A0A087WR33_MOUSE Loading...

Glutamate receptor, ionotropic, NMDA2B (epsilon 2)

AlphaFold DB , UniProt , Accession A0A087WR33, Species MOUSE (Mus musculus, Mouse), Gene Grin2b, Length 36 aa.

						>A0A087WR33_MOUSE|A0A087WR33|Grin2b
MKPSAECCSPKFWLVLAVLAVSGSKARSQKSAPSIG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47	Very low	63.1	Low	241 Å²	241	123.3 Å²	123.3	100%	1.187	69%	0.691	S	S	*	*				0	108.4	0	-73.1	165.6	144	0	0	107.7
2	K	53.3	Low	64.8	Low	198 Å²	198	121.6 Å²	121.6	86%	0.861	67%	0.671	S	S	*	*			trans	-76.1	126.9	172.6	-86.9	161.6	160.5	171.9	0	107.1	S4	K2-S4 PolarHBondContact O-N 3.36Å
3	P	59.2	Low	66.4	Low	123 Å²	123	123.1 Å²	123.1	80%	0.799	66%	0.66	S	S	*	*			trans	-65.2	111.3	167.2	26.8	-28.8	0	0	0	106.1	A5	P3-A5 PolarHBondContact O-N 3.35Å
4	S	59.1	Low	68	Low	77 Å²	77	122.8 Å²	122.8	54%	0.538	66%	0.658	S	S	.	*			trans	-50.9	116.7	178.8	-70.6	0	0	0	0	108.6	K2 E6 C7	K2-S4 PolarHBondContact O-N 3.36Å; S4-E6 PolarHBondContact O-N 3.05Å; S4-C7 WeakPolarHBondContact O-CB 3.34Å; S4-C7 PolarHBondContact O-N 3.11Å
5	A	57.3	Low	69.5	Low	83 Å²	83	121.1 Å²	121.1	69%	0.686	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-61.7	-7.5	-179.9	0	0	0	0	0	112.8	P3 C7 C8	P3-A5 PolarHBondContact O-N 3.35Å; A5-C7 PolarHBondContact O-N 3.2Å; A5-C8 PolarHBondContact O-N 2.66Å; A5-C8 VanDerWaalsContact O-N 3.08Å
6	E	56.9	Low	70.5	Confident	161 Å²	161	118.1 Å²	118.1	75%	0.752	64%	0.636	S	S	*	*	G	3₁₀ helix	trans	-58.5	-22.3	166.5	-62.4	179.1	90.3	0	0	112.9	S4 C8	S4-E6 PolarHBondContact O-N 3.05Å; E6-C8 PolarHBondContact O-N 3.28Å
7	C	57.2	Low	71.5	Confident	42 Å²	42	114.4 Å²	114.4	28%	0.284	63%	0.625	S	S	.	*	G	3₁₀ helix	trans	-64.5	-22.2	173.8	-161.1	0	0	0	0	112.2	S4 A5 S9 W13	S4-C7 WeakPolarHBondContact O-CB 3.34Å; S4-C7 PolarHBondContact O-N 3.11Å; A5-C7 PolarHBondContact O-N 3.2Å; C7-S9 PolarHBondContact O-N 2.95Å; C7-S9 VanDerWaalsContact O-N 3.13Å; C7-W13 PolarHBondContact O-NE1 3.23Å; C7-W13 WeakPolarHBondContact SG-CZ2 3.25Å
8	C	64.9	Low	72.5	Confident	101 Å²	101	112.6 Å²	112.6	68%	0.682	62%	0.618	S	S	*	*	G	3₁₀ helix	trans	-76	1.7	-175.5	-64.3	0	0	0	0	114.9	A5 E6 P10	A5-C8 PolarHBondContact O-N 2.66Å; A5-C8 VanDerWaalsContact O-N 3.08Å; E6-C8 PolarHBondContact O-N 3.28Å; C8-P10 WeakPolarHBondContact O-CD 3.42Å
9	S	75.5	Confident	73.2	Confident	55 Å²	55	112.7 Å²	112.7	39%	0.385	62%	0.618	S	S	.	*			trans	-72.6	121.1	175.5	-177.2	0	0	0	0	110.6	C7 K11 F12 W13	C7-S9 PolarHBondContact O-N 2.95Å; C7-S9 VanDerWaalsContact O-N 3.13Å; S9-K11 PolarHBondContact O-N 2.97Å; S9-K11 VanDerWaalsContact O-N 3.11Å; S9-F12 WeakPolarHBondContact O-CB 3.4Å; S9-F12 PolarHBondContact O-N 3.08Å; S9-W13 PolarHBondContact O-N 3.13Å
10	P	79.8	Confident	73.7	Confident	106 Å²	106	109.7 Å²	109.7	69%	0.688	61%	0.608	S	S	*	*	H	α-helix	trans	-57.1	-31.2	179.1	-25.1	34	0	0	0	112.9	C8 L14	C8-P10 WeakPolarHBondContact O-CD 3.42Å; P10-L14 WeakPolarHBondContact O-CB 3.4Å; P10-L14 PolarHBondContact O-N 2.96Å
11	K	83.8	Confident	74	Confident	169 Å²	169	109.7 Å²	109.7	74%	0.735	61%	0.611	S	S	*	*	H	α-helix	trans	-67.6	-38.7	175.6	-79.8	-173	164.5	73.4	0	112.3	S9 L14 V15	S9-K11 PolarHBondContact O-N 2.97Å; S9-K11 VanDerWaalsContact O-N 3.11Å; K11-L14 PolarHBondContact O-N 2.86Å; K11-V15 PolarHBondContact O-N 3.35Å; K11-V15 WeakPolarHBondContact O-CG2 3.21Å
12	F	83.4	Confident	75.6	Confident	103 Å²	103	102 Å²	102	45%	0.452	58%	0.581	S	S	.	*	H	α-helix	trans	-65.5	-46.5	177.9	177.5	-97.7	0	0	0	111	S9 L14 V15 L16	S9-F12 WeakPolarHBondContact O-CB 3.4Å; S9-F12 PolarHBondContact O-N 3.08Å; F12-L14 VanDerWaalsContact C-N 3.28Å; F12-L14 PolarHBondContact O-N 3.45Å; F12-V15 PolarHBondContact O-N 2.88Å; F12-L16 HydrophobicContact CE1-CD2 4.39Å; F12-L16 WeakPolarHBondContact O-CB 3.25Å; F12-L16 PolarHBondContact O-N 2.85Å
13	W	85.6	Confident	76.2	Confident	141 Å²	141	94.2 Å²	94.2	53%	0.534	56%	0.556	S	S	.	*	H	α-helix	trans	-59.5	-38.6	174.1	-77.4	107.6	0	0	0	112.6	C7 S9 L16 A17	C7-W13 PolarHBondContact O-NE1 3.23Å; C7-W13 WeakPolarHBondContact SG-CZ2 3.25Å; S9-W13 PolarHBondContact O-N 3.13Å; W13-L16 HydrophobicContact CZ3-CD2 4.18Å; W13-L16 PolarHBondContact O-N 2.79Å; W13-L16 HydrophobicContact CE3-CD2 4.23Å; W13-A17 VanDerWaalsContact O-CB 3.25Å; W13-A17 WeakPolarHBondContact O-CB 3.42Å; W13-A17 PolarHBondContact O-N 2.94Å
14	L	89.8	Confident	76.1	Confident	119 Å²	119	92 Å²	92	62%	0.623	54%	0.544	S	S	*	.	H	α-helix	trans	-64.9	-46	177.5	-167.6	121.9	0	0	0	111.6	P10 K11 F12 L16 A17 V18	P10-L14 WeakPolarHBondContact O-CB 3.4Å; P10-L14 PolarHBondContact O-N 2.96Å; K11-L14 PolarHBondContact O-N 2.86Å; F12-L14 VanDerWaalsContact C-N 3.28Å; F12-L14 PolarHBondContact O-N 3.45Å; L14-L16 VanDerWaalsContact C-N 3.35Å; L14-L16 PolarHBondContact O-N 3.4Å; L14-A17 PolarHBondContact O-N 3.33Å; L14-V18 PolarHBondContact O-N 2.82Å; L14-V18 WeakPolarHBondContact O-CG2 3.27Å; L14-V18 VanDerWaalsContact O-CG2 3.26Å
15	V	89.6	Confident	75.9	Confident	97 Å²	97	97.2 Å²	97.2	59%	0.588	56%	0.557	S	S	*	*	H	α-helix	trans	-62.1	-43.3	175.5	173.1	0	0	0	0	111	K11 F12 V18 L19	K11-V15 PolarHBondContact O-N 3.35Å; K11-V15 WeakPolarHBondContact O-CG2 3.21Å; F12-V15 PolarHBondContact O-N 2.88Å; V15-V18 PolarHBondContact O-N 3.49Å; V15-L19 WeakPolarHBondContact O-CB 3.36Å; V15-L19 PolarHBondContact O-N 3.01Å; V15-L19 VanDerWaalsContact O-CB 3.3Å
16	L	86.1	Confident	75.8	Confident	74 Å²	74	96.9 Å²	96.9	39%	0.387	55%	0.554	S	S	.	*	H	α-helix	trans	-64.5	-41.5	177.8	-174.9	64.7	0	0	0	111.9	F12 W13 L14 L19 A20	F12-L16 HydrophobicContact CE1-CD2 4.39Å; F12-L16 WeakPolarHBondContact O-CB 3.25Å; F12-L16 PolarHBondContact O-N 2.85Å; W13-L16 HydrophobicContact CZ3-CD2 4.18Å; W13-L16 PolarHBondContact O-N 2.79Å; W13-L16 HydrophobicContact CE3-CD2 4.23Å; L14-L16 VanDerWaalsContact C-N 3.35Å; L14-L16 PolarHBondContact O-N 3.4Å; L16-L19 PolarHBondContact O-N 3.28Å; L16-A20 VanDerWaalsContact O-CB 3.24Å; L16-A20 WeakPolarHBondContact O-CB 3.26Å; L16-A20 PolarHBondContact O-N 2.63Å
17	A	87.3	Confident	75.7	Confident	54 Å²	54	99.7 Å²	99.7	45%	0.446	56%	0.558	S	S	.	*	H	α-helix	trans	-63.6	-45.4	176	0	0	0	0	0	111.4	W13 L14 L19 A20 V21	W13-A17 VanDerWaalsContact O-CB 3.25Å; W13-A17 WeakPolarHBondContact O-CB 3.42Å; W13-A17 PolarHBondContact O-N 2.94Å; L14-A17 PolarHBondContact O-N 3.33Å; A17-L19 VanDerWaalsContact C-N 3.32Å; A17-L19 PolarHBondContact O-N 3.01Å; A17-A20 PolarHBondContact O-N 3.36Å; A17-V21 WeakPolarHBondContact O-CB 3.38Å; A17-V21 VanDerWaalsContact O-CG2 3.27Å; A17-V21 WeakPolarHBondContact O-CG2 3.16Å; A17-V21 PolarHBondContact O-N 3.34Å
18	V	88.8	Confident	75.5	Confident	83 Å²	83	103 Å²	103	50%	0.503	58%	0.581	S	S	.	*	H	α-helix	trans	-60.7	-42.7	175	171.2	0	0	0	0	111	L14 V15 S22	L14-V18 PolarHBondContact O-N 2.82Å; L14-V18 WeakPolarHBondContact O-CG2 3.27Å; L14-V18 VanDerWaalsContact O-CG2 3.26Å; V15-V18 PolarHBondContact O-N 3.49Å; V18-S22 WeakPolarHBondContact O-CB 3.3Å; V18-S22 PolarHBondContact O-N 3.42Å; V18-S22 PolarHBondContact O-OG 2.9Å
19	L	86.1	Confident	75.1	Confident	115 Å²	115	106.6 Å²	106.6	60%	0.602	59%	0.588	S	S	*	*	H	α-helix	trans	-68.4	-39.8	178.4	-171.5	66.5	0	0	0	111.9	V15 L16 A17 G23	V15-L19 WeakPolarHBondContact O-CB 3.36Å; V15-L19 PolarHBondContact O-N 3.01Å; V15-L19 VanDerWaalsContact O-CB 3.3Å; L16-L19 PolarHBondContact O-N 3.28Å; A17-L19 VanDerWaalsContact C-N 3.32Å; A17-L19 PolarHBondContact O-N 3.01Å; L19-G23 WeakPolarHBondContact O-CA 3.24Å; L19-G23 PolarHBondContact O-N 3.38Å
20	A	83.9	Confident	74.3	Confident	52 Å²	52	112.8 Å²	112.8	43%	0.43	61%	0.608	S	S	.	*	H	α-helix	trans	-67.5	-43.9	177	0	0	0	0	0	111.2	L16 A17 S24	L16-A20 VanDerWaalsContact O-CB 3.24Å; L16-A20 WeakPolarHBondContact O-CB 3.26Å; L16-A20 PolarHBondContact O-N 2.63Å; A17-A20 PolarHBondContact O-N 3.36Å; A20-S24 WeakPolarHBondContact O-CB 3.36Å; A20-S24 PolarHBondContact O-N 3.47Å; A20-S24 PolarHBondContact O-OG 2.79Å
21	V	80.3	Confident	73.3	Confident	110 Å²	110	113.1 Å²	113.1	67%	0.667	61%	0.613	S	S	*	*	H	α-helix	trans	-64	-45.8	174.9	170.1	0	0	0	0	110.9	A17	A17-V21 WeakPolarHBondContact O-CB 3.38Å; A17-V21 VanDerWaalsContact O-CG2 3.27Å; A17-V21 WeakPolarHBondContact O-CG2 3.16Å; A17-V21 PolarHBondContact O-N 3.34Å
22	S	80.3	Confident	72.2	Confident	79 Å²	79	109.3 Å²	109.3	55%	0.552	61%	0.613	S	S	*	*	H	α-helix	trans	-69.9	-41.7	179.7	-58.1	0	0	0	0	112.5	V18	V18-S22 WeakPolarHBondContact O-CB 3.3Å; V18-S22 PolarHBondContact O-N 3.42Å; V18-S22 PolarHBondContact O-OG 2.9Å
23	G	65.3	Low	71	Confident	34 Å²	34	110 Å²	110	35%	0.351	63%	0.628	S	S	.	*	H	α-helix	trans	-78	-22.6	-178.6	0	0	0	0	0	114.2	L19 K25 A26 R27	L19-G23 WeakPolarHBondContact O-CA 3.24Å; L19-G23 PolarHBondContact O-N 3.38Å; G23-K25 PolarHBondContact O-N 3.05Å; G23-A26 WeakPolarHBondContact O-CA 3.47Å; G23-A26 WeakPolarHBondContact O-CB 3.44Å; G23-A26 PolarHBondContact O-N 3.44Å; G23-R27 VanDerWaalsContact O-N 3.11Å; G23-R27 PolarHBondContact O-N 3.2Å
24	S	57.6	Low	69.7	Low	77 Å²	77	108.6 Å²	108.6	54%	0.538	64%	0.639	S	S	.	*	H	α-helix	trans	-63.9	-29.5	173.5	-69.3	0	0	0	0	112.2	A20 A26 R27 S28	A20-S24 WeakPolarHBondContact O-CB 3.36Å; A20-S24 PolarHBondContact O-N 3.47Å; A20-S24 PolarHBondContact O-OG 2.79Å; S24-A26 PolarHBondContact O-N 2.89Å; S24-R27 PolarHBondContact O-N 2.74Å; S24-S28 PolarHBondContact O-N 3.11Å
25	K	55.8	Low	68.2	Low	187 Å²	187	111.1 Å²	111.1	81%	0.813	65%	0.652	S	S	*	*	H	α-helix	trans	-75.8	-6.3	171.8	-165.9	174	147.2	74.7	0	113.3	G23	G23-K25 PolarHBondContact O-N 3.05Å
26	A	55.1	Low	66.1	Low	75 Å²	75	113 Å²	113	62%	0.62	69%	0.691	S	S	*	*	H	α-helix	trans	-102.3	-23	172.3	0	0	0	0	0	112.8	G23 S24	G23-A26 WeakPolarHBondContact O-CA 3.47Å; G23-A26 WeakPolarHBondContact O-CB 3.44Å; G23-A26 PolarHBondContact O-N 3.44Å; S24-A26 PolarHBondContact O-N 2.89Å
27	R	54.3	Low	65.1	Low	220 Å²	220	115 Å²	115	83%	0.83	71%	0.706	S	S	*	*	H	α-helix	trans	-87.5	-15.8	179.4	-152.4	-171.9	156.6	-162.6	-7.6	113.9	G23 S24 Q29	G23-R27 VanDerWaalsContact O-N 3.11Å; G23-R27 PolarHBondContact O-N 3.2Å; S24-R27 PolarHBondContact O-N 2.74Å; R27-Q29 PolarHBondContact O-N 2.93Å
28	S	53.1	Low	63.9	Low	112 Å²	112	118.2 Å²	118.2	78%	0.783	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.1	28.6	172.1	-157.5	0	0	0	0	113.2	S24	S24-S28 PolarHBondContact O-N 3.11Å
29	Q	56.8	Low	62.6	Low	176 Å²	176	120.1 Å²	120.1	82%	0.822	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-139.2	15.4	172.8	-150.2	-172.4	-48.4	0	0	113.9	R27	R27-Q29 PolarHBondContact O-N 2.93Å
30	K	57.2	Low	61.2	Low	186 Å²	186	120.4 Å²	120.4	81%	0.809	74%	0.739	S	S	*	*	S	Bend	trans	-124.9	16.5	175.8	-165.1	132.5	-180	-177.2	0	115.2
31	S	59.7	Low	59.7	Low	112 Å²	112	124.7 Å²	124.7	78%	0.783	76%	0.759	S	S	*	*			trans	-145.2	55.7	165.2	-63.9	0	0	0	0	110.2	P33	S31-P33 WeakPolarHBondContact O-CD 3.43Å
32	A	60.3	Low	58.4	Low	89 Å²	89	125.7 Å²	125.7	74%	0.736	77%	0.765	S	S	*	*			trans	-71.6	117.8	141.5	0	0	0	0	0	104.6	S34	A32-S34 PolarHBondContact O-N 2.87Å; A32-S34 VanDerWaalsContact O-N 3.13Å
33	P	58.6	Low	56.8	Low	117 Å²	117	129 Å²	129	76%	0.76	78%	0.78	S	S	*	*			trans	-58	122.3	166.3	25.1	-29.5	0	0	0	106	S31 I35	S31-P33 WeakPolarHBondContact O-CD 3.43Å; P33-I35 VanDerWaalsContact C-N 3.27Å; P33-I35 PolarHBondContact O-N 3.13Å
34	S	57.2	Low	56.2	Low	112 Å²	112	136.3 Å²	136.3	78%	0.783	81%	0.813	S	S	*	*			trans	-60.9	99.8	165.7	-170.5	0	0	0	0	106.1	A32	A32-S34 PolarHBondContact O-N 2.87Å; A32-S34 VanDerWaalsContact O-N 3.13Å
35	I	58.3	Low	56	Low	172 Å²	172	141.3 Å²	141.3	88%	0.882	84%	0.836	S	S	*	*			trans	-87.7	110	159.4	-141.8	167.9	0	0	0	104.1	P33	P33-I35 VanDerWaalsContact C-N 3.27Å; P33-I35 PolarHBondContact O-N 3.13Å
36	G	46.1	Very low	56.1	Low	137 Å²	137	137.1 Å²	137.1	100%	1.412	84%	0.838	S	S	*	*			trans	153.2	0	-171.5	0	0	0	0	0	110.2

Retrieved 36 of 36 residues in 10.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).