A0A087WR05_MOUSE Loading...

Runt related transcription factor 1

AlphaFold DB , UniProt , Accession A0A087WR05, Species MOUSE (Mus musculus, Mouse), Gene Runx1, Length 68 aa.

						>A0A087WR05_MOUSE|A0A087WR05|Runx1
MASDSIFESFPSYPQCFMRDASTSRRFTPPSTALSPGKMSEALPLGAPDGGAALASKLRSGDRSMVEV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.7	Very low	58.2	Low	233 Å²	233	131.9 Å²	131.9	100%	1.148	73%	0.733	S	S	*	*				0	102.3	0	-65.4	-76.8	83.6	0	0	106
2	A	54.5	Low	58.1	Low	90 Å²	90	130.2 Å²	130.2	74%	0.744	74%	0.736	S	S	*	*			trans	-76.3	126.9	177.2	0	0	0	0	0	107.7	D4	A2-D4 PolarHBondContact O-N 3.26Å
3	S	58.7	Low	57.9	Low	102 Å²	102	132.5 Å²	132.5	71%	0.713	73%	0.728	S	S	*	*			trans	-78	98.6	173	46.8	0	0	0	0	108.2	S5	S3-S5 VanDerWaalsContact C-N 3.35Å; S3-S5 PolarHBondContact O-N 2.81Å
4	D	64.3	Low	58.1	Low	146 Å²	146	127.7 Å²	127.7	78%	0.781	71%	0.707	S	S	*	*			trans	-69	96.8	170.9	-62.2	-32.2	0	0	0	107.5	A2 I6	A2-D4 PolarHBondContact O-N 3.26Å; D4-I6 PolarHBondContact O-N 3.18Å
5	S	65.7	Low	58.1	Low	67 Å²	67	129.3 Å²	129.3	47%	0.469	71%	0.707	S	S	.	*			trans	-63.9	118.6	-179.2	-76.8	0	0	0	0	108.6	S3 F7 E8	S3-S5 VanDerWaalsContact C-N 3.35Å; S3-S5 PolarHBondContact O-N 2.81Å; S5-F7 PolarHBondContact O-N 2.93Å; S5-E8 WeakPolarHBondContact O-CB 3.41Å; S5-E8 PolarHBondContact O-N 2.96Å
6	I	64.1	Low	58.1	Low	155 Å²	155	128.4 Å²	128.4	80%	0.795	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.7	-23.4	174.6	-63.6	164.3	0	0	0	111.6	D4	D4-I6 PolarHBondContact O-N 3.18Å
7	F	57.6	Low	57.9	Low	171 Å²	171	130.2 Å²	130.2	75%	0.75	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.2	-8.3	175.8	-71.4	-85.9	0	0	0	115.6	S5 S9 F10	S5-F7 PolarHBondContact O-N 2.93Å; F7-S9 VanDerWaalsContact C-N 3.33Å; F7-F10 HydrophobicContact CD1-CE2 4.15Å; F7-F10 WeakPolarHBondContact O-CD2 3.2Å
8	E	55	Low	58.1	Low	159 Å²	159	130.2 Å²	130.2	74%	0.743	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	-13.6	178.1	-145.4	167.6	-161.1	0	0	111.5	S5 F10	S5-E8 WeakPolarHBondContact O-CB 3.41Å; S5-E8 PolarHBondContact O-N 2.96Å; E8-F10 PolarHBondContact O-N 3.24Å
9	S	55.4	Low	58.3	Low	93 Å²	93	133.7 Å²	133.7	65%	0.65	71%	0.708	S	S	*	*			trans	-82	66.5	169.1	-159.8	0	0	0	0	111.3	F7	F7-S9 VanDerWaalsContact C-N 3.33Å
10	F	61.6	Low	58.4	Low	123 Å²	123	130.9 Å²	130.9	54%	0.539	69%	0.694	S	S	.	*			trans	-125.8	80.4	157.5	-67.1	-82.3	0	0	0	110.3	F7 E8 Y13	F7-F10 HydrophobicContact CD1-CE2 4.15Å; F7-F10 WeakPolarHBondContact O-CD2 3.2Å; E8-F10 PolarHBondContact O-N 3.24Å; F10-Y13 AromaticContact CD1-CD2 3.61Å; F10-Y13 HydrophobicContact CD1-CD2 3.61Å; F10-Y13 AromaticContact CD1-CE2 3.4Å; F10-Y13 HydrophobicContact CD1-CE2 3.4Å; F10-Y13 VanDerWaalsContact CD1-CE2 3.4Å; F10-Y13 AromaticContact CE1-CD2 3.9Å; F10-Y13 HydrophobicContact CE1-CD2 3.9Å; F10-Y13 AromaticContact CE1-CE2 3.27Å; F10-Y13 HydrophobicContact CE1-CE2 3.27Å; F10-Y13 HydrophobicContact CZ-CE2 4.49Å
11	P	57.6	Low	58.4	Low	112 Å²	112	129.1 Å²	129.1	73%	0.727	70%	0.697	S	S	*	*	S	Bend	trans	-136.2	45.2	145	40.1	-26.6	0	0	0	112.2
12	S	57.4	Low	59	Low	111 Å²	111	121.9 Å²	121.9	78%	0.776	67%	0.67	S	S	*	*			trans	-159.8	34.3	172.6	-129.2	0	0	0	0	117.2
13	Y	55.1	Low	59.2	Low	160 Å²	160	122 Å²	122	63%	0.627	66%	0.661	S	S	*	*	S	Bend	trans	-75.7	127.8	155.2	-75.8	-92.4	0	0	0	107.2	F10 Q15	F10-Y13 AromaticContact CD1-CD2 3.61Å; F10-Y13 HydrophobicContact CD1-CD2 3.61Å; F10-Y13 AromaticContact CD1-CE2 3.4Å; F10-Y13 HydrophobicContact CD1-CE2 3.4Å; F10-Y13 VanDerWaalsContact CD1-CE2 3.4Å; F10-Y13 AromaticContact CE1-CD2 3.9Å; F10-Y13 HydrophobicContact CE1-CD2 3.9Å; F10-Y13 AromaticContact CE1-CE2 3.27Å; F10-Y13 HydrophobicContact CE1-CE2 3.27Å; F10-Y13 HydrophobicContact CZ-CE2 4.49Å; Y13-Q15 PolarHBondContact O-N 3.38Å
14	P	61.1	Low	59.3	Low	66 Å²	66	119 Å²	119	43%	0.429	64%	0.64	S	S	.	*			trans	-56.9	123.3	175.3	20.4	-27.7	0	0	0	107.7	C16 F17	P14-C16 HydrophobicContact CB-CB 4.31Å; P14-C16 PolarHBondContact O-N 3.05Å; P14-F17 HydrophobicContact CG-CD2 3.81Å; P14-F17 HydrophobicContact CG-CE2 3.84Å; P14-F17 PolarHBondContact O-N 3.17Å
15	Q	57.5	Low	59.3	Low	152 Å²	152	123 Å²	123	71%	0.71	64%	0.644	S	S	*	*	G	3₁₀ helix	trans	-53.3	-13.1	178.7	-71.7	-71.2	-32.4	0	0	112.5	Y13 F17 M18	Y13-Q15 PolarHBondContact O-N 3.38Å; Q15-F17 PolarHBondContact O-N 3.26Å; Q15-M18 PolarHBondContact O-N 3.03Å; Q15-M18 VanDerWaalsContact O-N 3.11Å
16	C	58.1	Low	59.4	Low	115 Å²	115	129.3 Å²	129.3	78%	0.777	66%	0.658	S	S	*	*	G	3₁₀ helix	trans	-53.6	-29.8	169.4	-43.9	0	0	0	0	114.4	P14	P14-C16 HydrophobicContact CB-CB 4.31Å; P14-C16 PolarHBondContact O-N 3.05Å
17	F	54.3	Low	59.3	Low	158 Å²	158	130.4 Å²	130.4	69%	0.693	66%	0.657	S	S	*	*	G	3₁₀ helix	trans	-93.3	-13.7	177.2	-65.3	-68.3	0	0	0	113.7	P14 Q15 R19	P14-F17 HydrophobicContact CG-CD2 3.81Å; P14-F17 HydrophobicContact CG-CE2 3.84Å; P14-F17 PolarHBondContact O-N 3.17Å; Q15-F17 PolarHBondContact O-N 3.26Å; F17-R19 VanDerWaalsContact C-N 3.3Å; F17-R19 PolarHBondContact O-N 3.25Å
18	M	61.9	Low	59.5	Low	130 Å²	130	127.5 Å²	127.5	64%	0.64	65%	0.653	S	S	*	*	S	Bend	trans	-81.3	87.1	169.1	-69.7	-67.9	94.2	0	0	107.7	Q15 D20	Q15-M18 PolarHBondContact O-N 3.03Å; Q15-M18 VanDerWaalsContact O-N 3.11Å; M18-D20 PolarHBondContact O-N 3.02Å
19	R	62.9	Low	59.9	Low	198 Å²	198	123.4 Å²	123.4	75%	0.747	64%	0.641	S	S	*	*			trans	-43	102.8	170.7	176	-176.8	-96.3	-140.6	12.7	109.4	F17 A21 S24	F17-R19 VanDerWaalsContact C-N 3.3Å; F17-R19 PolarHBondContact O-N 3.25Å; R19-A21 PolarHBondContact O-N 2.83Å; R19-S24 WeakPolarHBondContact CD-OG 3.32Å; R19-S24 WeakPolarHBondContact CG-OG 3.49Å; R19-S24 PolarHBondContact NE-OG 2.93Å; R19-S24 PolarHBondContact NH1-OG 3.09Å
20	D	59.1	Low	60.3	Low	77 Å²	77	124.5 Å²	124.5	41%	0.412	65%	0.646	S	S	.	*			trans	-57.2	114.1	174.6	162.5	42.2	0	0	0	108.5	M18 S22 T23 S24	M18-D20 PolarHBondContact O-N 3.02Å; D20-S22 VanDerWaalsContact CG-OG 3.3Å; D20-S22 PolarHBondContact O-N 3.11Å; D20-S22 VanDerWaalsContact O-N 3.08Å; D20-S22 VanDerWaalsContact OD1-CB 3.32Å; D20-S22 WeakPolarHBondContact OD1-CB 2.99Å; D20-S22 PolarHBondContact OD1-N 3.36Å; D20-S22 PolarHBondContact OD1-OG 3.07Å; D20-S22 WeakPolarHBondContact OD2-CB 3.15Å; D20-S22 PolarHBondContact OD2-OG 2.88Å; D20-T23 WeakPolarHBondContact CB-OG1 3.38Å; D20-T23 PolarHBondContact O-N 3.03Å; D20-T23 PolarHBondContact O-OG1 3.23Å; D20-T23 WeakPolarHBondContact OD2-CB 3.41Å; D20-T23 WeakPolarHBondContact OD2-CG2 3.37Å; D20-T23 PolarHBondContact OD2-N 3.06Å; D20-T23 VanDerWaalsContact OD2-N 3.12Å; D20-T23 PolarHBondContact OD2-OG1 2.62Å; D20-S24 WeakPolarHBondContact O-CB 3.14Å; D20-S24 PolarHBondContact O-N 3.12Å
21	A	58.1	Low	60.3	Low	93 Å²	93	123.7 Å²	123.7	77%	0.769	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.8	-22.3	-177.8	0	0	0	0	0	111.8	R19	R19-A21 PolarHBondContact O-N 2.83Å
22	S	58.8	Low	60.3	Low	82 Å²	82	124.9 Å²	124.9	57%	0.573	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.3	-29.6	177.6	100.2	0	0	0	0	113.1	D20	D20-S22 VanDerWaalsContact CG-OG 3.3Å; D20-S22 PolarHBondContact O-N 3.11Å; D20-S22 VanDerWaalsContact O-N 3.08Å; D20-S22 VanDerWaalsContact OD1-CB 3.32Å; D20-S22 WeakPolarHBondContact OD1-CB 2.99Å; D20-S22 PolarHBondContact OD1-N 3.36Å; D20-S22 PolarHBondContact OD1-OG 3.07Å; D20-S22 WeakPolarHBondContact OD2-CB 3.15Å; D20-S22 PolarHBondContact OD2-OG 2.88Å
23	T	59.1	Low	60.5	Low	92 Å²	92	123.2 Å²	123.2	56%	0.564	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106	-16.2	-178	50.7	0	0	0	0	113.6	D20 R25	D20-T23 WeakPolarHBondContact CB-OG1 3.38Å; D20-T23 PolarHBondContact O-N 3.03Å; D20-T23 PolarHBondContact O-OG1 3.23Å; D20-T23 WeakPolarHBondContact OD2-CB 3.41Å; D20-T23 WeakPolarHBondContact OD2-CG2 3.37Å; D20-T23 PolarHBondContact OD2-N 3.06Å; D20-T23 VanDerWaalsContact OD2-N 3.12Å; D20-T23 PolarHBondContact OD2-OG1 2.62Å; T23-R25 VanDerWaalsContact C-N 3.27Å; T23-R25 PolarHBondContact O-N 2.77Å; T23-R25 VanDerWaalsContact O-N 3.09Å
24	S	60.7	Low	60.8	Low	39 Å²	39	121.3 Å²	121.3	27%	0.273	65%	0.654	S	S	.	*	T	Hydrogen-bonded Turn	trans	-68.2	-9.7	-170.4	-178.5	0	0	0	0	117	R19 D20	R19-S24 WeakPolarHBondContact CD-OG 3.32Å; R19-S24 WeakPolarHBondContact CG-OG 3.49Å; R19-S24 PolarHBondContact NE-OG 2.93Å; R19-S24 PolarHBondContact NH1-OG 3.09Å; D20-S24 WeakPolarHBondContact O-CB 3.14Å; D20-S24 PolarHBondContact O-N 3.12Å
25	R	64.1	Low	60.8	Low	230 Å²	230	121.6 Å²	121.6	87%	0.868	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-134.6	22.8	-178.6	-65.5	-164.9	-61.5	171.1	0	114.8	T23 F27	T23-R25 VanDerWaalsContact C-N 3.27Å; T23-R25 PolarHBondContact O-N 2.77Å; T23-R25 VanDerWaalsContact O-N 3.09Å; R25-F27 VanDerWaalsContact C-N 3.32Å; R25-F27 PolarHBondContact O-N 2.96Å; R25-F27 VanDerWaalsContact O-N 3.17Å
26	R	67.8	Low	61	Low	200 Å²	200	121.2 Å²	121.2	76%	0.755	67%	0.668	S	S	*	*			trans	-87.4	82.8	166.4	-71.7	-175.4	176.8	155.4	0.8	108.8	T28	R26-T28 PolarHBondContact O-N 3.04Å
27	F	62.1	Low	61.1	Low	178 Å²	178	117.8 Å²	117.8	78%	0.781	65%	0.652	S	S	*	*			trans	-61.9	95.3	151.1	178	-101.8	0	0	0	106.2	R25 P29	R25-F27 VanDerWaalsContact C-N 3.32Å; R25-F27 PolarHBondContact O-N 2.96Å; R25-F27 VanDerWaalsContact O-N 3.17Å; F27-P29 HydrophobicContact CD1-CB 4.42Å; F27-P29 HydrophobicContact CD1-CG 4.47Å; F27-P29 HydrophobicContact CE1-CB 3.72Å; F27-P29 HydrophobicContact CE1-CG 4.15Å; F27-P29 HydrophobicContact CZ-CB 4.16Å; F27-P29 WeakPolarHBondContact O-CD 3.16Å
28	T	61.7	Low	61.5	Low	109 Å²	109	116.4 Å²	116.4	67%	0.669	65%	0.646	S	S	*	*			trans	-90.7	99.1	169.6	-44.5	0	0	0	0	105.1	R26	R26-T28 PolarHBondContact O-N 3.04Å
29	P	63.8	Low	61.4	Low	73 Å²	73	118.6 Å²	118.6	47%	0.474	66%	0.657	S	S	.	*			trans	-56.3	148.6	174.7	22.9	-31.2	0	0	0	109.2	F27 S31	F27-P29 HydrophobicContact CD1-CB 4.42Å; F27-P29 HydrophobicContact CD1-CG 4.47Å; F27-P29 HydrophobicContact CE1-CB 3.72Å; F27-P29 HydrophobicContact CE1-CG 4.15Å; F27-P29 HydrophobicContact CZ-CB 4.16Å; F27-P29 WeakPolarHBondContact O-CD 3.16Å; P29-S31 PolarHBondContact O-N 3.08Å; P29-S31 VanDerWaalsContact O-N 3.15Å
30	P	63.2	Low	61.6	Low	116 Å²	116	114.1 Å²	114.1	75%	0.753	66%	0.656	S	S	*	*			trans	-52.6	125.9	177.2	22.2	-32.3	0	0	0	109	T32	P30-T32 PolarHBondContact O-N 3.22Å
31	S	61.6	Low	61.9	Low	107 Å²	107	118 Å²	118	75%	0.748	67%	0.672	S	S	*	*			trans	-53.8	108.9	-176.9	-68.9	0	0	0	0	110.5	P29 A33	P29-S31 PolarHBondContact O-N 3.08Å; P29-S31 VanDerWaalsContact O-N 3.15Å; S31-A33 PolarHBondContact O-N 3.07Å
32	T	58.6	Low	62.2	Low	136 Å²	136	118.1 Å²	118.1	83%	0.834	67%	0.672	S	S	*	*			trans	-77.8	3.9	162.2	56.5	0	0	0	0	111.6	P30 L34	P30-T32 PolarHBondContact O-N 3.22Å; T32-L34 VanDerWaalsContact C-N 3.3Å; T32-L34 PolarHBondContact O-N 2.78Å
33	A	61.3	Low	62.3	Low	77 Å²	77	120.3 Å²	120.3	64%	0.636	68%	0.677	S	S	*	*			trans	-66.4	91	173.3	0	0	0	0	0	109.6	S31 S35	S31-A33 PolarHBondContact O-N 3.07Å; A33-S35 PolarHBondContact O-N 3.13Å; A33-S35 VanDerWaalsContact O-N 3.14Å
34	L	61.5	Low	62.3	Low	120 Å²	120	121.5 Å²	121.5	63%	0.628	69%	0.686	S	S	*	*			trans	-50.2	117.9	151	-63.6	177.4	0	0	0	106.6	T32 K38	T32-L34 VanDerWaalsContact C-N 3.3Å; T32-L34 PolarHBondContact O-N 2.78Å; L34-K38 HydrophobicContact CB-CD 4.44Å; L34-K38 VanDerWaalsContact CB-NZ 3.27Å; L34-K38 HydrophobicContact CD2-CD 4.17Å
35	S	60.8	Low	62	Low	71 Å²	71	127.7 Å²	127.7	50%	0.497	72%	0.715	S	S	.	*			trans	-49.3	133.1	179.6	56.8	0	0	0	0	109.7	A33 G37 K38	A33-S35 PolarHBondContact O-N 3.13Å; A33-S35 VanDerWaalsContact O-N 3.14Å; S35-G37 PolarHBondContact O-N 3.17Å; S35-K38 PolarHBondContact O-N 3.37Å
36	P	61.8	Low	61.7	Low	144 Å²	144	119.6 Å²	119.6	94%	0.935	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.6	83.5	168.4	-16.3	29.4	0	0	0	107.8
37	G	60.9	Low	61	Low	43 Å²	43	114.1 Å²	114.1	44%	0.443	70%	0.701	S	S	.	*	T	Hydrogen-bonded Turn	trans	163.5	-27.7	-171.8	0	0	0	0	0	115.4	S35 M39 S40	S35-G37 PolarHBondContact O-N 3.17Å; G37-M39 PolarHBondContact O-N 3.22Å; G37-S40 PolarHBondContact O-N 2.94Å; G37-S40 VanDerWaalsContact O-N 3.13Å
38	K	62.6	Low	60.3	Low	130 Å²	130	111 Å²	111	57%	0.565	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.6	8.4	-179.7	80.6	-178.8	-146.6	-48.7	0	115.4	L34 S35	L34-K38 HydrophobicContact CB-CD 4.44Å; L34-K38 VanDerWaalsContact CB-NZ 3.27Å; L34-K38 HydrophobicContact CD2-CD 4.17Å; S35-K38 PolarHBondContact O-N 3.37Å
39	M	59.1	Low	59.9	Low	175 Å²	175	113.6 Å²	113.6	86%	0.862	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-136.4	39.4	167.2	62.8	174.5	-64	0	0	110.4	G37	G37-M39 PolarHBondContact O-N 3.22Å
40	S	67	Low	59.4	Low	105 Å²	105	113.3 Å²	113.3	73%	0.734	72%	0.719	S	S	*	*			trans	-111.1	54	172.6	-175.7	0	0	0	0	110.1	G37	G37-S40 PolarHBondContact O-N 2.94Å; G37-S40 VanDerWaalsContact O-N 3.13Å
41	E	64.9	Low	59.1	Low	159 Å²	159	111.6 Å²	111.6	74%	0.743	72%	0.722	S	S	*	*			trans	-115.4	99.9	155.2	-168.1	-178.4	169.4	0	0	106.3	L43	E41-L43 VanDerWaalsContact C-N 3.33Å; E41-L43 PolarHBondContact O-N 3.15Å
42	A	65.5	Low	58.9	Low	94 Å²	94	111.6 Å²	111.6	78%	0.777	73%	0.729	S	S	*	*			trans	-65.9	102.8	161.7	0	0	0	0	0	106	P44	A42-P44 WeakPolarHBondContact O-CD 3.45Å
43	L	60.2	Low	59	Low	128 Å²	128	110 Å²	110	67%	0.67	73%	0.729	S	S	*	*			trans	-53.4	124.5	163.1	-76	167.6	0	0	0	106.4	E41 L45	E41-L43 VanDerWaalsContact C-N 3.33Å; E41-L43 PolarHBondContact O-N 3.15Å; L43-L45 PolarHBondContact O-N 2.83Å
44	P	58.9	Low	58.8	Low	118 Å²	118	114.3 Å²	114.3	77%	0.766	74%	0.741	S	S	*	*			trans	-58.2	113.6	167.6	23.6	-29.3	0	0	0	105.5	A42 G46	A42-P44 WeakPolarHBondContact O-CD 3.45Å; P44-G46 PolarHBondContact O-N 3.14Å
45	L	54.8	Low	58.6	Low	168 Å²	168	113.6 Å²	113.6	88%	0.88	75%	0.752	S	S	*	*			trans	-68.8	71.1	168.7	-121.5	82.1	0	0	0	106.7	L43 A47	L43-L45 PolarHBondContact O-N 2.83Å; L45-A47 PolarHBondContact O-N 3.31Å
46	G	57.4	Low	58.6	Low	60 Å²	60	115.6 Å²	115.6	62%	0.619	77%	0.766	S	S	*	*			trans	-61.5	111.8	155.5	0	0	0	0	0	105.2	P44 P48	P44-G46 PolarHBondContact O-N 3.14Å; G46-P48 VanDerWaalsContact O-CD 3.26Å; G46-P48 WeakPolarHBondContact O-CD 3.26Å
47	A	53.3	Low	58.8	Low	85 Å²	85	117.7 Å²	117.7	70%	0.702	76%	0.761	S	S	*	*			trans	-48.6	127.2	179.7	0	0	0	0	0	110.5	L45	L45-A47 PolarHBondContact O-N 3.31Å
48	P	46.7	Very low	58.9	Low	113 Å²	113	123.8 Å²	123.8	73%	0.734	78%	0.782	S	S	*	*			trans	-103.2	95.1	160.1	29.7	-16.4	0	0	0	108.2	G46 G50	G46-P48 VanDerWaalsContact O-CD 3.26Å; G46-P48 WeakPolarHBondContact O-CD 3.26Å; P48-G50 PolarHBondContact O-N 3.46Å
49	D	53.6	Low	58.9	Low	163 Å²	163	128.7 Å²	128.7	87%	0.872	80%	0.797	S	S	*	*			trans	-51.3	116.7	144.2	-69.7	-70.3	0	0	0	107.7
50	G	53.6	Low	59.1	Low	67 Å²	67	126.1 Å²	126.1	69%	0.691	80%	0.796	S	S	*	*			trans	136.1	85.2	169.6	0	0	0	0	0	114.9	P48	P48-G50 PolarHBondContact O-N 3.46Å
51	G	57.1	Low	58.9	Low	81 Å²	81	124.4 Å²	124.4	84%	0.835	80%	0.795	S	S	*	*			trans	-61.7	139.6	159	0	0	0	0	0	111.2
52	A	58.2	Low	58.9	Low	107 Å²	107	123.6 Å²	123.6	88%	0.884	80%	0.796	S	S	*	*			trans	177.3	-22.9	150.5	0	0	0	0	0	116
53	A	59.2	Low	58.8	Low	101 Å²	101	131 Å²	131	84%	0.835	80%	0.804	S	S	*	*	S	Bend	trans	-110.4	-4.2	-149.6	0	0	0	0	0	120.5
54	L	57.8	Low	59.2	Low	169 Å²	169	129.6 Å²	129.6	89%	0.885	81%	0.805	S	S	*	*	S	Bend	trans	-135.1	2.3	-171.1	-130.9	111.5	0	0	0	118.6	S56	L54-S56 PolarHBondContact O-N 2.71Å
55	A	57.7	Low	59.7	Low	104 Å²	104	132.2 Å²	132.2	86%	0.86	81%	0.809	S	S	*	*	S	Bend	trans	-86.5	1.6	-176.8	0	0	0	0	0	115
56	S	61.1	Low	60.5	Low	114 Å²	114	130 Å²	130	80%	0.797	80%	0.802	S	S	*	*	S	Bend	trans	-128.9	51.2	-171.4	-162	0	0	0	0	113.5	L54	L54-S56 PolarHBondContact O-N 2.71Å
57	K	64.6	Low	60.7	Low	188 Å²	188	136.2 Å²	136.2	82%	0.817	82%	0.815	S	S	*	*			trans	-140.4	38.7	162.4	-68.5	-170	-175.5	-70.1	0	112.1	R59	K57-R59 PolarHBondContact O-N 3.05Å
58	L	62.6	Low	60.7	Low	171 Å²	171	142.1 Å²	142.1	90%	0.895	84%	0.842	S	S	*	*			trans	-88	69.8	163	-58.2	-174.2	0	0	0	108.8	S60	L58-S60 PolarHBondContact O-N 3.13Å; L58-S60 VanDerWaalsContact O-N 3.13Å
59	R	64.3	Low	61.4	Low	232 Å²	232	143.6 Å²	143.6	88%	0.875	85%	0.847	S	S	*	*			trans	-71.6	105.3	165.1	43.5	155.9	-161.3	-147.2	0.1	107	K57 G61	K57-R59 PolarHBondContact O-N 3.05Å; R59-G61 PolarHBondContact O-N 3.03Å
60	S	61.5	Low	61.8	Low	121 Å²	121	142.5 Å²	142.5	85%	0.846	85%	0.846	S	S	*	*			trans	-58.8	86.2	175.3	-166.9	0	0	0	0	109.8	L58	L58-S60 PolarHBondContact O-N 3.13Å; L58-S60 VanDerWaalsContact O-N 3.13Å
61	G	64.1	Low	62.3	Low	69 Å²	69	146.7 Å²	146.7	71%	0.711	85%	0.854	S	S	*	*			trans	-103.2	78.8	174.7	0	0	0	0	0	108.5	R59	R59-G61 PolarHBondContact O-N 3.03Å
62	D	63.8	Low	62.6	Low	143 Å²	143	150.6 Å²	150.6	77%	0.765	86%	0.856	S	S	*	*			trans	-160.5	48.2	158	-134.6	-8.9	0	0	0	113.1	S64	D62-S64 PolarHBondContact O-N 3.23Å
63	R	64.6	Low	62.9	Low	248 Å²	248	153.3 Å²	153.3	94%	0.936	85%	0.854	S	S	*	*			trans	-85.6	69.9	158.6	-64.1	-174.4	-165.1	160.9	3.9	108	M65	R63-M65 PolarHBondContact O-N 2.71Å
64	S	68.4	Low	63.1	Low	99 Å²	99	156.8 Å²	156.8	69%	0.692	86%	0.855	S	S	*	*			trans	-73.9	100.2	168.9	-172.8	0	0	0	0	108.3	D62 V66	D62-S64 PolarHBondContact O-N 3.23Å; S64-V66 PolarHBondContact O-N 3.17Å
65	M	69.7	Low	63.5	Low	173 Å²	173	155.9 Å²	155.9	85%	0.852	85%	0.853	S	S	*	*	P	Polyproline II helix	trans	-71.1	117.4	169.8	-172.5	175.4	-64.9	0	0	107	R63 E67	R63-M65 PolarHBondContact O-N 2.71Å; M65-E67 PolarHBondContact O-N 2.91Å
66	V	70.7	Confident	64	Low	123 Å²	123	159.9 Å²	159.9	75%	0.745	85%	0.852	S	S	*	*	P	Polyproline II helix	trans	-50.7	121.6	173.8	155.8	0	0	0	0	109.4	S64	S64-V66 PolarHBondContact O-N 3.17Å
67	E	62.2	Low	64.2	Low	190 Å²	190	163.8 Å²	163.8	89%	0.888	86%	0.857	S	S	*	*	P	Polyproline II helix	trans	-79.4	133.8	164.8	-67.6	-171.2	160.7	0	0	109	M65	M65-E67 PolarHBondContact O-N 2.91Å
68	V	53.8	Low	64.2	Low	208 Å²	208	161.5 Å²	161.5	100%	1.261	86%	0.861	S	S	*	*			trans	-91.8	0	174.6	155.4	0	0	0	0	109.8

Retrieved 68 of 68 residues in 22.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).