.43Å; A65-C68 WeakPolarHBondContact O-CB 3.45Å; A65-C68 PolarHBondContact O-N 3.41Å; A65-T69 PolarHBondContact O-N 3.45Å; A65-T69 PolarHBondContact O-OG1 3.44Å; A65-T69 VanDerWaalsContact O-OG1 3.14Å
66	E	92.9	Very high	85.5	Confident	125 Å²	125	74.2 Å²	74.2	58%	0.584	44%	0.438	S	S	*	.	H	α-helix	trans	-60.8	-46.6	173.8	-63.4	175.7	177	0	0	111.6	G62 R63 C68 T69 V70	G62-E66 PolarHBondContact O-N 2.89Å; R63-E66 WeakPolarHBondContact O-CB 3.33Å; R63-E66 PolarHBondContact O-N 2.86Å; E66-C68 VanDerWaalsContact C-N 3.28Å; E66-C68 PolarHBondContact O-N 2.86Å; E66-T69 WeakPolarHBondContact O-CB 3.49Å; E66-T69 PolarHBondContact O-N 2.84Å; E66-V70 WeakPolarHBondContact O-CG2 3.49Å; E66-V70 PolarHBondContact O-N 2.88Å
67	V	94.6	Very high	87.3	Confident	60 Å²	60	73.1 Å²	73.1	36%	0.364	42%	0.417	S	S	.	.	H	α-helix	trans	-58.9	-41.9	174.7	172.9	0	0	0	0	110.8	L34 R63 V70 L71	L34-V67 HydrophobicContact CD1-CG1 3.94Å; L34-V67 HydrophobicContact CD2-CG1 4.13Å; R63-V67 WeakPolarHBondContact O-CG2 3.45Å; R63-V67 PolarHBondContact O-N 3.35Å; V67-V70 PolarHBondContact O-N 2.91Å; V67-L71 VanDerWaalsContact O-CB 3.31Å; V67-L71 WeakPolarHBondContact O-CB 3.48Å; V67-L71 PolarHBondContact O-N 2.84Å
68	C	93.9	Very high	88.9	Confident	12 Å²	12	73 Å²	73	8%	0.081	41%	0.411	C	S	.	.	H	α-helix	trans	-60.4	-45.9	176.2	-168.5	0	0	0	0	111.7	L34 L64 A65 E66 V70 L71 L72	L34-C68 HydrophobicContact CD2-CB 3.65Å; L64-C68 WeakPolarHBondContact O-CB 3.31Å; L64-C68 PolarHBondContact O-N 3.33Å; A65-C68 WeakPolarHBondContact O-CB 3.45Å; A65-C68 PolarHBondContact O-N 3.41Å; E66-C68 VanDerWaalsContact C-N 3.28Å; E66-C68 PolarHBondContact O-N 2.86Å; C68-V70 PolarHBondContact O-N 3.39Å; C68-L71 PolarHBondContact O-N 3.21Å; C68-L72 WeakPolarHBondContact O-CB 3.34Å; C68-L72 VanDerWaalsContact O-CG 3.28Å; C68-L72 WeakPolarHBondContact O-CG 3.36Å; C68-L72 PolarHBondContact O-N 2.96Å
69	T	94	Very high	90.1	Very high	97 Å²	97	73 Å²	73	60%	0.595	41%	0.409	S	S	*	.	H	α-helix	trans	-59.5	-45.2	176.6	-58.1	0	0	0	0	112	A65 E66 R73	A65-T69 PolarHBondContact O-N 3.45Å; A65-T69 PolarHBondContact O-OG1 3.44Å; A65-T69 VanDerWaalsContact O-OG1 3.14Å; E66-T69 WeakPolarHBondContact O-CB 3.49Å; E66-T69 PolarHBondContact O-N 2.84Å; T69-R73 WeakPolarHBondContact O-CB 3.36Å; T69-R73 PolarHBondContact O-N 3.36Å; T69-R73 VanDerWaalsContact O-N 3.12Å
70	V	96.5	Very high	91.3	Very high	84 Å²	84	76.1 Å²	76.1	51%	0.509	41%	0.411	S	S	.	.	H	α-helix	trans	-64.1	-46	177.7	174.3	0	0	0	0	110.9	E66 V67 C68 L72 R73 L74	E66-V70 WeakPolarHBondContact O-CG2 3.49Å; E66-V70 PolarHBondContact O-N 2.88Å; V67-V70 PolarHBondContact O-N 2.91Å; C68-V70 PolarHBondContact O-N 3.39Å; V70-L72 PolarHBondContact O-N 2.92Å; V70-R73 PolarHBondContact O-N 2.85Å; V70-L74 HydrophobicContact CG1-CD1 3.8Å; V70-L74 HydrophobicContact CG1-CG 4.19Å; V70-L74 WeakPolarHBondContact O-CG 3.3Å; V70-L74 PolarHBondContact O-N 3.24Å
71	L	96.4	Very high	92.7	Very high	65 Å²	65	75.9 Å²	75.9	34%	0.34	40%	0.401	S	S	.	.	H	α-helix	trans	-58.4	-45.9	179.2	179	65.5	0	0	0	111.9	L34 Y38 V67 C68 L74 G75	L34-L71 HydrophobicContact CB-CD2 4.03Å; L34-L71 HydrophobicContact CD2-CD2 4.47Å; Y38-L71 HydrophobicContact CD2-CD2 4.15Å; Y38-L71 HydrophobicContact CD2-CG 3.91Å; Y38-L71 HydrophobicContact CE2-CG 4.3Å; V67-L71 VanDerWaalsContact O-CB 3.31Å; V67-L71 WeakPolarHBondContact O-CB 3.48Å; V67-L71 PolarHBondContact O-N 2.84Å; C68-L71 PolarHBondContact O-N 3.21Å; L71-L74 PolarHBondContact O-N 3.44Å; L71-G75 PolarHBondContact O-N 2.88Å
72	L	95.4	Very high	93.8	Very high	42 Å²	42	79 Å²	79	22%	0.22	39%	0.39	C	S	.	.	H	α-helix	trans	-61.3	-45.5	177.8	-71.9	172.4	0	0	0	111.6	Y38 A41 C68 V70 G75 D76	Y38-L72 HydrophobicContact CD2-CD2 3.84Å; Y38-L72 HydrophobicContact CE2-CD2 4.48Å; Y38-L72 HydrophobicContact CG-CD2 4.38Å; A41-L72 HydrophobicContact CB-CD1 4.44Å; A41-L72 HydrophobicContact CB-CD2 3.59Å; C68-L72 WeakPolarHBondContact O-CB 3.34Å; C68-L72 VanDerWaalsContact O-CG 3.28Å; C68-L72 WeakPolarHBondContact O-CG 3.36Å; C68-L72 PolarHBondContact O-N 2.96Å; V70-L72 PolarHBondContact O-N 2.92Å; L72-G75 PolarHBondContact O-N 3.14Å; L72-D76 PolarHBondContact O-N 3.11Å
73	R	96.1	Very high	94.1	Very high	168 Å²	168	80.3 Å²	80.3	63%	0.634	39%	0.393	S	S	*	.	H	α-helix	trans	-63.8	-47.3	179	-179.2	177.9	173.4	170.9	2	112.1	T69 V70 G75 D76 E77	T69-R73 WeakPolarHBondContact O-CB 3.36Å; T69-R73 PolarHBondContact O-N 3.36Å; T69-R73 VanDerWaalsContact O-N 3.12Å; V70-R73 PolarHBondContact O-N 2.85Å; R73-G75 VanDerWaalsContact C-N 3.29Å; R73-G75 PolarHBondContact O-N 3.41Å; R73-D76 WeakPolarHBondContact O-CB 3.33Å; R73-D76 PolarHBondContact O-N 2.87Å; R73-D76 VanDerWaalsContact O-N 3.11Å; R73-E77 WeakPolarHBondContact CG-OE1 3.39Å; R73-E77 IonicContact CZ-OE1 4Å; R73-E77 IonicContact NE-OE1 2.88Å; R73-E77 PolarHBondContact NE-OE1 3.28Å; R73-E77 IonicContact NH2-OE1 3.53Å; R73-E77 WeakPolarHBondContact O-CG 3.43Å; R73-E77 PolarHBondContact O-N 3.44Å
74	L	96.7	Very high	94.1	Very high	80 Å²	80	74.2 Å²	74.2	42%	0.419	38%	0.383	S	S	.	.	H	α-helix	trans	-61	-41.2	177.2	-71.9	175.8	0	0	0	111.3	V70 L71 D76 E77 L78	V70-L74 HydrophobicContact CG1-CD1 3.8Å; V70-L74 HydrophobicContact CG1-CG 4.19Å; V70-L74 WeakPolarHBondContact O-CG 3.3Å; V70-L74 PolarHBondContact O-N 3.24Å; L71-L74 PolarHBondContact O-N 3.44Å; L74-D76 VanDerWaalsContact C-N 3.28Å; L74-D76 PolarHBondContact O-N 3.47Å; L74-E77 PolarHBondContact O-N 3.27Å; L74-L78 WeakPolarHBondContact O-CB 3.34Å; L74-L78 VanDerWaalsContact O-CG 3.28Å; L74-L78 WeakPolarHBondContact O-CG 3.41Å; L74-L78 PolarHBondContact O-N 2.84Å
75	G	95.1	Very high	94.2	Very high	6 Å²	6	75.6 Å²	75.6	6%	0.062	39%	0.393	C	S	.	.	H	α-helix	trans	-58.1	-40.1	173.9	0	0	0	0	0	112.9	Y38 R42 L71 L72 R73 E79	Y38-G75 VanDerWaalsContact OH-CA 3.31Å; Y38-G75 WeakPolarHBondContact OH-CA 3.39Å; R42-G75 PolarHBondContact NH2-O 3.06Å; L71-G75 PolarHBondContact O-N 2.88Å; L72-G75 PolarHBondContact O-N 3.14Å; R73-G75 VanDerWaalsContact C-N 3.29Å; R73-G75 PolarHBondContact O-N 3.41Å; G75-E79 WeakPolarHBondContact O-CB 3.31Å; G75-E79 WeakPolarHBondContact O-CG 3.48Å; G75-E79 PolarHBondContact O-N 3.3Å; G75-E79 VanDerWaalsContact O-N 3.17Å
76	D	94.7	Very high	94.3	Very high	53 Å²	53	79.1 Å²	79.1	28%	0.283	40%	0.403	S	S	.	.	H	α-helix	trans	-66.3	-45.3	176.2	-71.3	-16.1	0	0	0	112.1	R42 R45 L72 R73 L74 E79 Q80	R42-D76 IonicContact CZ-OD1 3.07Å; R42-D76 IonicContact NH1-OD1 2.64Å; R42-D76 PolarHBondContact NH1-OD1 3.4Å; R42-D76 VanDerWaalsContact NH2-N 3.18Å; R42-D76 IonicContact NH2-OD1 3.65Å; R42-D76 PolarHBondContact NH2-OD1 3.01Å; R45-D76 IonicContact CZ-OD1 3.84Å; R45-D76 IonicContact NH1-OD1 2.69Å; R45-D76 PolarHBondContact NH1-OD1 2.92Å; L72-D76 PolarHBondContact O-N 3.11Å; R73-D76 WeakPolarHBondContact O-CB 3.33Å; R73-D76 PolarHBondContact O-N 2.87Å; R73-D76 VanDerWaalsContact O-N 3.11Å; L74-D76 VanDerWaalsContact C-N 3.28Å; L74-D76 PolarHBondContact O-N 3.47Å; D76-E79 PolarHBondContact O-N 3.12Å; D76-Q80 VanDerWaalsContact O-CG 3.31Å; D76-Q80 WeakPolarHBondContact O-CG 3.28Å; D76-Q80 PolarHBondContact O-N 2.85Å; D76-Q80 VanDerWaalsContact O-N 3.15Å
77	E	96.7	Very high	94.1	Very high	69 Å²	69	78.2 Å²	78.2	32%	0.322	39%	0.394	S	S	.	.	H	α-helix	trans	-64.3	-44	179.2	-69.5	177.6	-167.4	0	0	111.1	R73 L74 E79 Q80 I81	R73-E77 WeakPolarHBondContact CG-OE1 3.39Å; R73-E77 IonicContact CZ-OE1 4Å; R73-E77 IonicContact NE-OE1 2.88Å; R73-E77 PolarHBondContact NE-OE1 3.28Å; R73-E77 IonicContact NH2-OE1 3.53Å; R73-E77 WeakPolarHBondContact O-CG 3.43Å; R73-E77 PolarHBondContact O-N 3.44Å; L74-E77 PolarHBondContact O-N 3.27Å; E77-E79 PolarHBondContact O-N 2.95Å; E77-Q80 WeakPolarHBondContact O-CB 3.45Å; E77-Q80 PolarHBondContact O-N 3.22Å; E77-Q80 VanDerWaalsContact O-N 3.08Å; E77-I81 VanDerWaalsContact O-CG1 3.24Å; E77-I81 WeakPolarHBondContact O-CG1 3.45Å; E77-I81 PolarHBondContact O-N 3.47Å
78	L	94.8	Very high	93.8	Very high	64 Å²	64	79.7 Å²	79.7	34%	0.335	40%	0.4	S	S	.	.	H	α-helix	trans	-61.3	-42.6	177.2	-72.8	175.9	0	0	0	112.5	L74 Q80 I81 R82 Y86	L74-L78 WeakPolarHBondContact O-CB 3.34Å; L74-L78 VanDerWaalsContact O-CG 3.28Å; L74-L78 WeakPolarHBondContact O-CG 3.41Å; L74-L78 PolarHBondContact O-N 2.84Å; L78-Q80 PolarHBondContact O-N 2.91Å; L78-I81 PolarHBondContact O-N 2.99Å; L78-R82 PolarHBondContact O-N 3.47Å; L78-Y86 HydrophobicContact CB-CD1 4.26Å; L78-Y86 HydrophobicContact CB-CD2 3.86Å; L78-Y86 HydrophobicContact CB-CE1 4.21Å; L78-Y86 HydrophobicContact CB-CE2 3.82Å; L78-Y86 HydrophobicContact CB-CG 4.1Å; L78-Y86 HydrophobicContact CD1-CE1 3.95Å; L78-Y86 HydrophobicContact CD2-CE2 3.98Å; L78-Y86 HydrophobicContact CG-CE2 4.34Å; L78-Y86 VanDerWaalsContact O-CD2 3.27Å; L78-Y86 WeakPolarHBondContact O-CD2 3.36Å
79	E	93.7	Very high	93.5	Very high	19 Å²	19	81.7 Å²	81.7	9%	0.089	41%	0.411	C	S	.	.	H	α-helix	trans	-64.6	-25.6	175.2	-78.4	178.9	-149	0	0	113.6	R42 R45 G75 D76 E77 P83 R87	R42-E79 IonicContact CZ-OE1 2.76Å; R42-E79 IonicContact NE-OE1 3.55Å; R42-E79 PolarHBondContact NE-OE1 3.17Å; R42-E79 IonicContact NH2-OE1 2.76Å; R42-E79 PolarHBondContact NH2-OE1 3.42Å; R42-E79 IonicContact NH2-OE2 3.62Å; R45-E79 IonicContact CZ-OE2 2.7Å; R45-E79 IonicContact NH1-OE2 2.92Å; R45-E79 IonicContact NH2-OE1 3.2Å; R45-E79 IonicContact NH2-OE2 3.74Å; R45-E79 PolarHBondContact NH2-OE2 3.38Å; G75-E79 WeakPolarHBondContact O-CB 3.31Å; G75-E79 WeakPolarHBondContact O-CG 3.48Å; G75-E79 PolarHBondContact O-N 3.3Å; G75-E79 VanDerWaalsContact O-N 3.17Å; D76-E79 PolarHBondContact O-N 3.12Å; E77-E79 PolarHBondContact O-N 2.95Å; E79-P83 WeakPolarHBondContact O-CA 3.5Å; E79-P83 WeakPolarHBondContact O-CG 3.26Å; E79-R87 HydrophobicContact CB-CG 4.42Å; E79-R87 HydrophobicContact CG-CG 4.21Å; E79-R87 IonicContact OE2-NE 3.74Å
80	Q	93.4	Very high	93.3	Very high	138 Å²	138	78.5 Å²	78.5	65%	0.645	40%	0.395	S	S	*	.	H	α-helix	trans	-82.7	-43.8	175.1	-70.6	174.6	14	0	0	112	D76 E77 L78	D76-Q80 VanDerWaalsContact O-CG 3.31Å; D76-Q80 WeakPolarHBondContact O-CG 3.28Å; D76-Q80 PolarHBondContact O-N 2.85Å; D76-Q80 VanDerWaalsContact O-N 3.15Å; E77-Q80 WeakPolarHBondContact O-CB 3.45Å; E77-Q80 PolarHBondContact O-N 3.22Å; E77-Q80 VanDerWaalsContact O-N 3.08Å; L78-Q80 PolarHBondContact O-N 2.91Å
81	I	97.1	Very high	92.9	Very high	126 Å²	126	82.8 Å²	82.8	65%	0.646	40%	0.402	S	S	*	.	H	α-helix	trans	-71.5	-43.9	-176	-63.7	166.9	0	0	0	111	E77 L78	E77-I81 VanDerWaalsContact O-CG1 3.24Å; E77-I81 WeakPolarHBondContact O-CG1 3.45Å; E77-I81 PolarHBondContact O-N 3.47Å; L78-I81 PolarHBondContact O-N 2.99Å
82	R	94.4	Very high	92.5	Very high	142 Å²	142	84.2 Å²	84.2	54%	0.536	41%	0.407	S	S	.	.			trans	-132.3	72.5	179.7	-69.3	-167.6	-78.1	-160	-1.7	112	L78 S84 V85 Y86	L78-R82 PolarHBondContact O-N 3.47Å; R82-S84 PolarHBondContact O-N 3.03Å; R82-V85 HydrophobicContact CB-CB 4.24Å; R82-V85 HydrophobicContact CB-CG2 4.15Å; R82-V85 PolarHBondContact O-N 3Å; R82-Y86 HydrophobicContact CB-CD2 4.15Å; R82-Y86 HydrophobicContact CB-CE2 4.21Å; R82-Y86 WeakPolarHBondContact O-CD2 3.23Å; R82-Y86 PolarHBondContact O-N 3.32Å
83	P	91.4	Very high	92.1	Very high	57 Å²	57	86.8 Å²	86.8	37%	0.37	42%	0.421	S	S	.	.	H	α-helix	trans	-58.4	-35.2	-177.7	-21.7	31.4	0	0	0	113.3	E79 V85 R87	E79-P83 WeakPolarHBondContact O-CA 3.5Å; E79-P83 WeakPolarHBondContact O-CG 3.26Å; P83-V85 PolarHBondContact O-N 3.05Å; P83-R87 VanDerWaalsContact O-CB 3.32Å; P83-R87 WeakPolarHBondContact O-CB 3.41Å; P83-R87 PolarHBondContact O-N 3.37Å
84	S	90.4	Very high	91.9	Very high	85 Å²	85	86.8 Å²	86.8	59%	0.594	43%	0.428	S	S	*	.	H	α-helix	trans	-65.3	-19.2	177.6	55.7	0	0	0	0	113.4	R82 Q92	R82-S84 PolarHBondContact O-N 3.03Å; S84-Q92 PolarHBondContact O-NE2 3.47Å; S84-Q92 PolarHBondContact O-OE1 3.37Å
85	V	90	Very high	91.5	Very high	76 Å²	76	84.7 Å²	84.7	46%	0.461	42%	0.416	S	S	.	.	H	α-helix	trans	-95.5	-41.7	177.8	178.9	0	0	0	0	110.8	R82 P83 V89	R82-V85 HydrophobicContact CB-CB 4.24Å; R82-V85 HydrophobicContact CB-CG2 4.15Å; R82-V85 PolarHBondContact O-N 3Å; P83-V85 PolarHBondContact O-N 3.05Å; V85-V89 VanDerWaalsContact O-CG2 3.23Å; V85-V89 WeakPolarHBondContact O-CG2 3.42Å
86	Y	91.2	Very high	91.2	Very high	94 Å²	94	87.8 Å²	87.8	37%	0.369	44%	0.435	S	S	.	.	H	α-helix	trans	-100.2	-9.8	-167.9	-65.1	-78.7	0	0	0	114.8	L78 R82	L78-Y86 HydrophobicContact CB-CD1 4.26Å; L78-Y86 HydrophobicContact CB-CD2 3.86Å; L78-Y86 HydrophobicContact CB-CE1 4.21Å; L78-Y86 HydrophobicContact CB-CE2 3.82Å; L78-Y86 HydrophobicContact CB-CG 4.1Å; L78-Y86 HydrophobicContact CD1-CE1 3.95Å; L78-Y86 HydrophobicContact CD2-CE2 3.98Å; L78-Y86 HydrophobicContact CG-CE2 4.34Å; L78-Y86 VanDerWaalsContact O-CD2 3.27Å; L78-Y86 WeakPolarHBondContact O-CD2 3.36Å; R82-Y86 HydrophobicContact CB-CD2 4.15Å; R82-Y86 HydrophobicContact CB-CE2 4.21Å; R82-Y86 WeakPolarHBondContact O-CD2 3.23Å; R82-Y86 PolarHBondContact O-N 3.32Å
87	R	90.3	Very high	90.8	Very high	105 Å²	105	90.8 Å²	90.8	40%	0.396	45%	0.451	S	S	.	.	S	Bend	trans	-112.2	140.7	179.9	-63	-174.6	171.9	155.1	1	112.5	E79 P83 V89 Q92	E79-R87 HydrophobicContact CB-CG 4.42Å; E79-R87 HydrophobicContact CG-CG 4.21Å; E79-R87 IonicContact OE2-NE 3.74Å; P83-R87 VanDerWaalsContact O-CB 3.32Å; P83-R87 WeakPolarHBondContact O-CB 3.41Å; P83-R87 PolarHBondContact O-N 3.37Å; R87-V89 PolarHBondContact O-N 3.26Å; R87-Q92 PolarHBondContact O-NE2 2.9Å
88	N	87.6	Confident	90.5	Very high	92 Å²	92	96.2 Å²	96.2	49%	0.492	48%	0.476	S	S	.	.	S	Bend	trans	57.1	30.8	175.2	-54.9	-59.1	0	0	0	114.3	A90 R91 Q92	N88-A90 VanDerWaalsContact C-N 3.26Å; N88-A90 PolarHBondContact O-N 3.49Å; N88-R91 HydrophobicContact CB-CB 4.15Å; N88-R91 WeakPolarHBondContact O-CA 3.25Å; N88-R91 WeakPolarHBondContact O-CB 3.37Å; N88-R91 PolarHBondContact O-N 2.96Å; N88-Q92 WeakPolarHBondContact O-CG 3.45Å; N88-Q92 PolarHBondContact O-N 3.49Å
89	V	88.4	Confident	90.5	Very high	53 Å²	53	95.7 Å²	95.7	32%	0.321	48%	0.478	S	S	.	.	H	α-helix	trans	-52.2	-43.7	-177.5	179	0	0	0	0	112.1	V85 R87 R91 Q92 L93	V85-V89 VanDerWaalsContact O-CG2 3.23Å; V85-V89 WeakPolarHBondContact O-CG2 3.42Å; R87-V89 PolarHBondContact O-N 3.26Å; V89-R91 VanDerWaalsContact C-N 3.25Å; V89-R91 PolarHBondContact O-N 3.09Å; V89-Q92 PolarHBondContact O-N 2.98Å; V89-Q92 VanDerWaalsContact O-N 3.1Å; V89-L93 HydrophobicContact CG1-CD1 3.7Å; V89-L93 HydrophobicContact CG1-CG 4.16Å; V89-L93 WeakPolarHBondContact O-CG 3.35Å; V89-L93 PolarHBondContact O-N 3.39Å
90	A	88.8	Confident	90.5	Very high	31 Å²	31	102.4 Å²	102.4	26%	0.256	51%	0.509	S	S	.	.	H	α-helix	trans	-56.8	-38.7	176	0	0	0	0	0	112.9	N88 H94 I95 L97	N88-A90 VanDerWaalsContact C-N 3.26Å; N88-A90 PolarHBondContact O-N 3.49Å; A90-H94 PolarHBondContact O-N 3.47Å; A90-H94 VanDerWaalsContact O-N 3.16Å; A90-I95 HydrophobicContact CB-CB 4.36Å; A90-I95 PolarHBondContact O-N 3.39Å; A90-L97 HydrophobicContact CB-CD1 4.26Å; A90-L97 HydrophobicContact CB-CD2 4.17Å; A90-L97 HydrophobicContact CB-CG 4.42Å
91	R	89.3	Confident	90.6	Very high	173 Å²	173	99.7 Å²	99.7	65%	0.653	50%	0.503	S	S	*	.	H	α-helix	trans	-70.9	-41.3	176.3	-168.7	-174.8	-61.2	142.6	5.5	111.5	N88 V89 L93 H94	N88-R91 HydrophobicContact CB-CB 4.15Å; N88-R91 WeakPolarHBondContact O-CA 3.25Å; N88-R91 WeakPolarHBondContact O-CB 3.37Å; N88-R91 PolarHBondContact O-N 2.96Å; V89-R91 VanDerWaalsContact C-N 3.25Å; V89-R91 PolarHBondContact O-N 3.09Å; R91-L93 VanDerWaalsContact C-N 3.31Å; R91-L93 PolarHBondContact O-N 3.23Å; R91-H94 PolarHBondContact O-N 3.11Å
92	Q	87.5	Confident	90.3	Very high	96 Å²	96	96.3 Å²	96.3	45%	0.449	49%	0.488	S	S	.	.	H	α-helix	trans	-65.4	-35.7	179.8	-62.9	-177.1	35.4	0	0	112.5	S84 R87 N88 V89 H94	S84-Q92 PolarHBondContact O-NE2 3.47Å; S84-Q92 PolarHBondContact O-OE1 3.37Å; R87-Q92 PolarHBondContact O-NE2 2.9Å; N88-Q92 WeakPolarHBondContact O-CG 3.45Å; N88-Q92 PolarHBondContact O-N 3.49Å; V89-Q92 PolarHBondContact O-N 2.98Å; V89-Q92 VanDerWaalsContact O-N 3.1Å; Q92-H94 VanDerWaalsContact C-N 3.32Å
93	L	87.4	Confident	90.2	Very high	96 Å²	96	92.4 Å²	92.4	50%	0.503	48%	0.48	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.3	5.7	178	-60.5	-178.4	0	0	0	113	V89 R91 I95 V110	V89-L93 HydrophobicContact CG1-CD1 3.7Å; V89-L93 HydrophobicContact CG1-CG 4.16Å; V89-L93 WeakPolarHBondContact O-CG 3.35Å; V89-L93 PolarHBondContact O-N 3.39Å; R91-L93 VanDerWaalsContact C-N 3.31Å; R91-L93 PolarHBondContact O-N 3.23Å; L93-I95 HydrophobicContact CB-CD1 3.72Å; L93-I95 HydrophobicContact CB-CG1 3.8Å; L93-I95 HydrophobicContact CD1-CD1 3.9Å; L93-I95 HydrophobicContact CG-CD1 4.44Å; L93-I95 PolarHBondContact O-N 2.83Å; L93-I95 VanDerWaalsContact O-N 3.17Å; L93-V110 HydrophobicContact CD1-CG2 3.78Å
94	H	90.4	Very high	90.4	Very high	168 Å²	168	92.7 Å²	92.7	78%	0.778	48%	0.481	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.2	36.1	-176.9	-60.6	-77.8	0	0	0	113.9	A90 R91 Q92 P96	A90-H94 PolarHBondContact O-N 3.47Å; A90-H94 VanDerWaalsContact O-N 3.16Å; R91-H94 PolarHBondContact O-N 3.11Å; Q92-H94 VanDerWaalsContact C-N 3.32Å; H94-P96 WeakPolarHBondContact O-CD 3.47Å
95	I	89.1	Confident	90.5	Very high	36 Å²	36	93.8 Å²	93.8	19%	0.185	48%	0.48	C	S	.	.			trans	-77.2	117.9	179.7	-62.4	163.6	0	0	0	108.9	A90 L93 L97 V102 A106	A90-I95 HydrophobicContact CB-CB 4.36Å; A90-I95 PolarHBondContact O-N 3.39Å; L93-I95 HydrophobicContact CB-CD1 3.72Å; L93-I95 HydrophobicContact CB-CG1 3.8Å; L93-I95 HydrophobicContact CD1-CD1 3.9Å; L93-I95 HydrophobicContact CG-CD1 4.44Å; L93-I95 PolarHBondContact O-N 2.83Å; L93-I95 VanDerWaalsContact O-N 3.17Å; I95-L97 HydrophobicContact CG2-CD2 4.21Å; I95-L97 PolarHBondContact O-N 3.07Å; I95-V102 HydrophobicContact CG2-CG1 4.48Å; I95-A106 HydrophobicContact CD1-CB 3.76Å; I95-A106 HydrophobicContact CG1-CB 4.05Å; I95-A106 HydrophobicContact CG2-CB 3.75Å
96	P	88.3	Confident	90.6	Very high	70 Å²	70	91.1 Å²	91.1	46%	0.455	47%	0.467	S	S	.	.			trans	-75.9	119.4	176.3	25.5	-22.9	0	0	0	110.2	H94 Q98 V102	H94-P96 WeakPolarHBondContact O-CD 3.47Å; P96-Q98 HydrophobicContact CB-CG 4.5Å; P96-Q98 PolarHBondContact O-N 2.78Å; P96-Q98 VanDerWaalsContact O-N 3.13Å; P96-V102 HydrophobicContact CG-CG1 4.01Å; P96-V102 WeakPolarHBondContact O-CG1 3.49Å
97	L	87.6	Confident	90.7	Very high	116 Å²	116	93.8 Å²	93.8	61%	0.607	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.9	47.1	178.4	-55.2	179.1	0	0	0	111.7	A90 I95 V103	A90-L97 HydrophobicContact CB-CD1 4.26Å; A90-L97 HydrophobicContact CB-CD2 4.17Å; A90-L97 HydrophobicContact CB-CG 4.42Å; I95-L97 HydrophobicContact CG2-CD2 4.21Å; I95-L97 PolarHBondContact O-N 3.07Å; L97-V103 HydrophobicContact CB-CG2 4.45Å; L97-V103 HydrophobicContact CD2-CG2 3.64Å
98	Q	90.4	Very high	91	Very high	183 Å²	183	93.9 Å²	93.9	86%	0.855	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.2	-17.5	-174.3	-64.8	-172.8	-5.9	0	0	113.6	P96	P96-Q98 HydrophobicContact CB-CG 4.5Å; P96-Q98 PolarHBondContact O-N 2.78Å; P96-Q98 VanDerWaalsContact O-N 3.13Å
99	S	93.3	Very high	91.2	Very high	53 Å²	53	92.6 Å²	92.6	37%	0.371	49%	0.49	S	S	.	.			trans	-145.9	145.7	179.2	69.9	0	0	0	0	111.4	V102 V103	S99-V102 PolarHBondContact O-N 3.41Å; S99-V102 WeakPolarHBondContact OG-CB 3.27Å; S99-V102 WeakPolarHBondContact OG-CG2 3.44Å; S99-V103 WeakPolarHBondContact O-CG2 3.31Å; S99-V103 PolarHBondContact O-N 3.43Å
100	E	94.4	Very high	91.4	Very high	160 Å²	160	92.4 Å²	92.4	75%	0.748	49%	0.489	S	S	*	.	H	α-helix	trans	-57.9	-42.9	178.8	178.7	-176.2	-175	0	0	113.5	V102 V103 T104	E100-V102 VanDerWaalsContact C-N 3.35Å; E100-V102 PolarHBondContact O-N 2.88Å; E100-V103 PolarHBondContact O-N 3.1Å; E100-T104 WeakPolarHBondContact O-CB 3.42Å; E100-T104 PolarHBondContact O-N 2.94Å; E100-T104 PolarHBondContact O-OG1 2.97Å
101	P	94.5	Very high	91.6	Very high	81 Å²	81	92 Å²	92	53%	0.526	49%	0.485	S	S	.	.	H	α-helix	trans	-61.4	-42.5	178.8	-23.8	35.2	0	0	0	112.4	V103 T104 D105	P101-V103 PolarHBondContact O-N 2.91Å; P101-T104 PolarHBondContact O-N 3.21Å; P101-D105 WeakPolarHBondContact O-CB 3.37Å; P101-D105 VanDerWaalsContact O-CG 3.31Å; P101-D105 PolarHBondContact O-N 3.46Å
102	V	92.1	Very high	91.9	Very high	55 Å²	55	85.9 Å²	85.9	33%	0.333	48%	0.477	S	S	.	.	H	α-helix	trans	-63.4	-42.4	-179.7	171.5	0	0	0	0	111.5	I95 P96 S99 E100 T104 A106	I95-V102 HydrophobicContact CG2-CG1 4.48Å; P96-V102 HydrophobicContact CG-CG1 4.01Å; P96-V102 WeakPolarHBondContact O-CG1 3.49Å; S99-V102 PolarHBondContact O-N 3.41Å; S99-V102 WeakPolarHBondContact OG-CB 3.27Å; S99-V102 WeakPolarHBondContact OG-CG2 3.44Å; E100-V102 VanDerWaalsContact C-N 3.35Å; E100-V102 PolarHBondContact O-N 2.88Å; V102-T104 VanDerWaalsContact C-N 3.34Å; V102-A106 VanDerWaalsContact O-CB 3.26Å; V102-A106 WeakPolarHBondContact O-CB 3.2Å; V102-A106 PolarHBondContact O-N 3.25Å
103	V	92.3	Very high	92.1	Very high	60 Å²	60	88.3 Å²	88.3	36%	0.364	49%	0.488	S	S	.	.	H	α-helix	trans	-65.2	-41.7	176.9	179	0	0	0	0	110.8	L97 S99 E100 P101 F107	L97-V103 HydrophobicContact CB-CG2 4.45Å; L97-V103 HydrophobicContact CD2-CG2 3.64Å; S99-V103 WeakPolarHBondContact O-CG2 3.31Å; S99-V103 PolarHBondContact O-N 3.43Å; E100-V103 PolarHBondContact O-N 3.1Å; P101-V103 PolarHBondContact O-N 2.91Å; V103-F107 VanDerWaalsContact O-CB 3.25Å; V103-F107 WeakPolarHBondContact O-CB 3.49Å; V103-F107 PolarHBondContact O-N 2.98Å
104	T	94.5	Very high	92.3	Very high	63 Å²	63	89 Å²	89	39%	0.387	49%	0.491	S	S	.	.	H	α-helix	trans	-64.2	-49.6	179.8	-57.5	0	0	0	0	111.3	E100 P101 V102 A106 F107 L108	E100-T104 WeakPolarHBondContact O-CB 3.42Å; E100-T104 PolarHBondContact O-N 2.94Å; E100-T104 PolarHBondContact O-OG1 2.97Å; P101-T104 PolarHBondContact O-N 3.21Å; V102-T104 VanDerWaalsContact C-N 3.34Å; T104-A106 PolarHBondContact O-N 3.39Å; T104-F107 PolarHBondContact O-N 3.48Å; T104-L108 HydrophobicContact CG2-CD1 4.02Å; T104-L108 HydrophobicContact CG2-CG 4.48Å; T104-L108 WeakPolarHBondContact O-CB 3.31Å; T104-L108 VanDerWaalsContact O-CG 3.31Å; T104-L108 WeakPolarHBondContact O-CG 3.35Å; T104-L108 PolarHBondContact O-N 2.9Å
105	D	93.3	Very high	92.5	Very high	108 Å²	108	86 Å²	86	58%	0.578	48%	0.476	S	S	*	.	H	α-helix	trans	-62.4	-44.5	179.7	-70.8	-16.7	0	0	0	111.3	P101 L108 A109	P101-D105 WeakPolarHBondContact O-CB 3.37Å; P101-D105 VanDerWaalsContact O-CG 3.31Å; P101-D105 PolarHBondContact O-N 3.46Å; D105-L108 PolarHBondContact O-N 3.14Å; D105-A109 VanDerWaalsContact O-CB 3.3Å; D105-A109 WeakPolarHBondContact O-CB 3.42Å; D105-A109 PolarHBondContact O-N 2.98Å
106	A	92.5	Very high	92.9	Very high	21 Å²	21	88.6 Å²	88.6	17%	0.174	50%	0.497	C	S	.	.	H	α-helix	trans	-64.4	-41.7	177.8	0	0	0	0	0	112	I95 V102 T104 A109 V110	I95-A106 HydrophobicContact CD1-CB 3.76Å; I95-A106 HydrophobicContact CG1-CB 4.05Å; I95-A106 HydrophobicContact CG2-CB 3.75Å; V102-A106 VanDerWaalsContact O-CB 3.26Å; V102-A106 WeakPolarHBondContact O-CB 3.2Å; V102-A106 PolarHBondContact O-N 3.25Å; T104-A106 PolarHBondContact O-N 3.39Å; A106-A109 PolarHBondContact O-N 3.3Å; A106-V110 WeakPolarHBondContact O-CG2 3.26Å; A106-V110 PolarHBondContact O-N 3.48Å
107	F	93.4	Very high	93.1	Very high	150 Å²	150	90.2 Å²	90.2	66%	0.658	52%	0.516	S	S	*	.	H	α-helix	trans	-61.7	-47.2	176	179.4	-94.2	0	0	0	111.5	V103 T104 V110 A111	V103-F107 VanDerWaalsContact O-CB 3.25Å; V103-F107 WeakPolarHBondContact O-CB 3.49Å; V103-F107 PolarHBondContact O-N 2.98Å; T104-F107 PolarHBondContact O-N 3.48Å; F107-V110 PolarHBondContact O-N 2.98Å; F107-A111 WeakPolarHBondContact O-CB 3.47Å; F107-A111 PolarHBondContact O-N 3.46Å
108	L	95.2	Very high	93.5	Very high	106 Å²	106	86.6 Å²	86.6	56%	0.555	51%	0.507	S	S	*	.	H	α-helix	trans	-64.7	-39.4	178.4	-69.9	175.3	0	0	0	112.1	T104 D105 A111 G112	T104-L108 HydrophobicContact CG2-CD1 4.02Å; T104-L108 HydrophobicContact CG2-CG 4.48Å; T104-L108 WeakPolarHBondContact O-CB 3.31Å; T104-L108 VanDerWaalsContact O-CG 3.31Å; T104-L108 WeakPolarHBondContact O-CG 3.35Å; T104-L108 PolarHBondContact O-N 2.9Å; D105-L108 PolarHBondContact O-N 3.14Å; L108-A111 PolarHBondContact O-N 2.9Å; L108-G112 PolarHBondContact O-N 3.18Å
109	A	93.3	Very high	93.7	Very high	65 Å²	65	84.8 Å²	84.8	54%	0.537	50%	0.502	S	S	.	.	H	α-helix	trans	-63.8	-46.1	176.6	0	0	0	0	0	112	D105 A106 G112 H113	D105-A109 VanDerWaalsContact O-CB 3.3Å; D105-A109 WeakPolarHBondContact O-CB 3.42Å; D105-A109 PolarHBondContact O-N 2.98Å; A106-A109 PolarHBondContact O-N 3.3Å; A109-G112 PolarHBondContact O-N 2.97Å; A109-H113 WeakPolarHBondContact O-CB 3.34Å; A109-H113 PolarHBondContact O-N 2.87Å
110	V	92.1	Very high	93.7	Very high	49 Å²	49	88 Å²	88	30%	0.297	52%	0.52	S	S	.	.	H	α-helix	trans	-64.2	-45	177	172.3	0	0	0	0	110.8	L93 A106 F107 H113 I114	L93-V110 HydrophobicContact CD1-CG2 3.78Å; A106-V110 WeakPolarHBondContact O-CG2 3.26Å; A106-V110 PolarHBondContact O-N 3.48Å; F107-V110 PolarHBondContact O-N 2.98Å; V110-H113 PolarHBondContact O-N 3.38Å; V110-I114 HydrophobicContact CG1-CD1 3.79Å; V110-I114 HydrophobicContact CG1-CG1 4.41Å; V110-I114 WeakPolarHBondContact O-CG1 3.33Å; V110-I114 PolarHBondContact O-N 2.95Å
111	A	93.6	Very high	93.5	Very high	22 Å²	22	95 Å²	95	18%	0.182	54%	0.539	C	S	.	.	H	α-helix	trans	-59.9	-48.4	176.5	0	0	0	0	0	111.5	F107 L108 H113 I114 F115	F107-A111 WeakPolarHBondContact O-CB 3.47Å; F107-A111 PolarHBondContact O-N 3.46Å; L108-A111 PolarHBondContact O-N 2.9Å; A111-H113 VanDerWaalsContact C-N 3.25Å; A111-H113 PolarHBondContact O-N 3.17Å; A111-I114 PolarHBondContact O-N 2.89Å; A111-F115 HydrophobicContact CB-CD2 4.32Å; A111-F115 HydrophobicContact CB-CE2 4.13Å; A111-F115 WeakPolarHBondContact O-CD2 3.33Å; A111-F115 WeakPolarHBondContact O-CG 3.36Å; A111-F115 PolarHBondContact O-N 2.69Å
112	G	94.8	Very high	93.5	Very high	46 Å²	46	95.7 Å²	95.7	47%	0.474	54%	0.54	S	S	.	.	H	α-helix	trans	-58.2	-37.9	176.8	0	0	0	0	0	112.6	L108 A109 S116	L108-G112 PolarHBondContact O-N 3.18Å; A109-G112 PolarHBondContact O-N 2.97Å; G112-S116 WeakPolarHBondContact O-CB 3.18Å; G112-S116 PolarHBondContact O-N 2.91Å; G112-S116 VanDerWaalsContact O-N 3.07Å
113	H	92.1	Very high	93.5	Very high	147 Å²	147	97.8 Å²	97.8	68%	0.681	55%	0.551	S	S	*	*	H	α-helix	trans	-68.4	-45.8	175.3	-168.8	64.9	0	0	0	112.6	A109 V110 A111 F115 S116	A109-H113 WeakPolarHBondContact O-CB 3.34Å; A109-H113 PolarHBondContact O-N 2.87Å; V110-H113 PolarHBondContact O-N 3.38Å; A111-H113 VanDerWaalsContact C-N 3.25Å; A111-H113 PolarHBondContact O-N 3.17Å; H113-F115 VanDerWaalsContact C-N 3.29Å; H113-F115 PolarHBondContact O-N 3.45Å; H113-S116 WeakPolarHBondContact O-CB 3.23Å; H113-S116 PolarHBondContact O-N 2.91Å; H113-S116 PolarHBondContact O-OG 3.15Å
114	I	91.4	Very high	93.6	Very high	110 Å²	110	99.9 Å²	99.9	56%	0.564	56%	0.561	S	S	*	*	H	α-helix	trans	-58.2	-43.1	177.9	-70.7	168.4	0	0	0	110.9	V110 A111	V110-I114 HydrophobicContact CG1-CD1 3.79Å; V110-I114 HydrophobicContact CG1-CG1 4.41Å; V110-I114 WeakPolarHBondContact O-CG1 3.33Å; V110-I114 PolarHBondContact O-N 2.95Å; A111-I114 PolarHBondContact O-N 2.89Å
115	F	95.3	Very high	93.6	Very high	105 Å²	105	102.1 Å²	102.1	46%	0.461	57%	0.571	S	S	.	*	H	α-helix	trans	-86.6	-2.2	-177.7	-58.3	-54.8	0	0	0	114.3	A111 H113 A117 G118 I119	A111-F115 HydrophobicContact CB-CD2 4.32Å; A111-F115 HydrophobicContact CB-CE2 4.13Å; A111-F115 WeakPolarHBondContact O-CD2 3.33Å; A111-F115 WeakPolarHBondContact O-CG 3.36Å; A111-F115 PolarHBondContact O-N 2.69Å; H113-F115 VanDerWaalsContact C-N 3.29Å; H113-F115 PolarHBondContact O-N 3.45Å; F115-A117 PolarHBondContact O-N 3.26Å; F115-G118 PolarHBondContact O-N 2.97Å; F115-I119 HydrophobicContact CB-CG1 4.46Å; F115-I119 HydrophobicContact CD1-CG1 4.05Å; F115-I119 HydrophobicContact CD1-CG2 4.49Å; F115-I119 HydrophobicContact CG-CG1 4.49Å
116	S	96.1	Very high	93.6	Very high	90 Å²	90	101.7 Å²	101.7	63%	0.629	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.6	-27	-177.4	66.6	0	0	0	0	113.7	G112 H113	G112-S116 WeakPolarHBondContact O-CB 3.18Å; G112-S116 PolarHBondContact O-N 2.91Å; G112-S116 VanDerWaalsContact O-N 3.07Å; H113-S116 WeakPolarHBondContact O-CB 3.23Å; H113-S116 PolarHBondContact O-N 2.91Å; H113-S116 PolarHBondContact O-OG 3.15Å
117	A	93.8	Very high	93.6	Very high	104 Å²	104	107.1 Å²	107.1	86%	0.86	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.6	7.6	177.4	0	0	0	0	0	113.4	F115	F115-A117 PolarHBondContact O-N 3.26Å
118	G	95.3	Very high	93.7	Very high	41 Å²	41	104 Å²	104	42%	0.423	59%	0.593	S	S	.	*			trans	114.5	173.9	-174.8	0	0	0	0	0	112.9	F115	F115-G118 PolarHBondContact O-N 2.97Å
119	I	94.6	Very high	93.5	Very high	144 Å²	144	103.8 Å²	103.8	74%	0.738	60%	0.596	S	S	*	*			trans	-109.7	128.3	-177.3	-57.6	171.2	0	0	0	108.7	F115	F115-I119 HydrophobicContact CB-CG1 4.46Å; F115-I119 HydrophobicContact CD1-CG1 4.05Å; F115-I119 HydrophobicContact CD1-CG2 4.49Å; F115-I119 HydrophobicContact CG-CG1 4.49Å
120	T	94	Very high	93.6	Very high	122 Å²	122	107.1 Å²	107.1	75%	0.748	60%	0.601	S	S	*	*			trans	-119.6	166.7	170.3	70.6	0	0	0	0	110.2
121	W	89.7	Confident	93.7	Very high	305 Å²	305	112.4 Å²	112.4	100%	1.155	63%	0.629	S	S	*	*			trans	-65.9	0	160.2	-71.1	107.2	0	0	0	111.4

Retrieved 121 of 121 residues in 74.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).