A0A087WR32_MOUSE Loading...

KH domain containing, RNA binding, signal transduction associated 2

AlphaFold DB , UniProt , Accession A0A087WR32, Species MOUSE (Mus musculus, Mouse), Gene Khdrbs2, Length 92 aa.

						>A0A087WR32_MOUSE|A0A087WR32|Khdrbs2
MGEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKECAANLYLPASVNSEVTHI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.6	Very low	76.7	Confident	255 Å²	255	108.4 Å²	108.4	100%	1.256	55%	0.546	S	S	*	.				0	98.2	0	-156.2	177.5	-162.7	0	0	106.2
2	G	55	Low	78	Confident	51 Å²	51	104.3 Å²	104.3	53%	0.526	54%	0.542	S	S	.	.			trans	154.7	-32.5	171.8	0	0	0	0	0	118.5	E4 K5 Y6	G2-E4 PolarHBondContact O-N 3.13Å; G2-K5 PolarHBondContact O-N 2.99Å; G2-Y6 PolarHBondContact O-N 3.18Å
3	E	58.5	Low	79	Confident	163 Å²	163	104.2 Å²	104.2	76%	0.762	54%	0.537	S	S	*	.	H	α-helix	trans	-70.1	-36.8	-167.6	-66.6	-177.4	168.8	0	0	114	K5 Y6	E3-K5 PolarHBondContact O-N 3.39Å; E3-Y6 PolarHBondContact O-N 2.82Å
4	E	68.4	Low	79.7	Confident	189 Å²	189	102.9 Å²	102.9	88%	0.883	53%	0.526	S	S	*	.	H	α-helix	trans	-65.5	-24.9	178.7	-68.2	-179.2	165.9	0	0	113.3	G2 P8	G2-E4 PolarHBondContact O-N 3.13Å; E4-P8 WeakPolarHBondContact O-CD 3.32Å; E4-P8 WeakPolarHBondContact O-CG 3.24Å
5	K	80.9	Confident	80.4	Confident	136 Å²	136	104.8 Å²	104.8	59%	0.591	54%	0.537	S	S	*	.	H	α-helix	trans	-92.7	-25.8	-179.3	-157.6	-172.9	-178.8	-134.3	0	112.4	G2 E3 P8 E9	G2-K5 PolarHBondContact O-N 2.99Å; E3-K5 PolarHBondContact O-N 3.39Å; K5-P8 WeakPolarHBondContact O-CD 3.45Å; K5-E9 WeakPolarHBondContact CD-OE1 3.44Å; K5-E9 WeakPolarHBondContact CE-OE1 3.39Å; K5-E9 HydrophobicContact CG-CG 4.28Å; K5-E9 WeakPolarHBondContact CG-OE1 3.44Å; K5-E9 IonicContact NZ-OE1 2.64Å; K5-E9 PolarHBondContact NZ-OE1 3.1Å; K5-E9 WeakPolarHBondContact O-CB 3.38Å; K5-E9 WeakPolarHBondContact O-CG 3.44Å; K5-E9 PolarHBondContact O-N 3.35Å; K5-E9 VanDerWaalsContact O-N 3.16Å
6	Y	86	Confident	81.2	Confident	87 Å²	87	104.4 Å²	104.4	34%	0.341	55%	0.546	S	S	.	.	H	α-helix	trans	-66.2	-45.9	-172	-175.1	-115.1	0	0	0	113.3	G2 E3 E9 L10 F35	G2-Y6 PolarHBondContact O-N 3.18Å; E3-Y6 PolarHBondContact O-N 2.82Å; Y6-E9 PolarHBondContact O-N 2.95Å; Y6-L10 HydrophobicContact CD1-CD1 3.94Å; Y6-L10 HydrophobicContact CE1-CD1 3.5Å; Y6-L10 VanDerWaalsContact CE1-CD1 3.5Å; Y6-L10 HydrophobicContact CE1-CG 4.27Å; Y6-L10 HydrophobicContact CE2-CD1 4.39Å; Y6-L10 HydrophobicContact CE2-CD2 4.36Å; Y6-L10 HydrophobicContact CE2-CG 4.34Å; Y6-L10 WeakPolarHBondContact O-CG 3.46Å; Y6-L10 PolarHBondContact O-N 3.42Å; Y6-F35 AromaticContact CD1-CE1 3.81Å; Y6-F35 HydrophobicContact CD1-CE1 3.81Å; Y6-F35 AromaticContact CD1-CE2 3.79Å; Y6-F35 HydrophobicContact CD1-CE2 3.79Å; Y6-F35 AromaticContact CD1-CZ 3.35Å; Y6-F35 HydrophobicContact CD1-CZ 3.35Å; Y6-F35 HydrophobicContact CE1-CD2 4.24Å; Y6-F35 HydrophobicContact CE1-CE1 4.24Å; Y6-F35 AromaticContact CE1-CE2 3.36Å; Y6-F35 HydrophobicContact CE1-CE2 3.36Å; Y6-F35 AromaticContact CE1-CZ 3.35Å; Y6-F35 HydrophobicContact CE1-CZ 3.35Å
7	L	87.6	Confident	81.9	Confident	48 Å²	48	100.8 Å²	100.8	25%	0.251	53%	0.528	S	S	.	.	H	α-helix	trans	-66.2	-46.6	-179.7	-179.6	67.7	0	0	0	112.8	E9 L10 M11 I32 F35	L7-E9 VanDerWaalsContact C-N 3.26Å; L7-E9 PolarHBondContact O-N 3.04Å; L7-L10 PolarHBondContact O-N 3Å; L7-M11 HydrophobicContact CG-SD 4.47Å; L7-M11 WeakPolarHBondContact O-CG 3.36Å; L7-M11 PolarHBondContact O-N 2.6Å; L7-M11 VanDerWaalsContact O-N 3.11Å; L7-I32 HydrophobicContact CD1-CB 4.49Å; L7-I32 HydrophobicContact CD1-CG1 4.36Å; L7-I32 HydrophobicContact CD1-CG2 4.08Å; L7-F35 HydrophobicContact CD1-CB 4.24Å
8	P	90.6	Very high	82.5	Confident	76 Å²	76	100.1 Å²	100.1	49%	0.494	53%	0.525	S	S	.	.	H	α-helix	trans	-56.7	-37.6	171.8	-27	34.2	0	0	0	113.8	E4 K5 M11 A12	E4-P8 WeakPolarHBondContact O-CD 3.32Å; E4-P8 WeakPolarHBondContact O-CG 3.24Å; K5-P8 WeakPolarHBondContact O-CD 3.45Å; P8-M11 PolarHBondContact O-N 3.3Å; P8-A12 WeakPolarHBondContact O-CB 3.47Å; P8-A12 PolarHBondContact O-N 3.24Å
9	E	90.8	Very high	82.9	Confident	89 Å²	89	100.6 Å²	100.6	42%	0.416	54%	0.535	S	S	.	.	H	α-helix	trans	-66.3	-45.1	177.5	-75.6	173.9	168.4	0	0	112.1	K5 Y6 L7 M11 A12 E13	K5-E9 WeakPolarHBondContact CD-OE1 3.44Å; K5-E9 WeakPolarHBondContact CE-OE1 3.39Å; K5-E9 HydrophobicContact CG-CG 4.28Å; K5-E9 WeakPolarHBondContact CG-OE1 3.44Å; K5-E9 IonicContact NZ-OE1 2.64Å; K5-E9 PolarHBondContact NZ-OE1 3.1Å; K5-E9 WeakPolarHBondContact O-CB 3.38Å; K5-E9 WeakPolarHBondContact O-CG 3.44Å; K5-E9 PolarHBondContact O-N 3.35Å; K5-E9 VanDerWaalsContact O-N 3.16Å; Y6-E9 PolarHBondContact O-N 2.95Å; L7-E9 VanDerWaalsContact C-N 3.26Å; L7-E9 PolarHBondContact O-N 3.04Å; E9-M11 VanDerWaalsContact C-N 3.31Å; E9-M11 PolarHBondContact O-N 2.9Å; E9-A12 PolarHBondContact O-N 3.06Å; E9-E13 WeakPolarHBondContact O-CB 3.35Å; E9-E13 PolarHBondContact O-N 3.07Å
10	L	90	Very high	83.4	Confident	11 Å²	11	99.8 Å²	99.8	6%	0.058	54%	0.537	C	S	.	.	H	α-helix	trans	-61	-39.1	176.3	-70.8	176.2	0	0	0	112.4	Y6 L7 K14 L28 E31 I32	Y6-L10 HydrophobicContact CD1-CD1 3.94Å; Y6-L10 HydrophobicContact CE1-CD1 3.5Å; Y6-L10 VanDerWaalsContact CE1-CD1 3.5Å; Y6-L10 HydrophobicContact CE1-CG 4.27Å; Y6-L10 HydrophobicContact CE2-CD1 4.39Å; Y6-L10 HydrophobicContact CE2-CD2 4.36Å; Y6-L10 HydrophobicContact CE2-CG 4.34Å; Y6-L10 WeakPolarHBondContact O-CG 3.46Å; Y6-L10 PolarHBondContact O-N 3.42Å; L7-L10 PolarHBondContact O-N 3Å; L10-K14 WeakPolarHBondContact O-CB 3.45Å; L10-K14 PolarHBondContact O-N 2.68Å; L10-L28 HydrophobicContact CD2-CD2 3.74Å; L10-E31 HydrophobicContact CD1-CB 4.46Å; L10-E31 HydrophobicContact CD1-CG 3.99Å; L10-I32 HydrophobicContact CB-CD1 4.14Å; L10-I32 HydrophobicContact CB-CG1 3.79Å; L10-I32 HydrophobicContact CD1-CG1 4.26Å
11	M	88.8	Confident	83.9	Confident	87 Å²	87	100.7 Å²	100.7	43%	0.429	54%	0.537	S	S	.	.	H	α-helix	trans	-66.3	-45.1	176.9	-68	-179.5	71.6	0	0	111.3	L7 P8 E9 E13 K14 D15 I32	L7-M11 HydrophobicContact CG-SD 4.47Å; L7-M11 WeakPolarHBondContact O-CG 3.36Å; L7-M11 PolarHBondContact O-N 2.6Å; L7-M11 VanDerWaalsContact O-N 3.11Å; P8-M11 PolarHBondContact O-N 3.3Å; E9-M11 VanDerWaalsContact C-N 3.31Å; E9-M11 PolarHBondContact O-N 2.9Å; M11-E13 PolarHBondContact O-N 3Å; M11-K14 PolarHBondContact O-N 3.03Å; M11-D15 PolarHBondContact O-N 3.32Å; M11-I32 HydrophobicContact CG-CD1 4.16Å
12	A	92.8	Very high	86.1	Confident	60 Å²	60	93.2 Å²	93.2	50%	0.496	51%	0.505	S	S	.	.	H	α-helix	trans	-64	-39.1	177.3	0	0	0	0	0	112.5	P8 E9 D15 S16	P8-A12 WeakPolarHBondContact O-CB 3.47Å; P8-A12 PolarHBondContact O-N 3.24Å; E9-A12 PolarHBondContact O-N 3.06Å; A12-D15 PolarHBondContact O-N 3.4Å; A12-S16 WeakPolarHBondContact O-CB 3.24Å; A12-S16 PolarHBondContact O-N 3.1Å; A12-S16 VanDerWaalsContact O-N 3.12Å; A12-S16 PolarHBondContact O-OG 3.38Å
13	E	90.7	Very high	87.9	Confident	103 Å²	103	97.4 Å²	97.4	48%	0.481	51%	0.511	S	S	.	.	H	α-helix	trans	-64.2	-47.1	175.2	-171.7	177	170.8	0	0	110.9	E9 M11 D15 S16 L17 L28	E9-E13 WeakPolarHBondContact O-CB 3.35Å; E9-E13 PolarHBondContact O-N 3.07Å; M11-E13 PolarHBondContact O-N 3Å; E13-D15 VanDerWaalsContact C-N 3.3Å; E13-D15 PolarHBondContact O-N 2.79Å; E13-S16 PolarHBondContact O-N 3.44Å; E13-S16 PolarHBondContact O-OG 3.32Å; E13-L17 VanDerWaalsContact O-CB 3.31Å; E13-L17 WeakPolarHBondContact O-CB 3.35Å; E13-L17 PolarHBondContact O-N 2.75Å; E13-L28 HydrophobicContact CB-CD1 4.43Å; E13-L28 HydrophobicContact CG-CD1 3.99Å
14	K	89.4	Confident	89.5	Confident	86 Å²	86	91.6 Å²	91.6	37%	0.374	49%	0.49	S	S	.	.	H	α-helix	trans	-58.1	-41.3	177.8	-175.7	-166.2	168.9	-148.7	0	112.4	L10 M11 L28 I32	L10-K14 WeakPolarHBondContact O-CB 3.45Å; L10-K14 PolarHBondContact O-N 2.68Å; M11-K14 PolarHBondContact O-N 3.03Å; K14-L28 HydrophobicContact CB-CB 4.41Å; K14-L28 HydrophobicContact CB-CD1 4.3Å; K14-I32 HydrophobicContact CB-CD1 4.42Å; K14-I32 HydrophobicContact CD-CD1 3.99Å
15	D	90.3	Very high	90.6	Very high	131 Å²	131	84.5 Å²	84.5	70%	0.701	46%	0.462	S	S	*	.	H	α-helix	trans	-75.8	-25.4	-177.3	-69.8	-17.8	0	0	0	113.1	M11 A12 E13	M11-D15 PolarHBondContact O-N 3.32Å; A12-D15 PolarHBondContact O-N 3.4Å; E13-D15 VanDerWaalsContact C-N 3.3Å; E13-D15 PolarHBondContact O-N 2.79Å
16	S	93.3	Very high	91.1	Very high	98 Å²	98	84 Å²	84	69%	0.685	46%	0.456	S	S	*	.	H	α-helix	trans	-91.6	-14.4	176.5	58.6	0	0	0	0	113.8	A12 E13	A12-S16 WeakPolarHBondContact O-CB 3.24Å; A12-S16 PolarHBondContact O-N 3.1Å; A12-S16 VanDerWaalsContact O-N 3.12Å; A12-S16 PolarHBondContact O-OG 3.38Å; E13-S16 PolarHBondContact O-N 3.44Å; E13-S16 PolarHBondContact O-OG 3.32Å
17	L	93.1	Very high	91.4	Very high	44 Å²	44	84.5 Å²	84.5	23%	0.23	46%	0.464	C	S	.	.	S	Bend	trans	-69.6	134.1	-179.1	-169.7	69.4	0	0	0	111.5	E13 F21 A24 L28	E13-L17 VanDerWaalsContact O-CB 3.31Å; E13-L17 WeakPolarHBondContact O-CB 3.35Å; E13-L17 PolarHBondContact O-N 2.75Å; L17-F21 HydrophobicContact CD1-CB 4.25Å; L17-F21 HydrophobicContact CD1-CD2 4.01Å; L17-F21 HydrophobicContact CD1-CG 4.36Å; L17-F21 HydrophobicContact CD2-CB 4.11Å; L17-F21 HydrophobicContact CG-CB 4.15Å; L17-F21 HydrophobicContact CG-CD2 4.4Å; L17-A24 HydrophobicContact CD2-CB 3.89Å; L17-L28 HydrophobicContact CD2-CD1 4.02Å
18	D	92.9	Very high	91.6	Very high	88 Å²	88	83.1 Å²	83.1	47%	0.471	46%	0.457	S	S	.	.			trans	-64.7	133.2	176.5	178.5	74.7	0	0	0	111.5	S20 F21	D18-S20 PolarHBondContact O-N 3.18Å; D18-S20 WeakPolarHBondContact OD2-CB 3.43Å; D18-S20 PolarHBondContact OD2-N 2.84Å; D18-S20 PolarHBondContact OD2-OG 3.06Å; D18-F21 HydrophobicContact CB-CD2 3.92Å; D18-F21 HydrophobicContact CB-CE2 4.09Å; D18-F21 PolarHBondContact O-N 3.38Å
19	P	88.9	Confident	91.5	Very high	110 Å²	110	81.3 Å²	81.3	71%	0.714	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.2	-16.1	-177.7	-27.1	35.5	0	0	0	115.6	F21	P19-F21 PolarHBondContact O-N 3.32Å
20	S	93.7	Very high	91.5	Very high	84 Å²	84	80.4 Å²	80.4	59%	0.587	44%	0.444	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.3	-23.1	174.6	72.4	0	0	0	0	112.8	D18 V22	D18-S20 PolarHBondContact O-N 3.18Å; D18-S20 WeakPolarHBondContact OD2-CB 3.43Å; D18-S20 PolarHBondContact OD2-N 2.84Å; D18-S20 PolarHBondContact OD2-OG 3.06Å; S20-V22 PolarHBondContact O-N 3.06Å
21	F	93.6	Very high	91.4	Very high	119 Å²	119	82.5 Å²	82.5	52%	0.522	45%	0.454	S	S	.	.			trans	-81.6	59.8	176.1	-62.9	-72.3	0	0	0	111.8	L17 D18 P19 H23 A24 S25	L17-F21 HydrophobicContact CD1-CB 4.25Å; L17-F21 HydrophobicContact CD1-CD2 4.01Å; L17-F21 HydrophobicContact CD1-CG 4.36Å; L17-F21 HydrophobicContact CD2-CB 4.11Å; L17-F21 HydrophobicContact CG-CB 4.15Å; L17-F21 HydrophobicContact CG-CD2 4.4Å; D18-F21 HydrophobicContact CB-CD2 3.92Å; D18-F21 HydrophobicContact CB-CE2 4.09Å; D18-F21 PolarHBondContact O-N 3.38Å; P19-F21 PolarHBondContact O-N 3.32Å; F21-H23 VanDerWaalsContact C-N 3.25Å; F21-H23 PolarHBondContact O-N 3.06Å; F21-A24 HydrophobicContact CB-CB 4.14Å; F21-A24 PolarHBondContact O-N 2.92Å; F21-A24 VanDerWaalsContact O-N 3.17Å; F21-S25 WeakPolarHBondContact O-CB 3.31Å; F21-S25 PolarHBondContact O-N 3.22Å
22	V	92.3	Very high	91.4	Very high	97 Å²	97	79.1 Å²	79.1	59%	0.588	44%	0.437	S	S	*	.	H	α-helix	trans	-53.3	-41.8	-176.3	-179	0	0	0	0	112.2	S20 R26	S20-V22 PolarHBondContact O-N 3.06Å; V22-R26 WeakPolarHBondContact O-CB 3.47Å; V22-R26 PolarHBondContact O-N 3.41Å
23	H	93.4	Very high	91.2	Very high	140 Å²	140	82.7 Å²	82.7	65%	0.648	44%	0.443	S	S	*	.	H	α-helix	trans	-72.4	-41.4	-178.6	-61.6	-39.8	0	0	0	113	F21 R26 L27	F21-H23 VanDerWaalsContact C-N 3.25Å; F21-H23 PolarHBondContact O-N 3.06Å; H23-R26 PolarHBondContact O-N 2.64Å; H23-L27 WeakPolarHBondContact O-CG 3.46Å; H23-L27 PolarHBondContact O-N 2.98Å
24	A	91.4	Very high	90.9	Very high	41 Å²	41	83.7 Å²	83.7	34%	0.339	45%	0.446	S	S	.	.	H	α-helix	trans	-68.7	-42.1	178.2	0	0	0	0	0	111	L17 F21 R26 L27 L28	L17-A24 HydrophobicContact CD2-CB 3.89Å; F21-A24 HydrophobicContact CB-CB 4.14Å; F21-A24 PolarHBondContact O-N 2.92Å; F21-A24 VanDerWaalsContact O-N 3.17Å; A24-R26 VanDerWaalsContact C-N 3.32Å; A24-R26 PolarHBondContact O-N 2.97Å; A24-L27 PolarHBondContact O-N 3.33Å; A24-L28 WeakPolarHBondContact O-CG 3.38Å; A24-L28 PolarHBondContact O-N 3.39Å
25	S	91.5	Very high	90.5	Very high	40 Å²	40	83.1 Å²	83.1	28%	0.28	44%	0.444	S	S	.	.	H	α-helix	trans	-58.7	-42.2	173.9	-171.1	0	0	0	0	112.1	F21 A29	F21-S25 WeakPolarHBondContact O-CB 3.31Å; F21-S25 PolarHBondContact O-N 3.22Å; S25-A29 WeakPolarHBondContact O-CB 3.33Å; S25-A29 PolarHBondContact O-N 3.46Å
26	R	92.6	Very high	89.8	Confident	125 Å²	125	83.1 Å²	83.1	47%	0.472	44%	0.439	S	S	.	.	H	α-helix	trans	-61.7	-46.9	175	-176.8	-179.7	64.8	86.7	1.5	112.3	V22 H23 A24 A29 E30	V22-R26 WeakPolarHBondContact O-CB 3.47Å; V22-R26 PolarHBondContact O-N 3.41Å; H23-R26 PolarHBondContact O-N 2.64Å; A24-R26 VanDerWaalsContact C-N 3.32Å; A24-R26 PolarHBondContact O-N 2.97Å; R26-A29 PolarHBondContact O-N 3.3Å; R26-E30 IonicContact CZ-OE1 3.69Å; R26-E30 IonicContact NH1-OE1 2.8Å; R26-E30 PolarHBondContact NH1-OE1 3.14Å; R26-E30 IonicContact NH1-OE2 2.64Å; R26-E30 WeakPolarHBondContact O-CG 3.38Å; R26-E30 PolarHBondContact O-N 3.03Å
27	L	92.7	Very high	88.3	Confident	98 Å²	98	80.5 Å²	80.5	51%	0.513	43%	0.428	S	S	.	.	H	α-helix	trans	-65.2	-40.2	-179.1	-70.2	171.7	0	0	0	112	H23 A24 E30 E31	H23-L27 WeakPolarHBondContact O-CG 3.46Å; H23-L27 PolarHBondContact O-N 2.98Å; A24-L27 PolarHBondContact O-N 3.33Å; L27-E30 PolarHBondContact O-N 2.96Å; L27-E31 WeakPolarHBondContact O-CB 3.46Å; L27-E31 PolarHBondContact O-N 3.26Å
28	L	90.5	Very high	86.5	Confident	19 Å²	19	82.5 Å²	82.5	10%	0.099	45%	0.446	C	S	.	.	H	α-helix	trans	-62.1	-42.9	174.3	-73.1	172	0	0	0	111.5	L10 E13 K14 L17 A24 E31 I32	L10-L28 HydrophobicContact CD2-CD2 3.74Å; E13-L28 HydrophobicContact CB-CD1 4.43Å; E13-L28 HydrophobicContact CG-CD1 3.99Å; K14-L28 HydrophobicContact CB-CB 4.41Å; K14-L28 HydrophobicContact CB-CD1 4.3Å; L17-L28 HydrophobicContact CD2-CD1 4.02Å; A24-L28 WeakPolarHBondContact O-CG 3.38Å; A24-L28 PolarHBondContact O-N 3.39Å; L28-E31 PolarHBondContact O-N 3.43Å; L28-I32 WeakPolarHBondContact O-CD1 3.43Å; L28-I32 VanDerWaalsContact O-CG1 3.24Å; L28-I32 WeakPolarHBondContact O-CG1 3.05Å; L28-I32 PolarHBondContact O-N 2.97Å
29	A	89.3	Confident	84.5	Confident	37 Å²	37	85.4 Å²	85.4	31%	0.306	46%	0.461	S	S	.	.	H	α-helix	trans	-62.5	-44.9	176.3	0	0	0	0	0	112.3	S25 R26 E31 I32 E33	S25-A29 WeakPolarHBondContact O-CB 3.33Å; S25-A29 PolarHBondContact O-N 3.46Å; R26-A29 PolarHBondContact O-N 3.3Å; A29-E31 VanDerWaalsContact C-N 3.3Å; A29-E31 PolarHBondContact O-N 3.49Å; A29-I32 PolarHBondContact O-N 3.07Å; A29-E33 WeakPolarHBondContact O-CB 3.31Å; A29-E33 PolarHBondContact O-N 3.39Å
30	E	89.6	Confident	82.6	Confident	71 Å²	71	81.5 Å²	81.5	33%	0.332	44%	0.441	S	S	.	.	H	α-helix	trans	-61.1	-38.9	175.8	-75.9	173.3	-168.4	0	0	112	R26 L27 E33 K34	R26-E30 IonicContact CZ-OE1 3.69Å; R26-E30 IonicContact NH1-OE1 2.8Å; R26-E30 PolarHBondContact NH1-OE1 3.14Å; R26-E30 IonicContact NH1-OE2 2.64Å; R26-E30 WeakPolarHBondContact O-CG 3.38Å; R26-E30 PolarHBondContact O-N 3.03Å; L27-E30 PolarHBondContact O-N 2.96Å; E30-E33 PolarHBondContact O-N 3.38Å; E30-K34 WeakPolarHBondContact O-CG 3.48Å; E30-K34 PolarHBondContact O-N 3.4Å
31	E	89.3	Confident	80.5	Confident	55 Å²	55	87 Å²	87	26%	0.257	45%	0.454	S	S	.	.	H	α-helix	trans	-69.6	-43.2	178.8	-165.4	63.8	-170.7	0	0	111.7	L10 L27 L28 A29 E33 K34 F35	L10-E31 HydrophobicContact CD1-CB 4.46Å; L10-E31 HydrophobicContact CD1-CG 3.99Å; L27-E31 WeakPolarHBondContact O-CB 3.46Å; L27-E31 PolarHBondContact O-N 3.26Å; L28-E31 PolarHBondContact O-N 3.43Å; A29-E31 VanDerWaalsContact C-N 3.3Å; A29-E31 PolarHBondContact O-N 3.49Å; E31-E33 VanDerWaalsContact C-N 3.29Å; E31-E33 PolarHBondContact O-N 2.97Å; E31-K34 PolarHBondContact O-N 3.31Å; E31-K34 IonicContact OE2-NZ 3.53Å; E31-K34 PolarHBondContact OE2-NZ 3.17Å; E31-F35 WeakPolarHBondContact O-CD2 3.49Å; E31-F35 PolarHBondContact O-N 3.26Å
32	I	88.6	Confident	78.4	Confident	15 Å²	15	89.6 Å²	89.6	8%	0.077	47%	0.465	C	S	.	.	H	α-helix	trans	-58.6	-42.8	173.3	-69.5	164.4	0	0	0	110.8	L7 L10 M11 K14 L28 A29 K34 F35 Q36	L7-I32 HydrophobicContact CD1-CB 4.49Å; L7-I32 HydrophobicContact CD1-CG1 4.36Å; L7-I32 HydrophobicContact CD1-CG2 4.08Å; L10-I32 HydrophobicContact CB-CD1 4.14Å; L10-I32 HydrophobicContact CB-CG1 3.79Å; L10-I32 HydrophobicContact CD1-CG1 4.26Å; M11-I32 HydrophobicContact CG-CD1 4.16Å; K14-I32 HydrophobicContact CB-CD1 4.42Å; K14-I32 HydrophobicContact CD-CD1 3.99Å; L28-I32 WeakPolarHBondContact O-CD1 3.43Å; L28-I32 VanDerWaalsContact O-CG1 3.24Å; L28-I32 WeakPolarHBondContact O-CG1 3.05Å; L28-I32 PolarHBondContact O-N 2.97Å; A29-I32 PolarHBondContact O-N 3.07Å; I32-K34 PolarHBondContact O-N 3.09Å; I32-F35 PolarHBondContact O-N 2.89Å; I32-Q36 VanDerWaalsContact CG2-NE2 3.26Å; I32-Q36 WeakPolarHBondContact O-CG 3.41Å; I32-Q36 PolarHBondContact O-N 2.5Å; I32-Q36 VanDerWaalsContact O-N 3.14Å
33	E	87.8	Confident	76.5	Confident	136 Å²	136	89.5 Å²	89.5	64%	0.636	46%	0.458	S	S	*	.	H	α-helix	trans	-64.5	-38.3	179	-171.6	177.5	-173.8	0	0	112.2	A29 E30 E31 F35 Q36 G37	A29-E33 WeakPolarHBondContact O-CB 3.31Å; A29-E33 PolarHBondContact O-N 3.39Å; E30-E33 PolarHBondContact O-N 3.38Å; E31-E33 VanDerWaalsContact C-N 3.29Å; E31-E33 PolarHBondContact O-N 2.97Å; E33-F35 VanDerWaalsContact C-N 3.29Å; E33-F35 PolarHBondContact O-N 2.99Å; E33-Q36 PolarHBondContact O-N 3.01Å; E33-G37 WeakPolarHBondContact O-CA 3.44Å; E33-G37 PolarHBondContact O-N 3.18Å
34	K	85.9	Confident	74.5	Confident	123 Å²	123	89.2 Å²	89.2	54%	0.535	46%	0.461	S	S	.	.	H	α-helix	trans	-62.6	-35.2	175.1	-71.8	172.6	-152.1	157.5	0	112.9	E30 E31 I32 S38	E30-K34 WeakPolarHBondContact O-CG 3.48Å; E30-K34 PolarHBondContact O-N 3.4Å; E31-K34 PolarHBondContact O-N 3.31Å; E31-K34 IonicContact OE2-NZ 3.53Å; E31-K34 PolarHBondContact OE2-NZ 3.17Å; I32-K34 PolarHBondContact O-N 3.09Å; K34-S38 WeakPolarHBondContact O-CA 3.35Å; K34-S38 VanDerWaalsContact O-CB 3.31Å; K34-S38 WeakPolarHBondContact O-CB 3.49Å; K34-S38 PolarHBondContact O-N 2.92Å; K34-S38 VanDerWaalsContact O-N 3.09Å
35	F	80.1	Confident	72.6	Confident	74 Å²	74	95 Å²	95	33%	0.325	48%	0.481	S	S	.	.	H	α-helix	trans	-69.1	-46	176.4	-88.6	-99.7	0	0	0	111	Y6 L7 E31 I32 E33 G37 S38	Y6-F35 AromaticContact CD1-CE1 3.81Å; Y6-F35 HydrophobicContact CD1-CE1 3.81Å; Y6-F35 AromaticContact CD1-CE2 3.79Å; Y6-F35 HydrophobicContact CD1-CE2 3.79Å; Y6-F35 AromaticContact CD1-CZ 3.35Å; Y6-F35 HydrophobicContact CD1-CZ 3.35Å; Y6-F35 HydrophobicContact CE1-CD2 4.24Å; Y6-F35 HydrophobicContact CE1-CE1 4.24Å; Y6-F35 AromaticContact CE1-CE2 3.36Å; Y6-F35 HydrophobicContact CE1-CE2 3.36Å; Y6-F35 AromaticContact CE1-CZ 3.35Å; Y6-F35 HydrophobicContact CE1-CZ 3.35Å; L7-F35 HydrophobicContact CD1-CB 4.24Å; E31-F35 WeakPolarHBondContact O-CD2 3.49Å; E31-F35 PolarHBondContact O-N 3.26Å; I32-F35 PolarHBondContact O-N 2.89Å; E33-F35 VanDerWaalsContact C-N 3.29Å; E33-F35 PolarHBondContact O-N 2.99Å; F35-G37 VanDerWaalsContact C-N 3.34Å; F35-S38 PolarHBondContact O-OG 3.33Å
36	Q	74.4	Confident	70.8	Confident	131 Å²	131	100.5 Å²	100.5	61%	0.612	50%	0.503	S	S	*	.	H	α-helix	trans	-70.7	-30	179.1	-64.7	177.6	18.9	0	0	112.9	I32 E33	I32-Q36 VanDerWaalsContact CG2-NE2 3.26Å; I32-Q36 WeakPolarHBondContact O-CG 3.41Å; I32-Q36 PolarHBondContact O-N 2.5Å; I32-Q36 VanDerWaalsContact O-N 3.14Å; E33-Q36 PolarHBondContact O-N 3.01Å
37	G	63.9	Low	69.3	Low	43 Å²	43	101.4 Å²	101.4	44%	0.443	51%	0.51	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.6	13.7	-179.9	0	0	0	0	0	114.5	E33 F35 D39 G40	E33-G37 WeakPolarHBondContact O-CA 3.44Å; E33-G37 PolarHBondContact O-N 3.18Å; F35-G37 VanDerWaalsContact C-N 3.34Å; G37-D39 PolarHBondContact O-N 2.95Å; G37-G40 PolarHBondContact O-N 2.94Å
38	S	53.4	Low	68.1	Low	86 Å²	86	104.1 Å²	104.1	60%	0.601	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68	0.1	-177.3	58.1	0	0	0	0	115.2	K34 F35 G40	K34-S38 WeakPolarHBondContact O-CA 3.35Å; K34-S38 VanDerWaalsContact O-CB 3.31Å; K34-S38 WeakPolarHBondContact O-CB 3.49Å; K34-S38 PolarHBondContact O-N 2.92Å; K34-S38 VanDerWaalsContact O-N 3.09Å; F35-S38 PolarHBondContact O-OG 3.33Å; S38-G40 VanDerWaalsContact C-N 3.25Å
39	D	51.5	Low	67.4	Low	150 Å²	150	112 Å²	112	80%	0.802	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71	-17.1	159.8	-90.8	-66.2	0	0	0	113.1	G37	G37-D39 PolarHBondContact O-N 2.95Å
40	G	49.4	Very low	66.9	Low	27 Å²	27	115.1 Å²	115.1	28%	0.278	56%	0.559	S	S	.	*	G	3₁₀ helix	trans	-84.3	-10.7	-169.5	0	0	0	0	0	116.8	G37 S38 K42 E43	G37-G40 PolarHBondContact O-N 2.94Å; S38-G40 VanDerWaalsContact C-N 3.25Å; G40-K42 PolarHBondContact O-N 3.14Å; G40-E43 PolarHBondContact O-N 3.25Å; G40-E43 VanDerWaalsContact O-N 3.1Å
41	K	50.3	Low	66.5	Low	199 Å²	199	115.5 Å²	115.5	87%	0.865	56%	0.563	S	S	*	*	G	3₁₀ helix	trans	-68.3	-13.9	-179.4	-83.5	-173.1	178.8	175.1	0	114.2
42	K	49.4	Very low	66.1	Low	175 Å²	175	118.1 Å²	118.1	76%	0.761	58%	0.582	S	S	*	*	G	3₁₀ helix	trans	-88.6	-16.3	173.1	-69.5	-176.8	-179.8	173.9	0	113.4	G40	G40-K42 PolarHBondContact O-N 3.14Å
43	E	51.1	Low	66.1	Low	94 Å²	94	124.6 Å²	124.6	44%	0.439	62%	0.616	S	S	.	*	H	α-helix	trans	-78.1	-24.8	-172.1	-67.5	-167	165.8	0	0	114.1	G40 E45 E46 K47	G40-E43 PolarHBondContact O-N 3.25Å; G40-E43 VanDerWaalsContact O-N 3.1Å; E43-E45 VanDerWaalsContact C-N 3.28Å; E43-E45 PolarHBondContact O-N 2.8Å; E43-E46 PolarHBondContact O-N 2.85Å; E43-K47 WeakPolarHBondContact O-CG 2.94Å; E43-K47 PolarHBondContact O-N 3.12Å; E43-K47 IonicContact OE2-NZ 2.68Å; E43-K47 PolarHBondContact OE2-NZ 3.49Å
44	D	52.6	Low	65.8	Low	134 Å²	134	120.5 Å²	120.5	72%	0.717	60%	0.602	S	S	*	*	H	α-helix	trans	-68.4	-27.9	-178.5	-84.7	-20	0	0	0	112.7
45	E	51.3	Low	65.5	Low	163 Å²	163	121.5 Å²	121.5	76%	0.762	61%	0.613	S	S	*	*	H	α-helix	trans	-75.9	-38.5	173.5	-103.4	-176.8	163.8	0	0	112.2	E43 K48	E43-E45 VanDerWaalsContact C-N 3.28Å; E43-E45 PolarHBondContact O-N 2.8Å; E45-K48 WeakPolarHBondContact O-CB 3.17Å; E45-K48 PolarHBondContact O-N 3.03Å
46	E	53.9	Low	65.8	Low	156 Å²	156	124.9 Å²	124.9	73%	0.729	63%	0.627	S	S	*	*	H	α-helix	trans	-72.7	-32.7	-179.9	-77.1	-173.9	162.4	0	0	113.1	E43 K48	E43-E46 PolarHBondContact O-N 2.85Å; E46-K48 PolarHBondContact O-N 3.34Å
47	K	60.3	Low	66	Low	144 Å²	144	126.7 Å²	126.7	63%	0.626	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75	-8.3	177.4	-70.4	171.5	-171	158	0	113.8	E43 Y49	E43-K47 WeakPolarHBondContact O-CG 2.94Å; E43-K47 PolarHBondContact O-N 3.12Å; E43-K47 IonicContact OE2-NZ 2.68Å; E43-K47 PolarHBondContact OE2-NZ 3.49Å; K47-Y49 VanDerWaalsContact C-N 3.35Å
48	K	67.8	Low	66.9	Low	155 Å²	155	129.4 Å²	129.4	67%	0.674	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.2	-27.2	-178.5	-169.4	176.3	178.8	-178.5	0	112.9	E45 E46	E45-K48 WeakPolarHBondContact O-CB 3.17Å; E45-K48 PolarHBondContact O-N 3.03Å; E46-K48 PolarHBondContact O-N 3.34Å
49	Y	75.5	Confident	68.3	Low	185 Å²	185	135.2 Å²	135.2	73%	0.725	66%	0.659	S	S	*	*	S	Bend	trans	-112.5	132.6	-177.9	-61.1	-76.4	0	0	0	111.1	K47	K47-Y49 VanDerWaalsContact C-N 3.35Å
50	L	79.3	Confident	69.8	Low	102 Å²	102	135.7 Å²	135.7	53%	0.534	66%	0.661	S	S	.	*			trans	-89.7	126.3	176	-179.3	63.7	0	0	0	110.2	V52 I58	L50-V52 HydrophobicContact CD2-CG1 4.12Å; L50-V52 HydrophobicContact CG-CG1 4.25Å; L50-V52 PolarHBondContact O-N 3.48Å; L50-I58 HydrophobicContact CD1-CD1 3.34Å; L50-I58 HydrophobicContact CD1-CG1 3.68Å; L50-I58 HydrophobicContact CD2-CD1 3.46Å; L50-I58 VanDerWaalsContact CD2-CD1 3.46Å; L50-I58 HydrophobicContact CG-CD1 4Å
51	D	80.8	Confident	71.4	Confident	78 Å²	78	140.2 Å²	140.2	42%	0.417	69%	0.689	S	S	.	*			trans	-79.1	103.1	163.3	176.6	9.7	0	0	0	109.7	I53 S54	D51-I53 VanDerWaalsContact C-N 3.27Å; D51-I53 PolarHBondContact O-N 3Å; D51-I53 PolarHBondContact OD1-N 2.89Å; D51-S54 VanDerWaalsContact OD2-CB 3.24Å; D51-S54 WeakPolarHBondContact OD2-CB 3.4Å; D51-S54 PolarHBondContact OD2-OG 3.27Å
52	V	82.2	Confident	73.1	Confident	110 Å²	110	139.1 Å²	139.1	67%	0.667	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75	-11.1	-177.9	-66.1	0	0	0	0	113.8	L50	L50-V52 HydrophobicContact CD2-CG1 4.12Å; L50-V52 HydrophobicContact CG-CG1 4.25Å; L50-V52 PolarHBondContact O-N 3.48Å
53	I	87.3	Confident	74.8	Confident	152 Å²	152	142.7 Å²	142.7	78%	0.779	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.4	-36.1	-178.8	-57.5	175.2	0	0	0	110.5	D51	D51-I53 VanDerWaalsContact C-N 3.27Å; D51-I53 PolarHBondContact O-N 3Å; D51-I53 PolarHBondContact OD1-N 2.89Å
54	S	81.7	Confident	76.5	Confident	50 Å²	50	143.6 Å²	143.6	35%	0.35	71%	0.707	S	S	.	*	T	Hydrogen-bonded Turn	trans	-85.1	-3.3	-173.6	57.4	0	0	0	0	115.4	D51 K56	D51-S54 VanDerWaalsContact OD2-CB 3.24Å; D51-S54 WeakPolarHBondContact OD2-CB 3.4Å; D51-S54 PolarHBondContact OD2-OG 3.27Å; S54-K56 PolarHBondContact O-N 3.04Å; S54-K56 VanDerWaalsContact O-N 3.1Å; S54-K56 WeakPolarHBondContact OG-CE 3.21Å
55	N	80	Confident	78.1	Confident	143 Å²	143	144.8 Å²	144.8	77%	0.765	71%	0.712	S	S	*	*	T	Hydrogen-bonded Turn	trans	46.7	40.2	175.9	-74.5	-27.9	0	0	0	114.4
56	K	85.1	Confident	79.8	Confident	145 Å²	145	140.2 Å²	140.2	63%	0.63	69%	0.692	S	S	*	*			trans	-72.7	145.6	178	-65.1	175.6	-176.5	172.6	0	110.9	S54	S54-K56 PolarHBondContact O-N 3.04Å; S54-K56 VanDerWaalsContact O-N 3.1Å; S54-K56 WeakPolarHBondContact OG-CE 3.21Å
57	N	79.5	Confident	81.2	Confident	170 Å²	170	135.3 Å²	135.3	91%	0.909	67%	0.674	S	S	*	*			trans	-64.9	134.9	173.8	-60.7	82.1	0	0	0	111.2
58	I	82.9	Confident	82.2	Confident	99 Å²	99	132.5 Å²	132.5	51%	0.508	67%	0.669	S	S	.	*			trans	-109.9	140.7	179.9	-50.6	167	0	0	0	108.6	L50 L60	L50-I58 HydrophobicContact CD1-CD1 3.34Å; L50-I58 HydrophobicContact CD1-CG1 3.68Å; L50-I58 HydrophobicContact CD2-CD1 3.46Å; L50-I58 VanDerWaalsContact CD2-CD1 3.46Å; L50-I58 HydrophobicContact CG-CD1 4Å; I58-L60 HydrophobicContact CG2-CD2 4.02Å; I58-L60 HydrophobicContact CG2-CG 4.12Å
59	K	82.3	Confident	82.8	Confident	208 Å²	208	134.9 Å²	134.9	90%	0.904	68%	0.679	S	S	*	*			trans	-97.9	119.7	168.9	-65.2	-177.9	-178.6	178.7	0	108.8
60	L	82.9	Confident	83.1	Confident	160 Å²	160	133 Å²	133	84%	0.838	68%	0.677	S	S	*	*			trans	-116.6	135.1	174.8	-64	174.2	0	0	0	109	I58	I58-L60 HydrophobicContact CG2-CD2 4.02Å; I58-L60 HydrophobicContact CG2-CG 4.12Å
61	S	83.4	Confident	83	Confident	123 Å²	123	134.7 Å²	134.7	86%	0.86	68%	0.677	S	S	*	*			trans	-141	125.8	176	63.1	0	0	0	0	109.8
62	E	85.6	Confident	82.7	Confident	175 Å²	175	135.5 Å²	135.5	82%	0.818	69%	0.687	S	S	*	*			trans	-115	136.2	176	-172.9	171.6	179.3	0	0	109.9	V64	E62-V64 HydrophobicContact CG-CG2 4.35Å
63	R	85.9	Confident	82	Confident	250 Å²	250	139.6 Å²	139.6	94%	0.943	70%	0.696	S	S	*	*			trans	-98.9	111.3	174.9	-67.8	-173.1	179.8	-178.6	1.1	109
64	V	87.1	Confident	80.8	Confident	114 Å²	114	139.2 Å²	139.2	69%	0.691	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-98.9	137.3	178.1	-177.8	0	0	0	0	110.2	E62	E62-V64 HydrophobicContact CG-CG2 4.35Å
65	L	85.8	Confident	79.5	Confident	158 Å²	158	137.8 Å²	137.8	83%	0.827	68%	0.68	S	S	*	*	P	Polyproline II helix	trans	-76.6	127.7	177.9	-174.8	71.1	0	0	0	110.9
66	I	86	Confident	78.3	Confident	67 Å²	67	134.1 Å²	134.1	34%	0.344	67%	0.67	S	S	.	*	P	Polyproline II helix	trans	-90.5	124.7	171.5	-57	179.1	0	0	0	108.7	V68 C75 L79	I66-V68 HydrophobicContact CB-CG1 4.19Å; I66-V68 HydrophobicContact CG2-CG1 3.75Å; I66-V68 PolarHBondContact O-N 3.11Å; I66-C75 HydrophobicContact CG2-CB 3.49Å; I66-C75 VanDerWaalsContact CG2-CB 3.49Å; I66-L79 HydrophobicContact CD1-CB 4.5Å; I66-L79 HydrophobicContact CD1-CD1 4.26Å; I66-L79 HydrophobicContact CG1-CD1 4.4Å; I66-L79 HydrophobicContact CG2-CD1 4.23Å
67	P	83.3	Confident	76.9	Confident	54 Å²	54	130.5 Å²	130.5	35%	0.351	67%	0.667	S	S	.	*			trans	-78.1	55.7	-174.6	33.7	-37.2	0	0	0	112.7	K69 Q70 Y71	P67-K69 PolarHBondContact O-N 3.5Å; P67-K69 VanDerWaalsContact O-N 3.07Å; P67-Q70 HydrophobicContact CB-CB 4.48Å; P67-Q70 PolarHBondContact O-N 3.39Å; P67-Y71 HydrophobicContact CG-CD2 4.39Å; P67-Y71 PolarHBondContact O-N 3.31Å
68	V	83	Confident	75.7	Confident	84 Å²	84	128.7 Å²	128.7	51%	0.509	66%	0.657	S	S	.	*	T	Hydrogen-bonded Turn	trans	-59.4	-24	-176.3	-62.1	0	0	0	0	113.8	I66 P72	I66-V68 HydrophobicContact CB-CG1 4.19Å; I66-V68 HydrophobicContact CG2-CG1 3.75Å; I66-V68 PolarHBondContact O-N 3.11Å; V68-P72 WeakPolarHBondContact O-CA 3.46Å
69	K	80.1	Confident	74.5	Confident	206 Å²	206	129.5 Å²	129.5	90%	0.896	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	-29.8	177.1	-63.2	-172.5	179.6	-179.4	0	113	P67	P67-K69 PolarHBondContact O-N 3.5Å; P67-K69 VanDerWaalsContact O-N 3.07Å
70	Q	81	Confident	73.2	Confident	146 Å²	146	129.1 Å²	129.1	68%	0.682	66%	0.656	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.2	-36.4	-178.6	-66.4	169.8	-0.1	0	0	110.8	P67	P67-Q70 HydrophobicContact CB-CB 4.48Å; P67-Q70 PolarHBondContact O-N 3.39Å
71	Y	78.3	Confident	71.5	Confident	136 Å²	136	128 Å²	128	53%	0.533	65%	0.651	S	S	.	*			trans	-132.5	73.9	-177.6	-56.5	-76.5	0	0	0	111.7	P67 K73	P67-Y71 HydrophobicContact CG-CD2 4.39Å; P67-Y71 PolarHBondContact O-N 3.31Å; Y71-K73 VanDerWaalsContact C-N 3.27Å; Y71-K73 PolarHBondContact O-N 3Å
72	P	73.4	Confident	69.7	Low	95 Å²	95	128 Å²	128	62%	0.617	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.7	-19.9	-173.7	22.6	-31.9	0	0	0	114.8	V68	V68-P72 WeakPolarHBondContact O-CA 3.46Å
73	K	68.3	Low	67.5	Low	197 Å²	197	123.6 Å²	123.6	86%	0.857	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100	-25.7	-173.6	-64	-177.7	-178.8	178.3	0	114.8	Y71	Y71-K73 VanDerWaalsContact C-N 3.27Å; Y71-K73 PolarHBondContact O-N 3Å
74	E	61.2	Low	65.2	Low	144 Å²	144	116.3 Å²	116.3	67%	0.673	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	-25.5	-170.8	-65.2	-175.6	-174.4	0	0	113.7
75	C	54.6	Low	62.9	Low	19 Å²	19	116.5 Å²	116.5	13%	0.128	63%	0.63	C	S	.	*	H	α-helix	trans	-83.7	-26.1	-173.9	-61.6	0	0	0	0	115.1	I66	I66-C75 HydrophobicContact CG2-CB 3.49Å; I66-C75 VanDerWaalsContact CG2-CB 3.49Å
76	A	55.4	Low	60.6	Low	66 Å²	66	115.6 Å²	115.6	55%	0.545	63%	0.626	S	S	.	*	H	α-helix	trans	-79.3	-32.5	-169.1	0	0	0	0	0	113.9
77	A	54.6	Low	58.4	Low	69 Å²	69	117 Å²	117	57%	0.57	64%	0.641	S	S	*	*	H	α-helix	trans	-90	-33.3	-173.8	0	0	0	0	0	113.8
78	N	54.8	Low	56.2	Low	133 Å²	133	122.7 Å²	122.7	71%	0.711	66%	0.663	S	S	*	*	H	α-helix	trans	-89.3	-20.3	-171.5	-70.7	-27.9	0	0	0	114.4
79	L	57.8	Low	54	Low	116 Å²	116	124 Å²	124	61%	0.607	67%	0.671	S	S	*	*	S	Bend	trans	-92.7	-8.2	179.6	-78.7	154.9	0	0	0	113.6	I66	I66-L79 HydrophobicContact CD1-CB 4.5Å; I66-L79 HydrophobicContact CD1-CD1 4.26Å; I66-L79 HydrophobicContact CG1-CD1 4.4Å; I66-L79 HydrophobicContact CG2-CD1 4.23Å
80	Y	54.6	Low	51.7	Low	200 Å²	200	119.8 Å²	119.8	78%	0.784	66%	0.663	S	S	*	*	S	Bend	trans	-93.4	-1.4	-177.1	-122.5	-91.4	0	0	0	114.1	P82	Y80-P82 VanDerWaalsContact O-CD 3.32Å; Y80-P82 WeakPolarHBondContact O-CD 3.41Å
81	L	47.4	Very low	49.6	Very low	137 Å²	137	120.8 Å²	120.8	72%	0.717	67%	0.667	S	S	*	*	S	Bend	trans	-84.5	112.9	166.4	-89.2	128.6	0	0	0	108.3	A83	L81-A83 PolarHBondContact O-N 3.34Å
82	P	45.3	Very low	47.7	Very low	122 Å²	122	125.4 Å²	125.4	79%	0.792	70%	0.699	S	S	*	*			trans	-67.6	100.6	170.2	28.1	-31.3	0	0	0	107.6	Y80 S84	Y80-P82 VanDerWaalsContact O-CD 3.32Å; Y80-P82 WeakPolarHBondContact O-CD 3.41Å; P82-S84 VanDerWaalsContact C-N 3.29Å; P82-S84 PolarHBondContact O-N 3.3Å
83	A	38.8	Very low	46.5	Very low	82 Å²	82	127 Å²	127	68%	0.678	70%	0.703	S	S	*	*			trans	-62.3	101.2	156.7	0	0	0	0	0	106.1	L81 V85	L81-A83 PolarHBondContact O-N 3.34Å; A83-V85 HydrophobicContact CB-CG2 4.02Å; A83-V85 PolarHBondContact O-N 3.26Å
84	S	38.1	Very low	45.3	Very low	98 Å²	98	123.3 Å²	123.3	69%	0.685	70%	0.695	S	S	*	*			trans	-62.8	86.8	162.9	179.7	0	0	0	0	106.9	P82 N86	P82-S84 VanDerWaalsContact C-N 3.29Å; P82-S84 PolarHBondContact O-N 3.3Å; S84-N86 PolarHBondContact O-N 3.16Å
85	V	39.9	Very low	44.4	Very low	118 Å²	118	122.1 Å²	122.1	72%	0.715	70%	0.696	S	S	*	*			trans	-89.3	87.5	167.7	-173.7	0	0	0	0	105.7	A83 S87	A83-V85 HydrophobicContact CB-CG2 4.02Å; A83-V85 PolarHBondContact O-N 3.26Å; V85-S87 VanDerWaalsContact C-N 3.31Å; V85-S87 PolarHBondContact O-N 2.64Å
86	N	36.8	Very low	43.8	Very low	139 Å²	139	128.2 Å²	128.2	74%	0.743	73%	0.729	S	S	*	*			trans	-65.9	97.3	160.2	-72.8	-36.2	0	0	0	106.8	S84 E88	S84-N86 PolarHBondContact O-N 3.16Å; N86-E88 PolarHBondContact O-N 3.2Å; N86-E88 VanDerWaalsContact O-N 3.13Å
87	S	39.8	Very low	43.1	Very low	96 Å²	96	132.1 Å²	132.1	67%	0.671	74%	0.741	S	S	*	*			trans	-78.3	91.6	169.7	65.2	0	0	0	0	108.7	V85 V89	V85-S87 VanDerWaalsContact C-N 3.31Å; V85-S87 PolarHBondContact O-N 2.64Å; S87-V89 PolarHBondContact O-N 3.35Å
88	E	38	Very low	42.3	Very low	173 Å²	173	136.3 Å²	136.3	81%	0.808	75%	0.752	S	S	*	*			trans	-65	107.2	155.8	-74.3	-178.5	153.8	0	0	107.5	N86 T90	N86-E88 PolarHBondContact O-N 3.2Å; N86-E88 VanDerWaalsContact O-N 3.13Å; E88-T90 VanDerWaalsContact C-N 3.3Å; E88-T90 PolarHBondContact O-N 3.3Å
89	V	35	Very low	41.4	Very low	113 Å²	113	136.5 Å²	136.5	69%	0.685	76%	0.755	S	S	*	*			trans	-75	88.1	171.7	-179	0	0	0	0	107.5	S87 H91	S87-V89 PolarHBondContact O-N 3.35Å; V89-H91 PolarHBondContact O-N 3.45Å
90	T	31.9	Very low	40.2	Very low	117 Å²	117	138.1 Å²	138.1	72%	0.718	77%	0.767	S	S	*	*			trans	-73.9	115.4	164.5	-59.3	0	0	0	0	107.9	E88	E88-T90 VanDerWaalsContact C-N 3.3Å; E88-T90 PolarHBondContact O-N 3.3Å
91	H	37.9	Very low	39	Very low	166 Å²	166	132.9 Å²	132.9	77%	0.769	77%	0.765	S	S	*	*			trans	-67.4	134.4	171.5	-79	41.4	0	0	0	109.9	V89	V89-H91 PolarHBondContact O-N 3.45Å
92	I	39	Very low	38.2	Very low	234 Å²	234	132.5 Å²	132.5	100%	1.2	77%	0.77	S	S	*	*			trans	-122.4	0	154.7	-48.9	179.1	0	0	0	106.6

Retrieved 92 of 92 residues in 24 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).