A0A087WR17_MOUSE Loading...

MAS-related GPR, member B1

AlphaFold DB , UniProt , Accession A0A087WR17, Species MOUSE (Mus musculus, Mouse), Gene Mrgprb1, Length 57 aa.

						>A0A087WR17_MOUSE|A0A087WR17|Mrgprb1
MEQRHHRFQRKTLKLLLQRAMQDSPEEEECGEMGSSRRPREIKTVWKGLRAALIRHK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.7	Low	62.9	Low	212 Å²	212	154.6 Å²	154.6	100%	1.044	67%	0.673	S	S	*	*				0	12.3	0	-72.8	-124.2	-97.9	0	0	113.2
2	E	54.1	Low	64.7	Low	169 Å²	169	146.2 Å²	146.2	79%	0.79	64%	0.644	S	S	*	*	H	α-helix	trans	-88.1	-25.6	-174.1	-72.3	154.8	120.4	0	0	114.9	R4 H5	E2-R4 VanDerWaalsContact C-N 3.34Å; E2-R4 PolarHBondContact O-N 2.86Å; E2-H5 PolarHBondContact O-N 3.11Å
3	Q	56.7	Low	66.2	Low	164 Å²	164	144 Å²	144	77%	0.766	64%	0.642	S	S	*	*	H	α-helix	trans	-72	-26.4	-176.4	-62.5	-79.9	58.1	0	0	113.4	R7	Q3-R7 PolarHBondContact O-N 2.87Å
4	R	58.4	Low	67.6	Low	211 Å²	211	143.2 Å²	143.2	80%	0.796	64%	0.637	S	S	*	*	H	α-helix	trans	-71.9	-37	178.8	-79.2	-176.8	169.1	171	-3.9	111.5	E2 F8	E2-R4 VanDerWaalsContact C-N 3.34Å; E2-R4 PolarHBondContact O-N 2.86Å; R4-F8 WeakPolarHBondContact O-CB 3.4Å; R4-F8 PolarHBondContact O-N 3.02Å
5	H	59.8	Low	68.9	Low	121 Å²	121	141.5 Å²	141.5	56%	0.56	64%	0.636	S	S	*	*	H	α-helix	trans	-68.4	-46.3	-178.8	-157.5	129.9	0	0	0	110.7	E2 R7 F8 Q9	E2-H5 PolarHBondContact O-N 3.11Å; H5-R7 PolarHBondContact O-N 3.46Å; H5-F8 PolarHBondContact O-N 3.42Å; H5-Q9 PolarHBondContact CD2-NE2 3.32Å; H5-Q9 PolarHBondContact NE2-NE2 2.97Å; H5-Q9 WeakPolarHBondContact O-CB 3.33Å; H5-Q9 WeakPolarHBondContact O-CG 3.35Å; H5-Q9 PolarHBondContact O-N 3.01Å
6	H	60.6	Low	70	Confident	103 Å²	103	139.6 Å²	139.6	48%	0.477	63%	0.632	S	S	.	*	H	α-helix	trans	-65.6	-41.1	-179.8	-174.1	44.6	0	0	0	112.8	F8 R10	H6-F8 VanDerWaalsContact C-N 3.34Å; H6-F8 PolarHBondContact O-N 2.91Å; H6-R10 WeakPolarHBondContact O-CG 3.42Å; H6-R10 PolarHBondContact O-N 2.74Å; H6-R10 VanDerWaalsContact O-N 3.13Å
7	R	60.4	Low	70.8	Confident	179 Å²	179	137.3 Å²	137.3	68%	0.675	63%	0.626	S	S	*	*	H	α-helix	trans	-68	-34.8	177.1	-165.2	177.4	-176.1	-167.4	1.5	112.2	Q3 H5 K11	Q3-R7 PolarHBondContact O-N 2.87Å; H5-R7 PolarHBondContact O-N 3.46Å; R7-K11 WeakPolarHBondContact O-CG 3.44Å; R7-K11 PolarHBondContact O-N 3Å
8	F	63.8	Low	71.6	Confident	142 Å²	142	134.2 Å²	134.2	62%	0.623	61%	0.613	S	S	*	*	H	α-helix	trans	-69.3	-46.4	176.3	-174.4	-104.2	0	0	0	111.4	R4 H5 H6 R10 K11 T12	R4-F8 WeakPolarHBondContact O-CB 3.4Å; R4-F8 PolarHBondContact O-N 3.02Å; H5-F8 PolarHBondContact O-N 3.42Å; H6-F8 VanDerWaalsContact C-N 3.34Å; H6-F8 PolarHBondContact O-N 2.91Å; F8-R10 VanDerWaalsContact C-N 3.31Å; F8-R10 PolarHBondContact O-N 3.32Å; F8-K11 PolarHBondContact O-N 3.31Å; F8-K11 VanDerWaalsContact O-N 3.14Å; F8-T12 PolarHBondContact O-N 3.15Å; F8-T12 PolarHBondContact O-OG1 2.94Å; F8-T12 VanDerWaalsContact O-OG1 3.1Å
9	Q	71.8	Confident	72.3	Confident	100 Å²	100	135.9 Å²	135.9	47%	0.467	61%	0.614	S	S	.	*	H	α-helix	trans	-55.5	-43.7	174.6	-78.1	175.6	-11	0	0	112.5	H5 K11 T12 L13	H5-Q9 PolarHBondContact CD2-NE2 3.32Å; H5-Q9 PolarHBondContact NE2-NE2 2.97Å; H5-Q9 WeakPolarHBondContact O-CB 3.33Å; H5-Q9 WeakPolarHBondContact O-CG 3.35Å; H5-Q9 PolarHBondContact O-N 3.01Å; Q9-K11 PolarHBondContact O-N 2.9Å; Q9-T12 PolarHBondContact O-N 3.31Å; Q9-L13 WeakPolarHBondContact O-CB 3.29Å; Q9-L13 PolarHBondContact O-N 3.43Å
10	R	76.1	Confident	72.8	Confident	174 Å²	174	131.9 Å²	131.9	66%	0.657	61%	0.605	S	S	*	*	H	α-helix	trans	-64.7	-37.8	178.9	-71.7	-178.2	69.7	-178.9	2.3	112.9	H6 F8 K14	H6-R10 WeakPolarHBondContact O-CG 3.42Å; H6-R10 PolarHBondContact O-N 2.74Å; H6-R10 VanDerWaalsContact O-N 3.13Å; F8-R10 VanDerWaalsContact C-N 3.31Å; F8-R10 PolarHBondContact O-N 3.32Å; R10-K14 VanDerWaalsContact O-CB 3.3Å; R10-K14 WeakPolarHBondContact O-CB 3.28Å; R10-K14 PolarHBondContact O-N 3.5Å
11	K	79.2	Confident	73.1	Confident	126 Å²	126	131.1 Å²	131.1	55%	0.548	60%	0.604	S	S	.	*	H	α-helix	trans	-69.4	-44.6	176.7	-72.6	-177	176.7	-169.1	0	111.3	R7 F8 Q9 K14 L15	R7-K11 WeakPolarHBondContact O-CG 3.44Å; R7-K11 PolarHBondContact O-N 3Å; F8-K11 PolarHBondContact O-N 3.31Å; F8-K11 VanDerWaalsContact O-N 3.14Å; Q9-K11 PolarHBondContact O-N 2.9Å; K11-K14 PolarHBondContact O-N 3.2Å; K11-L15 WeakPolarHBondContact O-CG 3.42Å; K11-L15 PolarHBondContact O-N 2.92Å
12	T	85.4	Confident	74.5	Confident	53 Å²	53	128.3 Å²	128.3	33%	0.325	59%	0.588	S	S	.	*	H	α-helix	trans	-63.7	-46.3	177.1	-55.5	0	0	0	0	111.1	F8 Q9 K14 L15 L16	F8-T12 PolarHBondContact O-N 3.15Å; F8-T12 PolarHBondContact O-OG1 2.94Å; F8-T12 VanDerWaalsContact O-OG1 3.1Å; Q9-T12 PolarHBondContact O-N 3.31Å; T12-K14 VanDerWaalsContact C-N 3.31Å; T12-K14 PolarHBondContact O-N 3.04Å; T12-L15 PolarHBondContact O-N 3.43Å; T12-L16 HydrophobicContact CG2-CD1 4.06Å; T12-L16 HydrophobicContact CG2-CG 4.42Å; T12-L16 WeakPolarHBondContact O-CG 3.45Å; T12-L16 PolarHBondContact O-N 3.04Å
13	L	83.5	Confident	75.3	Confident	118 Å²	118	125.6 Å²	125.6	62%	0.618	58%	0.579	S	S	*	*	H	α-helix	trans	-59.5	-41.9	175.7	-178.2	62.3	0	0	0	111.6	Q9 L15 L16 L17	Q9-L13 WeakPolarHBondContact O-CB 3.29Å; Q9-L13 PolarHBondContact O-N 3.43Å; L13-L15 PolarHBondContact O-N 2.93Å; L13-L16 PolarHBondContact O-N 3Å; L13-L17 VanDerWaalsContact O-CB 3.29Å; L13-L17 WeakPolarHBondContact O-CB 3.33Å; L13-L17 PolarHBondContact O-N 3.39Å
14	K	86.3	Confident	75.6	Confident	133 Å²	133	120.8 Å²	120.8	58%	0.578	56%	0.564	S	S	*	*	H	α-helix	trans	-60.4	-45.4	175.9	-173	-178.7	179.6	-177.6	0	111.8	R10 K11 T12 L17 Q18	R10-K14 VanDerWaalsContact O-CB 3.3Å; R10-K14 WeakPolarHBondContact O-CB 3.28Å; R10-K14 PolarHBondContact O-N 3.5Å; K11-K14 PolarHBondContact O-N 3.2Å; T12-K14 VanDerWaalsContact C-N 3.31Å; T12-K14 PolarHBondContact O-N 3.04Å; K14-L17 PolarHBondContact O-N 3.49Å; K14-Q18 WeakPolarHBondContact O-CB 3.3Å; K14-Q18 VanDerWaalsContact O-CG 3.28Å; K14-Q18 WeakPolarHBondContact O-CG 3.48Å; K14-Q18 PolarHBondContact O-N 3.33Å
15	L	87.2	Confident	75.5	Confident	117 Å²	117	116.4 Å²	116.4	61%	0.613	56%	0.563	S	S	*	*	H	α-helix	trans	-66.1	-42.8	179.1	-72.5	169.3	0	0	0	112.1	K11 T12 L13 Q18 R19	K11-L15 WeakPolarHBondContact O-CG 3.42Å; K11-L15 PolarHBondContact O-N 2.92Å; T12-L15 PolarHBondContact O-N 3.43Å; L13-L15 PolarHBondContact O-N 2.93Å; L15-Q18 PolarHBondContact O-N 3.14Å; L15-R19 WeakPolarHBondContact O-CB 3.16Å; L15-R19 PolarHBondContact O-N 3.45Å
16	L	86.4	Confident	75.4	Confident	111 Å²	111	118.3 Å²	118.3	58%	0.581	57%	0.572	S	S	*	*	H	α-helix	trans	-63.5	-43.1	176.9	-68.7	173.9	0	0	0	111.6	T12 L13 R19 A20	T12-L16 HydrophobicContact CG2-CD1 4.06Å; T12-L16 HydrophobicContact CG2-CG 4.42Å; T12-L16 WeakPolarHBondContact O-CG 3.45Å; T12-L16 PolarHBondContact O-N 3.04Å; L13-L16 PolarHBondContact O-N 3Å; L16-R19 PolarHBondContact O-N 2.8Å; L16-A20 WeakPolarHBondContact O-CB 3.42Å; L16-A20 PolarHBondContact O-N 2.94Å
17	L	83.6	Confident	75.5	Confident	101 Å²	101	122.8 Å²	122.8	53%	0.529	59%	0.593	S	S	.	*	H	α-helix	trans	-63.2	-46.8	175.8	180	63	0	0	0	111.7	L13 K14 R19 A20 M21	L13-L17 VanDerWaalsContact O-CB 3.29Å; L13-L17 WeakPolarHBondContact O-CB 3.33Å; L13-L17 PolarHBondContact O-N 3.39Å; K14-L17 PolarHBondContact O-N 3.49Å; L17-R19 PolarHBondContact O-N 3.1Å; L17-A20 PolarHBondContact O-N 3.33Å; L17-M21 HydrophobicContact CD1-CG 4.34Å; L17-M21 HydrophobicContact CD1-SD 4.41Å; L17-M21 HydrophobicContact CG-CE 4.19Å; L17-M21 HydrophobicContact CG-SD 4.35Å; L17-M21 WeakPolarHBondContact O-CG 3.35Å; L17-M21 PolarHBondContact O-N 3.4Å
18	Q	85.3	Confident	75.3	Confident	82 Å²	82	122.6 Å²	122.6	38%	0.383	60%	0.599	S	S	.	*	H	α-helix	trans	-60.4	-34	176.8	-76.7	-177.1	-71.1	0	0	112.8	K14 L15 M21 Q22	K14-Q18 WeakPolarHBondContact O-CB 3.3Å; K14-Q18 VanDerWaalsContact O-CG 3.28Å; K14-Q18 WeakPolarHBondContact O-CG 3.48Å; K14-Q18 PolarHBondContact O-N 3.33Å; L15-Q18 PolarHBondContact O-N 3.14Å; Q18-M21 HydrophobicContact CG-CE 4.4Å; Q18-Q22 WeakPolarHBondContact O-CG 3.47Å; Q18-Q22 PolarHBondContact O-N 3.13Å; Q18-Q22 PolarHBondContact O-NE2 2.9Å
19	R	84.8	Confident	74.8	Confident	167 Å²	167	125.5 Å²	125.5	63%	0.63	62%	0.615	S	S	*	*	H	α-helix	trans	-73.5	-47	176.2	-176.8	172.4	-176.7	168.8	4.5	111.5	L15 L16 L17 M21 Q22 D23	L15-R19 WeakPolarHBondContact O-CB 3.16Å; L15-R19 PolarHBondContact O-N 3.45Å; L16-R19 PolarHBondContact O-N 2.8Å; L17-R19 PolarHBondContact O-N 3.1Å; R19-M21 VanDerWaalsContact C-N 3.28Å; R19-M21 PolarHBondContact O-N 2.93Å; R19-Q22 PolarHBondContact O-N 3.5Å; R19-D23 WeakPolarHBondContact CG-OD2 3.21Å; R19-D23 IonicContact NE-OD2 3.53Å; R19-D23 PolarHBondContact O-N 3.3Å
20	A	82.2	Confident	74.4	Confident	54 Å²	54	127.2 Å²	127.2	45%	0.446	64%	0.636	S	S	.	*	H	α-helix	trans	-58.2	-39.9	178.2	0	0	0	0	0	112.4	L16 L17 Q22 S24	L16-A20 WeakPolarHBondContact O-CB 3.42Å; L16-A20 PolarHBondContact O-N 2.94Å; L17-A20 PolarHBondContact O-N 3.33Å; A20-Q22 VanDerWaalsContact C-N 3.32Å; A20-Q22 PolarHBondContact O-N 3.32Å; A20-S24 PolarHBondContact O-N 3.04Å; A20-S24 VanDerWaalsContact O-N 3.11Å
21	M	79.3	Confident	73.3	Confident	116 Å²	116	121.8 Å²	121.8	57%	0.571	64%	0.635	S	S	*	*	H	α-helix	trans	-69.9	-23.5	175.5	-67.8	-175.7	-53.9	0	0	114.2	L17 Q18 R19 S24	L17-M21 HydrophobicContact CD1-CG 4.34Å; L17-M21 HydrophobicContact CD1-SD 4.41Å; L17-M21 HydrophobicContact CG-CE 4.19Å; L17-M21 HydrophobicContact CG-SD 4.35Å; L17-M21 WeakPolarHBondContact O-CG 3.35Å; L17-M21 PolarHBondContact O-N 3.4Å; Q18-M21 HydrophobicContact CG-CE 4.4Å; R19-M21 VanDerWaalsContact C-N 3.28Å; R19-M21 PolarHBondContact O-N 2.93Å; M21-S24 VanDerWaalsContact O-O 3.1Å
22	Q	79.1	Confident	72.1	Confident	153 Å²	153	125 Å²	125	72%	0.715	65%	0.652	S	S	*	*	H	α-helix	trans	-87.5	-32.4	176.5	-77.6	176.7	90.1	0	0	111.8	Q18 R19 A20	Q18-Q22 WeakPolarHBondContact O-CG 3.47Å; Q18-Q22 PolarHBondContact O-N 3.13Å; Q18-Q22 PolarHBondContact O-NE2 2.9Å; R19-Q22 PolarHBondContact O-N 3.5Å; A20-Q22 VanDerWaalsContact C-N 3.32Å; A20-Q22 PolarHBondContact O-N 3.32Å
23	D	70.5	Confident	70.6	Confident	112 Å²	112	131.2 Å²	131.2	60%	0.599	68%	0.679	S	S	*	*	H	α-helix	trans	-77.4	-25.4	179.7	-70.1	-18.4	0	0	0	111.9	R19	R19-D23 WeakPolarHBondContact CG-OD2 3.21Å; R19-D23 IonicContact NE-OD2 3.53Å; R19-D23 PolarHBondContact O-N 3.3Å
24	S	63.9	Low	69.4	Low	64 Å²	64	129.4 Å²	129.4	45%	0.448	69%	0.689	S	S	.	*	S	Bend	trans	-117.1	100	169.1	-65.3	0	0	0	0	109.6	A20 M21 E26	A20-S24 PolarHBondContact O-N 3.04Å; A20-S24 VanDerWaalsContact O-N 3.11Å; M21-S24 VanDerWaalsContact O-O 3.1Å; S24-E26 PolarHBondContact O-N 2.82Å
25	P	57.1	Low	68	Low	119 Å²	119	127 Å²	127	77%	0.773	69%	0.689	S	S	*	*			trans	-76.9	70.9	167.4	33.4	-31.8	0	0	0	108.2
26	E	57.6	Low	67	Low	161 Å²	161	126.4 Å²	126.4	75%	0.752	70%	0.695	S	S	*	*			trans	-86.2	109.2	163	-79.1	168.7	-176.5	0	0	106.7	S24 E28	S24-E26 PolarHBondContact O-N 2.82Å; E26-E28 VanDerWaalsContact C-N 3.27Å; E26-E28 PolarHBondContact O-N 3.19Å
27	E	61.5	Low	65.6	Low	196 Å²	196	129.5 Å²	129.5	92%	0.916	70%	0.698	S	S	*	*			trans	-60	88.3	170	-56.9	-163.4	152.2	0	0	109.1
28	E	57.7	Low	64.5	Low	175 Å²	175	132.6 Å²	132.6	82%	0.818	70%	0.703	S	S	*	*			trans	-125.6	116.7	163.9	-86	-162	151.2	0	0	111.1	E26 C30	E26-E28 VanDerWaalsContact C-N 3.27Å; E26-E28 PolarHBondContact O-N 3.19Å; E28-C30 PolarHBondContact O-N 3.47Å
29	E	53	Low	63.4	Low	204 Å²	204	133.5 Å²	133.5	95%	0.953	72%	0.716	S	S	*	*			trans	-50.5	71.6	170.5	-163.2	175.7	-150.6	0	0	111.6	G31	E29-G31 PolarHBondContact O-N 3.34Å; E29-G31 VanDerWaalsContact O-N 3.15Å
30	C	62.4	Low	62.3	Low	135 Å²	135	135.6 Å²	135.6	91%	0.912	72%	0.724	S	S	*	*			trans	-78.3	97.6	169.1	-173.5	0	0	0	0	108.5	E28	E28-C30 PolarHBondContact O-N 3.47Å
31	G	53.6	Low	61.3	Low	60 Å²	60	136.8 Å²	136.8	62%	0.619	72%	0.72	S	S	*	*			trans	164.1	61.5	160.2	0	0	0	0	0	118	E29	E29-G31 PolarHBondContact O-N 3.34Å; E29-G31 VanDerWaalsContact O-N 3.15Å
32	E	54.3	Low	60.8	Low	195 Å²	195	135.5 Å²	135.5	91%	0.911	72%	0.715	S	S	*	*			trans	-162.5	37.1	144.9	-114.3	171.9	-144.8	0	0	115.5	G34	E32-G34 PolarHBondContact O-N 3.45Å
33	M	54	Low	60.4	Low	183 Å²	183	135.2 Å²	135.2	90%	0.901	71%	0.711	S	S	*	*			trans	-84.9	62.2	159.8	-150.4	75.8	178.5	0	0	110.3	S35	M33-S35 VanDerWaalsContact C-N 3.28Å; M33-S35 PolarHBondContact O-N 3.4Å
34	G	58	Low	60.6	Low	79 Å²	79	134 Å²	134	81%	0.814	71%	0.708	S	S	*	*			trans	-63.3	90.8	159.5	0	0	0	0	0	109.1	E32	E32-G34 PolarHBondContact O-N 3.45Å
35	S	56.7	Low	61.3	Low	83 Å²	83	135.6 Å²	135.6	58%	0.58	72%	0.715	S	S	*	*			trans	-115.5	86.1	166.7	-162	0	0	0	0	110.4	M33 R37	M33-S35 VanDerWaalsContact C-N 3.28Å; M33-S35 PolarHBondContact O-N 3.4Å; S35-R37 PolarHBondContact O-N 3.03Å
36	S	65.8	Low	62.5	Low	105 Å²	105	137.3 Å²	137.3	73%	0.734	71%	0.706	S	S	*	*			trans	-62.9	69.1	159.7	-176.2	0	0	0	0	109.6	R38	S36-R38 PolarHBondContact O-N 2.99Å
37	R	56.8	Low	63.6	Low	175 Å²	175	136.7 Å²	136.7	66%	0.66	70%	0.701	S	S	*	*			trans	-79.9	107	178.1	-154.3	171.8	179.5	177.7	3.6	109.1	S35 E41	S35-R37 PolarHBondContact O-N 3.03Å; R37-E41 WeakPolarHBondContact CG-OE2 3.39Å; R37-E41 IonicContact CZ-OE2 3.81Å; R37-E41 IonicContact NE-OE2 2.94Å; R37-E41 PolarHBondContact NE-OE2 3.17Å; R37-E41 IonicContact NH2-OE2 3.79Å
38	R	61.8	Low	64.6	Low	167 Å²	167	129.4 Å²	129.4	63%	0.63	68%	0.678	S	S	*	*			trans	-46.2	133	-169.7	-63	-79.3	173.6	166.8	-5	111.9	S36 R40 E41	S36-R38 PolarHBondContact O-N 2.99Å; R38-R40 PolarHBondContact O-N 2.94Å; R38-E41 PolarHBondContact O-N 2.88Å; R38-E41 VanDerWaalsContact O-N 3.14Å
39	P	62.2	Low	65.9	Low	101 Å²	101	126.1 Å²	126.1	66%	0.656	67%	0.666	S	S	*	*	H	α-helix	trans	-59.7	-12.7	-179.4	-2.9	0.7	0	0	0	115.3
40	R	60	Low	67.4	Low	210 Å²	210	124.2 Å²	124.2	79%	0.792	65%	0.65	S	S	*	*	H	α-helix	trans	-76.4	-36.7	178.8	-71.3	178	176.2	-107.1	1.1	112.8	R38 I42 K43 T44	R38-R40 PolarHBondContact O-N 2.94Å; R40-I42 VanDerWaalsContact C-N 3.35Å; R40-I42 PolarHBondContact O-N 3.14Å; R40-K43 PolarHBondContact O-N 3.37Å; R40-T44 PolarHBondContact O-N 3.5Å; R40-T44 PolarHBondContact O-OG1 3.3Å
41	E	62.3	Low	68.4	Low	79 Å²	79	119.6 Å²	119.6	37%	0.369	62%	0.621	S	S	.	*	H	α-helix	trans	-66.8	-37.9	-179	-75	167.6	-142.5	0	0	111.9	R37 R38 K43 T44 V45	R37-E41 WeakPolarHBondContact CG-OE2 3.39Å; R37-E41 IonicContact CZ-OE2 3.81Å; R37-E41 IonicContact NE-OE2 2.94Å; R37-E41 PolarHBondContact NE-OE2 3.17Å; R37-E41 IonicContact NH2-OE2 3.79Å; R38-E41 PolarHBondContact O-N 2.88Å; R38-E41 VanDerWaalsContact O-N 3.14Å; E41-K43 PolarHBondContact O-N 3.4Å; E41-T44 WeakPolarHBondContact CA-OG1 3.34Å; E41-T44 PolarHBondContact O-N 3.06Å; E41-T44 PolarHBondContact O-OG1 2.98Å; E41-V45 WeakPolarHBondContact O-CG2 3.37Å; E41-V45 PolarHBondContact O-N 3.29Å
42	I	67.9	Low	69.8	Low	89 Å²	89	118.1 Å²	118.1	46%	0.456	60%	0.603	S	S	.	*	H	α-helix	trans	-63.1	-46.2	178.6	-62.8	169.8	0	0	0	109.3	R40 T44 V45 W46	R40-I42 VanDerWaalsContact C-N 3.35Å; R40-I42 PolarHBondContact O-N 3.14Å; I42-T44 VanDerWaalsContact C-N 3.29Å; I42-T44 PolarHBondContact O-N 2.72Å; I42-V45 PolarHBondContact O-N 3.12Å; I42-V45 VanDerWaalsContact O-N 3.17Å; I42-W46 VanDerWaalsContact CG2-CD1 3.43Å; I42-W46 PolarHBondContact O-N 3.27Å
43	K	70.6	Confident	71.1	Confident	147 Å²	147	115 Å²	115	64%	0.639	59%	0.592	S	S	*	*	H	α-helix	trans	-59.6	-36	177.8	-73.3	-179.5	-180	-179.8	0	113.1	R40 E41 K47	R40-K43 PolarHBondContact O-N 3.37Å; E41-K43 PolarHBondContact O-N 3.4Å; K43-K47 VanDerWaalsContact O-CG 3.31Å; K43-K47 WeakPolarHBondContact O-CG 3.37Å; K43-K47 PolarHBondContact O-N 3.48Å; K43-K47 VanDerWaalsContact O-N 3.12Å
44	T	76.1	Confident	72.4	Confident	87 Å²	87	112.4 Å²	112.4	53%	0.534	58%	0.581	S	S	.	*	H	α-helix	trans	-71.4	-39.1	177	44	0	0	0	0	112	R40 E41 I42 K47 G48	R40-T44 PolarHBondContact O-N 3.5Å; R40-T44 PolarHBondContact O-OG1 3.3Å; E41-T44 WeakPolarHBondContact CA-OG1 3.34Å; E41-T44 PolarHBondContact O-N 3.06Å; E41-T44 PolarHBondContact O-OG1 2.98Å; I42-T44 VanDerWaalsContact C-N 3.29Å; I42-T44 PolarHBondContact O-N 2.72Å; T44-K47 PolarHBondContact O-N 3.28Å; T44-G48 PolarHBondContact O-N 2.97Å
45	V	79	Confident	73.1	Confident	97 Å²	97	117 Å²	117	59%	0.588	57%	0.574	S	S	*	*	H	α-helix	trans	-61.9	-45.7	173.9	173.7	0	0	0	0	110.7	E41 I42 K47 G48 L49	E41-V45 WeakPolarHBondContact O-CG2 3.37Å; E41-V45 PolarHBondContact O-N 3.29Å; I42-V45 PolarHBondContact O-N 3.12Å; I42-V45 VanDerWaalsContact O-N 3.17Å; V45-K47 VanDerWaalsContact C-N 3.31Å; V45-K47 PolarHBondContact O-N 3.25Å; V45-G48 PolarHBondContact O-N 3.31Å; V45-L49 WeakPolarHBondContact O-CB 3.31Å; V45-L49 PolarHBondContact O-N 2.98Å
46	W	80.6	Confident	73.4	Confident	155 Å²	155	121.3 Å²	121.3	59%	0.587	58%	0.584	S	S	*	*	H	α-helix	trans	-62.4	-35.1	177.1	-78.5	104.3	0	0	0	113.5	I42 R50	I42-W46 VanDerWaalsContact CG2-CD1 3.43Å; I42-W46 PolarHBondContact O-N 3.27Å; W46-R50 WeakPolarHBondContact O-CB 3.49Å; W46-R50 PolarHBondContact O-N 2.9Å; W46-R50 VanDerWaalsContact O-N 3.13Å
47	K	80.6	Confident	73	Confident	148 Å²	148	128.2 Å²	128.2	64%	0.643	60%	0.601	S	S	*	*	H	α-helix	trans	-68.6	-45.3	174.8	-76.3	175.2	177.9	-171.1	0	111.6	K43 T44 V45 R50 A51	K43-K47 VanDerWaalsContact O-CG 3.31Å; K43-K47 WeakPolarHBondContact O-CG 3.37Å; K43-K47 PolarHBondContact O-N 3.48Å; K43-K47 VanDerWaalsContact O-N 3.12Å; T44-K47 PolarHBondContact O-N 3.28Å; V45-K47 VanDerWaalsContact C-N 3.31Å; V45-K47 PolarHBondContact O-N 3.25Å; K47-R50 PolarHBondContact O-N 3.35Å; K47-A51 PolarHBondContact O-N 3.13Å
48	G	82.8	Confident	73.8	Confident	43 Å²	43	125.9 Å²	125.9	44%	0.443	60%	0.598	S	S	.	*	H	α-helix	trans	-62.3	-44	177.4	0	0	0	0	0	112.6	T44 V45 A51 A52	T44-G48 PolarHBondContact O-N 2.97Å; V45-G48 PolarHBondContact O-N 3.31Å; G48-A51 PolarHBondContact O-N 3.48Å; G48-A52 PolarHBondContact O-N 3Å
49	L	84.6	Confident	74.4	Confident	107 Å²	107	123.7 Å²	123.7	56%	0.56	60%	0.596	S	S	*	*	H	α-helix	trans	-63.2	-44.1	178.1	-173.2	65.9	0	0	0	112	V45 A51 A52 L53	V45-L49 WeakPolarHBondContact O-CB 3.31Å; V45-L49 PolarHBondContact O-N 2.98Å; L49-A51 PolarHBondContact O-N 3.29Å; L49-A52 PolarHBondContact O-N 3.04Å; L49-L53 PolarHBondContact O-N 3.44Å
50	R	85.8	Confident	75.1	Confident	163 Å²	163	125 Å²	125	62%	0.615	59%	0.593	S	S	*	*	H	α-helix	trans	-62.2	-41.8	174.7	-87	-159.6	-78.9	-153.8	-3.6	112.7	W46 K47 A52 L53 I54	W46-R50 WeakPolarHBondContact O-CB 3.49Å; W46-R50 PolarHBondContact O-N 2.9Å; W46-R50 VanDerWaalsContact O-N 3.13Å; K47-R50 PolarHBondContact O-N 3.35Å; R50-A52 VanDerWaalsContact C-N 3.33Å; R50-A52 PolarHBondContact O-N 3.05Å; R50-L53 PolarHBondContact O-N 3.44Å; R50-I54 WeakPolarHBondContact O-CG1 3.35Å; R50-I54 PolarHBondContact O-N 3.17Å
51	A	82.5	Confident	76	Confident	38 Å²	38	120 Å²	120	31%	0.314	58%	0.581	S	S	.	*	H	α-helix	trans	-64	-39.4	177.7	0	0	0	0	0	111.8	K47 G48 L49 R55	K47-A51 PolarHBondContact O-N 3.13Å; G48-A51 PolarHBondContact O-N 3.48Å; L49-A51 PolarHBondContact O-N 3.29Å; A51-R55 WeakPolarHBondContact O-CG 3.34Å; A51-R55 PolarHBondContact O-N 3.49Å; A51-R55 VanDerWaalsContact O-N 3.17Å; A51-R55 PolarHBondContact O-NH1 3.35Å
52	A	83.1	Confident	76.9	Confident	29 Å²	29	122.6 Å²	122.6	24%	0.24	60%	0.595	C	S	.	*	H	α-helix	trans	-63.3	-42.6	174.4	0	0	0	0	0	112.1	G48 L49 R50 I54 R55 H56	G48-A52 PolarHBondContact O-N 3Å; L49-A52 PolarHBondContact O-N 3.04Å; R50-A52 VanDerWaalsContact C-N 3.33Å; R50-A52 PolarHBondContact O-N 3.05Å; A52-I54 PolarHBondContact O-N 3.29Å; A52-R55 PolarHBondContact O-N 3.36Å; A52-H56 PolarHBondContact O-CD2 3.49Å; A52-H56 PolarHBondContact O-N 3.42Å
53	L	81.8	Confident	77.5	Confident	130 Å²	130	124.8 Å²	124.8	68%	0.681	60%	0.604	S	S	*	*	H	α-helix	trans	-64.3	-39.3	179.4	-173.3	64.6	0	0	0	112.7	L49 R50 R55 H56	L49-L53 PolarHBondContact O-N 3.44Å; R50-L53 PolarHBondContact O-N 3.44Å; L53-R55 VanDerWaalsContact C-N 3.34Å; L53-H56 PolarHBondContact O-N 3.25Å
54	I	81.6	Confident	78	Confident	128 Å²	128	123.2 Å²	123.2	66%	0.656	60%	0.601	S	S	*	*	H	α-helix	trans	-68	-35.6	176.8	-66.8	165.1	0	0	0	111.3	R50 A52 H56 K57	R50-I54 WeakPolarHBondContact O-CG1 3.35Å; R50-I54 PolarHBondContact O-N 3.17Å; A52-I54 PolarHBondContact O-N 3.29Å; I54-H56 PolarHBondContact O-N 3.46Å; I54-K57 PolarHBondContact O-N 3.35Å
55	R	73.3	Confident	78.1	Confident	176 Å²	176	126 Å²	126	66%	0.664	61%	0.606	S	S	*	*	H	α-helix	trans	-68.4	-20.2	178.6	-75.4	-170.8	-55.9	-95.7	4.9	114.2	A51 A52 L53	A51-R55 WeakPolarHBondContact O-CG 3.34Å; A51-R55 PolarHBondContact O-N 3.49Å; A51-R55 VanDerWaalsContact O-N 3.17Å; A51-R55 PolarHBondContact O-NH1 3.35Å; A52-R55 PolarHBondContact O-N 3.36Å; L53-R55 VanDerWaalsContact C-N 3.34Å
56	H	62.8	Low	78	Confident	173 Å²	173	128.4 Å²	128.4	80%	0.801	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102	24.2	-178.7	-79.5	-76.6	0	0	0	113.1	A52 L53 I54	A52-H56 PolarHBondContact O-CD2 3.49Å; A52-H56 PolarHBondContact O-N 3.42Å; L53-H56 PolarHBondContact O-N 3.25Å; I54-H56 PolarHBondContact O-N 3.46Å
57	K	57	Low	77.8	Confident	251 Å²	251	126 Å²	126	100%	1.091	61%	0.61	S	S	*	*			trans	-115.6	0	174	-174	170.3	-178.8	176.8	0	111.6	I54	I54-K57 PolarHBondContact O-N 3.35Å

Retrieved 57 of 57 residues in 71.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).