A0A087WR07_MOUSE Loading...

Frey regulator of sperm-oocyte fusion 1

AlphaFold DB , UniProt , Accession A0A087WR07, Species MOUSE (Mus musculus, Mouse), Gene Frey1, Length 35 aa.

						>A0A087WR07_MOUSE|A0A087WR07|Frey1
MVLAMLGALYPRAGLSLFLFYLILAGALLRPQPQR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.6	Low	64.9	Low	202 Å²	202	115.6 Å²	115.6	100%	0.995	65%	0.65	S	S	*	*				0	-54.8	0	-151.3	148.6	172.7	0	0	112	L3 A4 M5	M1-L3 VanDerWaalsContact C-N 3.34Å; M1-L3 PolarHBondContact O-N 3.4Å; M1-A4 PolarHBondContact O-N 2.73Å; M1-A4 VanDerWaalsContact O-N 3.09Å; M1-M5 PolarHBondContact O-N 2.77Å
2	V	63.1	Low	65.4	Low	113 Å²	113	122.1 Å²	122.1	69%	0.685	66%	0.657	S	S	*	*	H	α-helix	trans	-53.8	-44.2	171.6	147.4	0	0	0	0	113.1	A4 M5 L6	V2-A4 VanDerWaalsContact C-N 3.29Å; V2-A4 PolarHBondContact O-N 2.72Å; V2-M5 PolarHBondContact O-N 3.29Å; V2-L6 VanDerWaalsContact O-CB 3.28Å; V2-L6 WeakPolarHBondContact O-CB 3.48Å; V2-L6 PolarHBondContact O-N 2.96Å
3	L	65.8	Low	66.1	Low	152 Å²	152	116.9 Å²	116.9	80%	0.796	64%	0.641	S	S	*	*	H	α-helix	trans	-62.6	-32.3	177	-103.1	112.3	0	0	0	113.9	M1 G7	M1-L3 VanDerWaalsContact C-N 3.34Å; M1-L3 PolarHBondContact O-N 3.4Å; L3-G7 WeakPolarHBondContact O-CA 3.16Å; L3-G7 PolarHBondContact O-N 2.9Å
4	A	65.6	Low	66.9	Low	73 Å²	73	111.3 Å²	111.3	60%	0.603	62%	0.623	S	S	*	*	H	α-helix	trans	-75.9	-38.4	176.9	0	0	0	0	0	111.3	M1 V2 G7 A8	M1-A4 PolarHBondContact O-N 2.73Å; M1-A4 VanDerWaalsContact O-N 3.09Å; V2-A4 VanDerWaalsContact C-N 3.29Å; V2-A4 PolarHBondContact O-N 2.72Å; A4-G7 CarbonylContact O-C 3.54Å; A4-G7 PolarHBondContact O-N 2.81Å; A4-A8 WeakPolarHBondContact O-CB 3.19Å; A4-A8 PolarHBondContact O-N 3.28Å
5	M	68.1	Low	67.9	Low	139 Å²	139	111.1 Å²	111.1	69%	0.685	62%	0.62	S	S	*	*	H	α-helix	trans	-66.4	-41.7	171.3	-87.5	179.3	150.1	0	0	112	M1 V2 G7 A8 L9	M1-M5 PolarHBondContact O-N 2.77Å; V2-M5 PolarHBondContact O-N 3.29Å; M5-G7 VanDerWaalsContact C-N 3.34Å; M5-A8 PolarHBondContact O-N 3.33Å; M5-L9 VanDerWaalsContact O-CB 3.32Å; M5-L9 WeakPolarHBondContact O-CB 3.49Å; M5-L9 PolarHBondContact O-N 3.29Å
6	L	65.5	Low	68.9	Low	109 Å²	109	108.9 Å²	108.9	57%	0.571	61%	0.614	S	S	*	*	H	α-helix	trans	-66.3	-39.7	174.8	-150.9	77.4	0	0	0	110.6	V2 A8 L9 Y10	V2-L6 VanDerWaalsContact O-CB 3.28Å; V2-L6 WeakPolarHBondContact O-CB 3.48Å; V2-L6 PolarHBondContact O-N 2.96Å; L6-A8 VanDerWaalsContact C-N 3.26Å; L6-A8 PolarHBondContact O-N 2.87Å; L6-L9 PolarHBondContact O-N 2.87Å; L6-Y10 VanDerWaalsContact O-CB 3.26Å; L6-Y10 WeakPolarHBondContact O-CB 3.37Å; L6-Y10 PolarHBondContact O-N 3.18Å
7	G	66	Low	69.8	Low	48 Å²	48	108.1 Å²	108.1	50%	0.495	61%	0.607	S	S	.	*	H	α-helix	trans	-68.9	-17.4	173.3	0	0	0	0	0	114.4	L3 A4 M5 P11	L3-G7 WeakPolarHBondContact O-CA 3.16Å; L3-G7 PolarHBondContact O-N 2.9Å; A4-G7 CarbonylContact O-C 3.54Å; A4-G7 PolarHBondContact O-N 2.81Å; M5-G7 VanDerWaalsContact C-N 3.34Å; G7-P11 WeakPolarHBondContact O-CD 3.3Å; G7-P11 WeakPolarHBondContact O-CG 3.5Å
8	A	65.2	Low	70.8	Confident	63 Å²	63	109.7 Å²	109.7	52%	0.521	61%	0.607	S	S	.	*	H	α-helix	trans	-93.4	-27.9	169.1	0	0	0	0	0	112.4	A4 M5 L6 P11	A4-A8 WeakPolarHBondContact O-CB 3.19Å; A4-A8 PolarHBondContact O-N 3.28Å; M5-A8 PolarHBondContact O-N 3.33Å; L6-A8 VanDerWaalsContact C-N 3.26Å; L6-A8 PolarHBondContact O-N 2.87Å; A8-P11 WeakPolarHBondContact O-CD 3.23Å; A8-P11 WeakPolarHBondContact O-CG 3.21Å
9	L	63.1	Low	71.7	Confident	112 Å²	112	108.4 Å²	108.4	59%	0.586	60%	0.599	S	S	*	*	H	α-helix	trans	-75.8	-36.9	175.7	-153.5	73	0	0	0	111.6	M5 L6 R12 A13	M5-L9 VanDerWaalsContact O-CB 3.32Å; M5-L9 WeakPolarHBondContact O-CB 3.49Å; M5-L9 PolarHBondContact O-N 3.29Å; L6-L9 PolarHBondContact O-N 2.87Å; L9-R12 PolarHBondContact O-N 3.41Å; L9-A13 WeakPolarHBondContact O-CB 3.34Å; L9-A13 PolarHBondContact O-N 2.88Å
10	Y	62.8	Low	72.6	Confident	186 Å²	186	109.4 Å²	109.4	73%	0.729	60%	0.596	S	S	*	*	H	α-helix	trans	-64.3	-45.6	178.5	-162.9	-99.9	0	0	0	114.6	L6 R12 A13 G14	L6-Y10 VanDerWaalsContact O-CB 3.26Å; L6-Y10 WeakPolarHBondContact O-CB 3.37Å; L6-Y10 PolarHBondContact O-N 3.18Å; Y10-R12 VanDerWaalsContact C-N 3.28Å; Y10-R12 PolarHBondContact O-N 2.82Å; Y10-A13 PolarHBondContact O-N 2.88Å; Y10-G14 PolarHBondContact O-N 3.4Å
11	P	68.3	Low	73.4	Confident	75 Å²	75	110.9 Å²	110.9	49%	0.487	60%	0.595	S	S	.	*	H	α-helix	trans	-66.2	-33	175.2	25.1	-34.5	0	0	0	111.5	G7 A8 L15	G7-P11 WeakPolarHBondContact O-CD 3.3Å; G7-P11 WeakPolarHBondContact O-CG 3.5Å; A8-P11 WeakPolarHBondContact O-CD 3.23Å; A8-P11 WeakPolarHBondContact O-CG 3.21Å; P11-L15 VanDerWaalsContact O-CB 3.32Å; P11-L15 WeakPolarHBondContact O-CB 3.48Å; P11-L15 PolarHBondContact O-N 3.46Å
12	R	71.1	Confident	74.8	Confident	193 Å²	193	106.3 Å²	106.3	73%	0.728	57%	0.573	S	S	*	*	H	α-helix	trans	-70.2	-40.5	174.5	-169.8	176.6	-178.2	179	1.2	112	L9 Y10 L15 S16	L9-R12 PolarHBondContact O-N 3.41Å; Y10-R12 VanDerWaalsContact C-N 3.28Å; Y10-R12 PolarHBondContact O-N 2.82Å; R12-L15 PolarHBondContact O-N 2.8Å; R12-S16 WeakPolarHBondContact O-CB 3.31Å; R12-S16 PolarHBondContact O-N 3.45Å
13	A	74.1	Confident	76.1	Confident	55 Å²	55	106.7 Å²	106.7	46%	0.455	57%	0.571	S	S	.	*	H	α-helix	trans	-64.7	-41.1	173.8	0	0	0	0	0	111.3	L9 Y10 S16 L17	L9-A13 WeakPolarHBondContact O-CB 3.34Å; L9-A13 PolarHBondContact O-N 2.88Å; Y10-A13 PolarHBondContact O-N 2.88Å; A13-S16 PolarHBondContact O-N 3.26Å; A13-L17 WeakPolarHBondContact O-CB 3.33Å; A13-L17 PolarHBondContact O-N 2.97Å
14	G	78.1	Confident	77.2	Confident	38 Å²	38	103 Å²	103	39%	0.392	55%	0.551	S	S	.	*	H	α-helix	trans	-63.1	-45.1	173.8	0	0	0	0	0	112.6	Y10 L17 F18	Y10-G14 PolarHBondContact O-N 3.4Å; G14-L17 PolarHBondContact O-N 3.49Å; G14-F18 VanDerWaalsContact O-CB 3.25Å; G14-F18 WeakPolarHBondContact O-CB 3.26Å; G14-F18 PolarHBondContact O-N 2.89Å
15	L	81.6	Confident	78.4	Confident	109 Å²	109	101.6 Å²	101.6	57%	0.571	54%	0.539	S	S	*	.	H	α-helix	trans	-62.6	-46	175.3	-170.2	96.6	0	0	0	111.4	P11 R12 L17 F18 L19	P11-L15 VanDerWaalsContact O-CB 3.32Å; P11-L15 WeakPolarHBondContact O-CB 3.48Å; P11-L15 PolarHBondContact O-N 3.46Å; R12-L15 PolarHBondContact O-N 2.8Å; L15-L17 VanDerWaalsContact C-N 3.33Å; L15-L17 PolarHBondContact O-N 2.83Å; L15-F18 PolarHBondContact O-N 3.45Å; L15-L19 HydrophobicContact CD2-CD1 4.31Å; L15-L19 HydrophobicContact CG-CD1 4.36Å; L15-L19 VanDerWaalsContact O-CG 3.31Å; L15-L19 WeakPolarHBondContact O-CG 3.32Å; L15-L19 PolarHBondContact O-N 3.44Å
16	S	82.8	Confident	79.4	Confident	76 Å²	76	96.9 Å²	96.9	53%	0.531	53%	0.527	S	S	.	.	H	α-helix	trans	-62.3	-41.8	178	-171.3	0	0	0	0	111.8	R12 A13 F20	R12-S16 WeakPolarHBondContact O-CB 3.31Å; R12-S16 PolarHBondContact O-N 3.45Å; A13-S16 PolarHBondContact O-N 3.26Å; S16-F20 WeakPolarHBondContact O-CB 3.4Å; S16-F20 PolarHBondContact O-N 3.36Å
17	L	85.3	Confident	80.3	Confident	94 Å²	94	94 Å²	94	49%	0.492	52%	0.519	S	S	.	.	H	α-helix	trans	-66.9	-41.4	176.7	-172.8	65.9	0	0	0	111	A13 G14 L15 F20 Y21	A13-L17 WeakPolarHBondContact O-CB 3.33Å; A13-L17 PolarHBondContact O-N 2.97Å; G14-L17 PolarHBondContact O-N 3.49Å; L15-L17 VanDerWaalsContact C-N 3.33Å; L15-L17 PolarHBondContact O-N 2.83Å; L17-F20 WeakPolarHBondContact O-CB 3.25Å; L17-F20 PolarHBondContact O-N 2.91Å; L17-Y21 HydrophobicContact CD1-CD2 4.04Å; L17-Y21 HydrophobicContact CD1-CE2 3.65Å; L17-Y21 HydrophobicContact CD2-CE2 4.18Å; L17-Y21 HydrophobicContact CG-CD2 3.83Å; L17-Y21 HydrophobicContact CG-CE2 3.68Å; L17-Y21 VanDerWaalsContact O-CD2 3.26Å; L17-Y21 WeakPolarHBondContact O-CD2 3.4Å; L17-Y21 PolarHBondContact O-N 3.29Å
18	F	86.6	Confident	81.2	Confident	137 Å²	137	98 Å²	98	60%	0.601	53%	0.528	S	S	*	.	H	α-helix	trans	-61.2	-46	176.1	-178.8	-99.6	0	0	0	111.7	G14 L15 F20 Y21 L22	G14-F18 VanDerWaalsContact O-CB 3.25Å; G14-F18 WeakPolarHBondContact O-CB 3.26Å; G14-F18 PolarHBondContact O-N 2.89Å; L15-F18 PolarHBondContact O-N 3.45Å; F18-F20 VanDerWaalsContact C-N 3.34Å; F18-F20 PolarHBondContact O-N 2.87Å; F18-Y21 PolarHBondContact O-N 2.82Å; F18-L22 WeakPolarHBondContact O-CB 3.37Å; F18-L22 PolarHBondContact O-N 3.2Å
19	L	88.5	Confident	82	Confident	86 Å²	86	101.9 Å²	101.9	45%	0.45	54%	0.539	S	S	.	.	H	α-helix	trans	-63.3	-40.6	175.2	-69.2	173.5	0	0	0	111.7	L15 L22 I23	L15-L19 HydrophobicContact CD2-CD1 4.31Å; L15-L19 HydrophobicContact CG-CD1 4.36Å; L15-L19 VanDerWaalsContact O-CG 3.31Å; L15-L19 WeakPolarHBondContact O-CG 3.32Å; L15-L19 PolarHBondContact O-N 3.44Å; L19-L22 PolarHBondContact O-N 2.88Å; L19-I23 WeakPolarHBondContact O-CD1 3.32Å; L19-I23 VanDerWaalsContact O-CG1 3.3Å; L19-I23 WeakPolarHBondContact O-CG1 3.16Å; L19-I23 PolarHBondContact O-N 2.78Å
20	F	90.2	Very high	82.6	Confident	127 Å²	127	104.7 Å²	104.7	56%	0.557	54%	0.542	S	S	*	.	H	α-helix	trans	-60.9	-47.5	175.2	-178.4	-95.7	0	0	0	111.8	S16 L17 F18 L22 I23 L24	S16-F20 WeakPolarHBondContact O-CB 3.4Å; S16-F20 PolarHBondContact O-N 3.36Å; L17-F20 WeakPolarHBondContact O-CB 3.25Å; L17-F20 PolarHBondContact O-N 2.91Å; F18-F20 VanDerWaalsContact C-N 3.34Å; F18-F20 PolarHBondContact O-N 2.87Å; F20-L22 VanDerWaalsContact C-N 3.32Å; F20-L22 PolarHBondContact O-N 2.82Å; F20-I23 PolarHBondContact O-N 2.8Å; F20-L24 HydrophobicContact CE1-CD2 4.39Å; F20-L24 WeakPolarHBondContact O-CB 3.22Å; F20-L24 PolarHBondContact O-N 3.44Å
21	Y	88.4	Confident	82.9	Confident	142 Å²	142	101.1 Å²	101.1	56%	0.557	54%	0.542	S	S	*	.	H	α-helix	trans	-63.2	-37	175.3	-85.9	-69.4	0	0	0	112.5	L17 F18 L24 A25	L17-Y21 HydrophobicContact CD1-CD2 4.04Å; L17-Y21 HydrophobicContact CD1-CE2 3.65Å; L17-Y21 HydrophobicContact CD2-CE2 4.18Å; L17-Y21 HydrophobicContact CG-CD2 3.83Å; L17-Y21 HydrophobicContact CG-CE2 3.68Å; L17-Y21 VanDerWaalsContact O-CD2 3.26Å; L17-Y21 WeakPolarHBondContact O-CD2 3.4Å; L17-Y21 PolarHBondContact O-N 3.29Å; F18-Y21 PolarHBondContact O-N 2.82Å; Y21-L24 PolarHBondContact O-N 2.9Å; Y21-A25 WeakPolarHBondContact O-CB 3.32Å; Y21-A25 PolarHBondContact O-N 3.23Å
22	L	90.7	Very high	82.9	Confident	105 Å²	105	105 Å²	105	55%	0.55	55%	0.553	S	S	.	*	H	α-helix	trans	-64.1	-43.8	176.7	-173.5	66.7	0	0	0	111.5	F18 L19 F20 G26	F18-L22 WeakPolarHBondContact O-CB 3.37Å; F18-L22 PolarHBondContact O-N 3.2Å; L19-L22 PolarHBondContact O-N 2.88Å; F20-L22 VanDerWaalsContact C-N 3.32Å; F20-L22 PolarHBondContact O-N 2.82Å; L22-G26 PolarHBondContact O-N 3.3Å
23	I	89.9	Confident	82.6	Confident	122 Å²	122	100.9 Å²	100.9	63%	0.626	55%	0.551	S	S	*	*	H	α-helix	trans	-64.6	-45.9	175.6	-66.8	161.5	0	0	0	110.3	L19 F20 G26 A27	L19-I23 WeakPolarHBondContact O-CD1 3.32Å; L19-I23 VanDerWaalsContact O-CG1 3.3Å; L19-I23 WeakPolarHBondContact O-CG1 3.16Å; L19-I23 PolarHBondContact O-N 2.78Å; F20-I23 PolarHBondContact O-N 2.8Å; I23-G26 CarbonylContact O-C 3.6Å; I23-G26 PolarHBondContact O-N 3.38Å; I23-A27 WeakPolarHBondContact O-CB 2.8Å; I23-A27 PolarHBondContact O-N 2.82Å
24	L	89.6	Confident	82.2	Confident	74 Å²	74	107.4 Å²	107.4	39%	0.387	57%	0.573	S	S	.	*	H	α-helix	trans	-62.2	-45.6	178.6	-178.7	62	0	0	0	111.5	F20 Y21 G26 A27 L28	F20-L24 HydrophobicContact CE1-CD2 4.39Å; F20-L24 WeakPolarHBondContact O-CB 3.22Å; F20-L24 PolarHBondContact O-N 3.44Å; Y21-L24 PolarHBondContact O-N 2.9Å; L24-G26 VanDerWaalsContact C-N 3.35Å; L24-A27 PolarHBondContact O-N 3.26Å; L24-L28 HydrophobicContact CG-CD1 4.23Å; L24-L28 WeakPolarHBondContact O-CB 3.4Å; L24-L28 WeakPolarHBondContact O-CG 3.17Å; L24-L28 PolarHBondContact O-N 2.76Å
25	A	90.2	Very high	81.4	Confident	43 Å²	43	120.4 Å²	120.4	36%	0.355	61%	0.61	S	S	.	*	H	α-helix	trans	-61.3	-44.3	175.1	0	0	0	0	0	110.9	Y21 A27 L28 L29	Y21-A25 WeakPolarHBondContact O-CB 3.32Å; Y21-A25 PolarHBondContact O-N 3.23Å; A25-A27 VanDerWaalsContact C-N 3.3Å; A25-A27 PolarHBondContact O-N 3.33Å; A25-L28 PolarHBondContact O-N 3.03Å; A25-L29 VanDerWaalsContact O-CB 3.23Å; A25-L29 WeakPolarHBondContact O-CB 3.46Å; A25-L29 WeakPolarHBondContact O-CG 3.35Å; A25-L29 PolarHBondContact O-N 3.41Å
26	G	88.9	Confident	81.4	Confident	41 Å²	41	121 Å²	121	42%	0.423	61%	0.612	S	S	.	*	H	α-helix	trans	-61	-37.2	173.7	0	0	0	0	0	112.9	L22 I23 L24 R30	L22-G26 PolarHBondContact O-N 3.3Å; I23-G26 CarbonylContact O-C 3.6Å; I23-G26 PolarHBondContact O-N 3.38Å; L24-G26 VanDerWaalsContact C-N 3.35Å; G26-R30 WeakPolarHBondContact O-CB 3.28Å; G26-R30 PolarHBondContact O-N 3.36Å
27	A	85.9	Confident	81.3	Confident	48 Å²	48	123.4 Å²	123.4	40%	0.397	62%	0.616	S	S	.	*	H	α-helix	trans	-72	-34.1	176.8	0	0	0	0	0	113.2	I23 L24 A25	I23-A27 WeakPolarHBondContact O-CB 2.8Å; I23-A27 PolarHBondContact O-N 2.82Å; L24-A27 PolarHBondContact O-N 3.26Å; A25-A27 VanDerWaalsContact C-N 3.3Å; A25-A27 PolarHBondContact O-N 3.33Å
28	L	83.8	Confident	81.1	Confident	132 Å²	132	125 Å²	125	69%	0.691	62%	0.623	S	S	*	*	H	α-helix	trans	-74.8	-40.7	174.5	-72.9	171.8	0	0	0	112.1	L24 A25 R30	L24-L28 HydrophobicContact CG-CD1 4.23Å; L24-L28 WeakPolarHBondContact O-CB 3.4Å; L24-L28 WeakPolarHBondContact O-CG 3.17Å; L24-L28 PolarHBondContact O-N 2.76Å; A25-L28 PolarHBondContact O-N 3.03Å; L28-R30 VanDerWaalsContact C-N 3.32Å
29	L	82.3	Confident	80.8	Confident	144 Å²	144	124.3 Å²	124.3	75%	0.754	62%	0.624	S	S	*	*	H	α-helix	trans	-74.7	-25.5	176.9	-71.6	171.2	0	0	0	112	A25 P31	A25-L29 VanDerWaalsContact O-CB 3.23Å; A25-L29 WeakPolarHBondContact O-CB 3.46Å; A25-L29 WeakPolarHBondContact O-CG 3.35Å; A25-L29 PolarHBondContact O-N 3.41Å; L29-P31 WeakPolarHBondContact O-CD 3.26Å; L29-P31 VanDerWaalsContact O-N 3.09Å
30	R	74.9	Confident	80.3	Confident	172 Å²	172	126.7 Å²	126.7	65%	0.649	64%	0.635	S	S	*	*	S	Bend	trans	-61.6	115.9	167.6	-174.8	174.1	-169.8	-120.5	1.7	105.6	G26 L28 Q32	G26-R30 WeakPolarHBondContact O-CB 3.28Å; G26-R30 PolarHBondContact O-N 3.36Å; L28-R30 VanDerWaalsContact C-N 3.32Å; R30-Q32 VanDerWaalsContact C-N 3.3Å; R30-Q32 PolarHBondContact O-N 3.09Å
31	P	69.3	Low	79.6	Confident	111 Å²	111	126.7 Å²	126.7	72%	0.721	64%	0.64	S	S	*	*			trans	-59.9	104.8	171.9	24.9	-30.5	0	0	0	105.5	L29 P33	L29-P31 WeakPolarHBondContact O-CD 3.26Å; L29-P31 VanDerWaalsContact O-N 3.09Å; P31-P33 WeakPolarHBondContact O-CD 3.42Å; P31-P33 VanDerWaalsContact O-N 3.16Å
32	Q	68.7	Low	79	Confident	156 Å²	156	125.6 Å²	125.6	73%	0.729	65%	0.646	S	S	*	*			trans	-56.3	125.7	167.9	-69.1	-159.8	1.1	0	0	104.4	R30 Q34	R30-Q32 VanDerWaalsContact C-N 3.3Å; R30-Q32 PolarHBondContact O-N 3.09Å; Q32-Q34 PolarHBondContact O-N 3.39Å
33	P	65.9	Low	78.1	Confident	106 Å²	106	127.2 Å²	127.2	69%	0.688	65%	0.653	S	S	*	*			trans	-57.7	105.5	171.6	24.1	-29.5	0	0	0	104.4	P31 R35	P31-P33 WeakPolarHBondContact O-CD 3.42Å; P31-P33 VanDerWaalsContact O-N 3.16Å; P33-R35 PolarHBondContact O-N 2.78Å
34	Q	64.9	Low	77.1	Confident	193 Å²	193	127.6 Å²	127.6	90%	0.902	66%	0.656	S	S	*	*			trans	-57.3	91.2	178.6	-176.1	177.6	-9.5	0	0	104.9	Q32	Q32-Q34 PolarHBondContact O-N 3.39Å
35	R	61.1	Low	76	Confident	311 Å²	311	132.5 Å²	132.5	100%	1.174	68%	0.68	S	S	*	*			trans	-66.7	0	171.5	-105.6	-165.5	-177.9	160.7	0.5	108	P33	P33-R35 PolarHBondContact O-N 2.78Å

Retrieved 35 of 35 residues in 11.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).